spacer

EBI Dbfetch

ID   FN870147; SV 1; linear; genomic DNA; STD; HUM; 2926 BP.
XX
AC   FN870147;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*460101V
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2926
RA   Qu J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Wang L., Liao K., Huang C., Zhen H., Tian Z.,
RA   Zhang H., Shen M.;
RT   "Identification of HLA-I gene's full length";
RL   Unpublished.
XX
DR   MD5; 0365b2cc57f5378e5abcd575b2978c6a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2926
FT                   /organism="Homo sapiens"
FT                   /isolate="LHLAD000448"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(238..310,440..709,955..1230,1806..2081,2186..2302,
FT                   2744..2776,2883..2926)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GM40"
FT                   /db_xref="IMGT/HLA:B*46:24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D7GM40"
FT                   /protein_id="CBM41447.1"
FT                   /translation="MRVTAPRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVLSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <238..310
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=1
FT   intron          311..439
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=1
FT   exon            440..709
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=2
FT   intron          710..954
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=2
FT   exon            955..1230
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=3
FT   intron          1231..1805
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=3
FT   exon            1806..2081
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=4
FT   intron          2082..2185
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=4
FT   exon            2186..2302
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=5
FT   intron          2303..2743
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=5
FT   exon            2744..2776
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=6
FT   intron          2777..2882
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=6
FT   exon            2883..>2926
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*460101V"
FT                   /number=7
XX
SQ   Sequence 2926 BP; 538 A; 882 C; 919 G; 587 T; 0 other;
     gctccgagag ccttgtctgc attggggagg cgcagcgttg gggattcccc actcccacga        60
     gtttcacttc ttctcccaac ctatgtcggg tccttcttcc aggatactcg tgacgcgtcc       120
     ccatttccca ctcccattgg gtgtcgggtg tctagagaag ccaatcagtg tcgccggggt       180
     cccagttcta aagtccccac gcacccaccc ggactcaaaa tctcctcaga cgccgagatg       240
     cgggtcacgg cgccccgaac cgtcctcctg ctgctctcgg gagccctggc cctgaccgag       300
     acctgggccg gtgagtgcgg ggtcggcagg gaaatggcct ctgtggggag gagcgagggg       360
     accgcaggcg ggggcgcagg acccggggag ccgcgccggg aggagggtcg ggcgggtctc       420
     agcccctcct cgcccccagg ctcccactcc atgaggtatt tctacaccgc catgtcccgg       480
     cccggccgcg gggagccccg cttcatcgca gtgggctacg tggacgacac ccagttcgtg       540
     aggttcgaca gcgacgccgc gagtccgagg atggcgcccc gggcgccatg gatagagcag       600
     gaggggccgg agtattggga ccgggagaca cagaagtaca agcgccaggc acagactgac       660
     cgagtgagcc tgcggaacct gcgcggctac tacaaccaga gcgaggccgg tgagtgaccc       720
     cggcctgggg cgcaggtcac gactccccat cccccacgta cggcccgggt cgccccgagt       780
     ctccgggtcc gagatccgcc cccctgaggc cgcgggaccc gcccaaaccc tcgaccggcg       840
     agagccccag gcgcgtttac ccggtttcat tttcagttga ggccaaaatc cccgcgggtt       900
     ggtcggggcg gggcggggct cgggggacgg ggctgaccgc ggggcctggg ccagggtctc       960
     acaccctcca gaggatgtac ggctgcgacg tggggccgga cgggcgcctc ctccgcgggc      1020
     atgaccagtc cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgagctcct      1080
     ggaccgcggc ggacacggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgagg      1140
     cggagcagtg gagagcctac ctggagggcc tgtgcgtgga gtggctccgc agatacctgg      1200
     agaacgggaa ggagacgctg cagcgcgcgg gtaccagggg cagtggggag ccttccccat      1260
     ctcctatagg tcgccgggga tggcctccca cgagaagagg aggaaaatgg gatcagcgct      1320
     agaatgtcgc cctcccttga atggagaatg gcatgagttt tcctgagttt cctctgaggg      1380
     ccccctcttc tctctaggac aattaaggga tgacgtctct gaggaaatgg aggggaagac      1440
     agtccctagg atagtgatca ggggtcccct ttgacccctg cagcagcctt gggaaccgtg      1500
     acttttcctc tcaggccttg ttctctgcct cacactcagt gtgtttgggg ctctgattcc      1560
     agcacttctg agtcacttta cctccactca gatcaggagc agaagtccct gttccccgct      1620
     cagagactcg aactttccaa tgaataggag attatcccag gtgcctgcgt ccaggctggt      1680
     gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt ccattctcag gctggtcaca      1740
     tgggtggtcc tagggtgtcc catgagagat gcaaagcgcc tgaattttct gactcttccc      1800
     atcagacccc ccaaagacac atgtgaccca ccaccccatc tctgaccatg aggccaccct      1860
     gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc agcgggatgg      1920
     cgaggaccaa actcaggaca ccgagcttgt ggagaccaga ccagcaggag atagaacctt      1980
     ccagaagtgg gcagctgtgg tggtgctttc tggagaagag cagagataca catgccatgt      2040
     acagcatgag gggctgccga agcccctcac cctgagatgg ggtaaggagg gggatgaggg      2100
     gtcatatctg ttctcaggga aagcaggagc ccttctggag cccttcagca gggtcagggc      2160
     ccctcatctt cccctccttt cccagagcca tcttcccagt ccaccatccc catcgtgggc      2220
     attgttgctg gcctggctgt cctagcagtt gtggtcatcg gagctgtggt cgctactgtg      2280
     atgtgtagga ggaagagctc aggtagggaa ggggtgaggg gtggggtctg ggttttcttg      2340
     tcccactggg ggtttcaagc cccaggtaga agtgttccct gcctcattac tgggaagcag      2400
     catccacaca ggggctaacg cagcctggga ccctgtgtgc cagcacttac tcttttgtgc      2460
     agcacatgtg acaatgaagg acagatgtat cgccttgatg gttgtggtgt tggggtcctg      2520
     attccagcat tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt      2580
     tggtccagga cccacacttg ctttcctcgt gtttcctgat cctgccctgg gtctgtagtc      2640
     atacttctgg aaattccttt tggttccaag acgaggaggt tcctctaaga tctcatggtc      2700
     ctgcttcctc ccagtcccct cacaggacat tttcttccca caggtggaaa aggagggagc      2760
     tactctcagg ctgcgtgtaa gtggtggggg tgggagtgtg gaggagctca cccaccccat      2820
     aattcctcct gtcccacgtc tcctgcgggc tctgaccagg tcctgttttt gttctactcc      2880
     agccagcgac agtgcccagg gctctgatgt gtctctcaca gcttga                     2926
//


spacer
spacer