Dbfetch

ID   FN870146; SV 1; linear; genomic DNA; STD; HUM; 2898 BP.
XX
AC   FN870146;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*580101V
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2898
RA   Qu J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Wang L., Liao K., Huang C., Zhen H., Tian Z.,
RA   Zhang H., Shen M.;
RT   "Identification of HLA-I gene's full length";
RL   Unpublished.
XX
DR   MD5; 29d224f4f9b6aa02e792defdd69c2e3d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2898
FT                   /organism="Homo sapiens"
FT                   /isolate="LHLAD000162"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(139..211,341..610,856..1131,1707..1982,2087..2203,
FT                   2645..2677,2784..2827)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5QT34"
FT                   /db_xref="IMGT/HLA:B*58:01:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QT34"
FT                   /protein_id="CBM41446.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <139..211
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=1
FT   intron          212..340
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=1
FT   exon            341..610
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=2
FT   intron          611..855
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=2
FT   exon            856..1131
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=3
FT   intron          1132..1706
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=3
FT   exon            1707..1982
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=4
FT   intron          1983..2086
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=4
FT   exon            2087..2203
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=5
FT   intron          2204..2644
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=5
FT   exon            2645..2677
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=6
FT   intron          2678..2783
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=6
FT   exon            2784..>2827
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101V"
FT                   /number=7
XX
SQ   Sequence 2898 BP; 538 A; 852 C; 932 G; 576 T; 0 other;
     caggatactc gtgacgcgtc cccatttccc actcccattg ggtgtcggat atctagagaa        60
     gccaatcagt gtcgccgggg tcccagttct aaagtcccca cgcacccacc cggactcaga       120
     atctcctcag acgccgagat gcgggtcacg gcgccccgaa ccgtcctcct gctgctctgg       180
     ggggcagtgg ccctgaccga gacctgggcc ggtgagtgcg gggtcgggag ggaaatggcc       240
     tctgtgggga ggagcgaggg gaccgcaggc gggggcgcag gacctgagga gccgcgccgg       300
     gaggagggtc gggcgggtct cagcccctcc tcgcccccag gctcccactc catgaggtat       360
     ttctacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac       420
     gtggacgaca cccagttcgt gaggttcgac agcgacgccg cgagtccgag gacggagccc       480
     cgggcgccat ggatagagca ggaggggccg gagtattggg acggggagac acggaacatg       540
     aaggcctccg cgcagactta ccgagagaac ctgcggatcg cgctccgcta ctacaaccag       600
     agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgactcccca tcccccacgt       660
     acggcccggg tcgccccgag tctccgggtc cgagatccgc ctccctgagg ccgcgggacc       720
     cgcccagacc ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg       780
     aggccaaaat ccccgcgggt tggtcggggc ggggcggggc tcgggggacg gggctgaccg       840
     cggggccggg gccagggtct cacatcatcc agaggatgta tggctgcgac ctggggcccg       900
     acgggcgcct cctccgcggg catgaccagt ccgcctacga cggcaaggat tacatcgccc       960
     tgaacgagga cctgagctcc tggaccgcgg cggacaccgc ggctcagatc acccagcgca      1020
     agtgggaggc ggcccgtgtg gcggagcagc tgagagccta cctggagggc ctgtgcgtgg      1080
     agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcgcg ggtaccaggg      1140
     gcagtgggga gccttcccca tctcctatag gtcgccgggg atggcctccc acgagaagag      1200
     gaggaaaatg ggatcagcgc tagaatgtcg ccctcccttg aatggagaat ggcatgagtt      1260
     ttcctgagtt tcctctgagg gccccctctt ctctctagga caattaaggg atgacgtctc      1320
     tgaggaaatg gaggggaaga cagtccctag aatactgatc aggggtcccc tttgacccct      1380
     gcagcagcct tgggaaccgt gacttttcct ctcaggcctt gttctctgcc tcacactcag      1440
     tgtgtttggg gctctgattc cagcacttct gagtcacttt acctccactc agatcaggag      1500
     cagaagtccc tgttccccgc tcagagactc gaactttcca atgaatagga gattatccca      1560
     ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacacc aggtgtcctg      1620
     tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc      1680
     ctgaattttc tgactcttcc catcagaccc cccaaagaca cacgtgaccc accaccccgt      1740
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1800
     actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg tggagaccag      1860
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga      1920
     gcagagatac acatgccatg tacagcatga ggggctgcca aagcccctca ccctgagatg      1980
     gggtaaggag ggggatgagg ggtcatatct cttctcaggg aaagcaggag cccttctgga      2040
     gcccttcagc agggtcaggg cccctcgtct tcccctcctt tcccagagcc atcttcccag      2100
     tccaccatcc ccatcgtggg cattgttgct ggcctggctg tcctagcagt tgtggtcatc      2160
     ggagctgtgg tcgctactgt gatgtgtagg aggaagagct caggtaggga aggggtgagg      2220
     ggtggggtct gggttttctt gtcccactgg gggtttcaag ccccaggtag aagtgttccc      2280
     tgcctcatta ctgggaagca gcatccacac aggggctaac gcagcctggg accctgtgtg      2340
     ccagcactta ctcttttgtg cagcacatgt gacaatgaag gacggatgta tcaccttgat      2400
     ggttgtggtg ttggggtcct gatttcagca ttcatgagtc aggggaaggt ccctgctaag      2460
     gacagacctt aggagggcag ttggtccagg acccacactt gctttcctcg tgtttcctga      2520
     tcctgccttg ggtctgtagt catacttctg gaaattcctt ttgggtccaa gacgaggagg      2580
     ttcctctaag atctcatggc cctgcttcct cccagtcccc tcacaggaca ttttcttccc      2640
     acaggtggaa aaggagggag ctactctcag gctgcgtgta agtggtgggg gtgggagtgt      2700
     ggaggagctc acccacccca taattcctcc tgtcccacgt ctcctgcggg ctctgaccag      2760
     gtcctgtttt tgttctactc cagccagcga cagtgcccag ggctctgatg tgtctctcac      2820
     agcttgaaaa ggtgagattc ttggggtcta gagtgggtgg ggtggcgggt ctgggggtgg      2880
     gtggggcaga ggggaaag                                                    2898
//