spacer

EBI Dbfetch

ID   FN870145; SV 1; linear; genomic DNA; STD; HUM; 3004 BP.
XX
AC   FN870145;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*58
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3004
RA   Qu J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Wang L., Liao K., Huang C., Zhen H., Tian Z.,
RA   Zhang H., Shen M.;
RT   "Identification of HLA-I gene's full length";
RL   Unpublished.
XX
DR   MD5; 8507d0acf3a65b125d7ff5bd6c4d1e8b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3004
FT                   /organism="Homo sapiens"
FT                   /isolate="D1000535"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(144..216,346..615,861..1136,1712..1964,2069..2171)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GM38"
FT                   /db_xref="IMGT/HLA:B*58:31N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D7GM38"
FT                   /protein_id="CBM41445.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLRAIFPVHHPHRGHCCWPGCPSSCGHRSCGRYCDV"
FT   exon            <144..216
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=1
FT   intron          217..345
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=1
FT   exon            346..615
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=2
FT   intron          616..860
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=2
FT   exon            861..1136
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=3
FT   intron          1137..1711
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=3
FT   exon            1712..1964
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=4
FT   intron          1965..2068
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=4
FT   exon            2069..>2171
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58"
FT                   /number=5
XX
SQ   Sequence 3004 BP; 554 A; 865 C; 963 G; 622 T; 0 other;
     tcttccagga tactcgtgac gcgtccccat ttcccactcc cattgggtgt cggatatcta        60
     gagaagccaa tcagtgtcgc cggggtccca gttctaaagt ccccacgcac ccacccggac       120
     tcagaatctc ctcagacgcc gagatgcggg tcacggcgcc ccgaaccgtc ctcctgctgc       180
     tctggggggc agtggccctg accgagacct gggccggtga gtgcggggtc gggagggaaa       240
     tggcctctgt ggggaggagc gaggggaccg caggcggggg cgcaggacct gaggagccgc       300
     gccgggagga gggtcgggcg ggtctcagcc cctcctcgcc cccaggctcc cactccatga       360
     ggtatttcta caccgccatg tcccggcccg gccgcgggga gccccgcttc atcgcagtgg       420
     gctacgtgga cgacacccag ttcgtgaggt tcgacagcga cgccgcgagt ccgaggacgg       480
     agccccgggc gccatggata gagcaggagg ggccggagta ttgggacggg gagacacgga       540
     acatgaaggc ctccgcgcag acttaccgag agaacctgcg gatcgcgctc cgctactaca       600
     accagagcga ggccggtgag tgaccccggc ccggggcgca ggtcacgact ccccatcccc       660
     cacgtacggc ccgggtcgcc ccgagtctcc gggtccgaga tccgcctccc tgaggccgcg       720
     ggacccgccc agaccctcga ccggcgagag ccccaggcgc gtttacccgg tttcattttc       780
     agttgaggcc aaaatccccg cgggttggtc ggggcggggc ggggctcggg ggacggggct       840
     gaccgcgggg ccggggccag ggtctcacat catccagagg atgtatggct gcgacctggg       900
     gcccgacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat       960
     cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca      1020
     gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg      1080
     cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgggtac      1140
     caggggcagt ggggagcctt ccccatctcc tataggtcgc cggggatggc ctcccacgag      1200
     aagaggagga aaatgggatc agcgctagaa tgtcgccctc ccttgaatgg agaatggcat      1260
     gagttttcct gagtttcctc tgagggcccc ctcttctctc taggacaatt aagggatgac      1320
     gtctctgagg aaatggaggg gaagacagtc cctagaatac tgatcagggg tcccctttga      1380
     cccctgcagc agccttggga accgtgactt ttcctctcag gccttgttct ctgcctcaca      1440
     ctcagtgtgt ttggggctct gattccagca cttctgagtc actttacctc cactcagatc      1500
     aggagcagaa gtccctgttc cccgctcaga gactcgaact ttccaatgaa taggagatta      1560
     tcccaggtgc ctgcgtccag gctggtgtct gggttctgtg ccccttcccc acaccaggtg      1620
     tcctgtccat tctcaggctg gtcacatggg tggtcctagg gtgtcccatg agagatgcaa      1680
     agcgcctgaa ttttctgact cttcccatca gaccccccaa agacacacgt gacccaccac      1740
     cccgtctctg accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag      1800
     atcacactga cctggcagcg ggatggcgag gaccaaactc aggacactga gcttgtggag      1860
     accagaccag caggagatag aaccttccag aagtgggcag ctgtggtggt gccttctgga      1920
     gaagagcaga gatacacatg ccatgtacag catgaggggc ttcggtaagg agggggatga      1980
     ggggtcatat ctcttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag      2040
     ggcccctcgt cttcccctcc tttcccagag ccatcttccc agtccaccat ccccatcgtg      2100
     ggcattgttg ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctact      2160
     gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga ggggtggggt ctgggttttc      2220
     ttgtcccact gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag      2280
     cagcatccac acaggggcta acgcagcctg ggaccctgtg tgccagcact tactcttttg      2340
     tgcagcacat gtgacaatga aggacggatg tatcaccttg atggttgtgg tgttggggtc      2400
     ctgatttcag cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc      2460
     agttggtcca ggacccacac ttgctttcct cgtgtttcct gatcctgcct tgggtctgta      2520
     gtcatacttc tggaaattcc ttttgggtcc aagacgagga ggttcctcta agatctcatg      2580
     gccctgcttc ctcccagtcc cctcacagga cattttcttc ccacaggtgg aaaaggaggg      2640
     agctactctc aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc      2700
     cataattcct cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac      2760
     tccagccagc gacagtgccc agggctctga tgtgtctctc acagcttgaa aaggtgagat      2820
     tcttggggtc tagagtgggt ggggtggcgg gtctgggggt gggtggggca gaggggaaag      2880
     gcctgggtaa tggggattct ttgattggga tgtttcgcgt gtgtggtggg ctgtttagag      2940
     tgtcatcgct taccatgact aaccagaatt tgttcatgac tgttgttttc tgtagcctga      3000
     gaca                                                                   3004
//


spacer
spacer