spacer

EBI Dbfetch

ID   FN870144; SV 1; linear; genomic DNA; STD; HUM; 2838 BP.
XX
AC   FN870144;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*400102V
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2838
RA   Qu J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Liao K.;
RT   "Identification of HLA-I gene's whole length";
RL   Unpublished.
XX
DR   MD5; 545278e3733c7bebdea47e819fbb9189.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2838
FT                   /organism="Homo sapiens"
FT                   /isolate="D1000668"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(97..169,298..567,813..1088,1663..1938,2032..2148,
FT                   2590..2622,2729..2772)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GM37"
FT                   /db_xref="IMGT/HLA:B*40:147"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D7GM37"
FT                   /protein_id="CBM41444.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYGESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <97..169
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=1
FT   intron          170..297
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=1
FT   exon            298..567
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=2
FT   intron          568..812
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=2
FT   exon            813..1088
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=3
FT   intron          1089..1662
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=3
FT   exon            1663..1938
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=4
FT   intron          1939..2031
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=4
FT   exon            2032..2148
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=5
FT   intron          2149..2589
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=5
FT   exon            2590..2622
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=6
FT   intron          2623..2728
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=6
FT   exon            2729..>2772
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*400102V"
FT                   /number=7
XX
SQ   Sequence 2838 BP; 530 A; 832 C; 912 G; 564 T; 0 other;
     tgtcgggtgt ctagagaagc caatcagcgt cgccgtggtc ccagttctaa agtccccacg        60
     cacccacccg gactcagaat ctcctcagac gccgagatgc gggtcacggc accccgaacc       120
     gtcctcctgc tgctctcggc ggccctggcc ctgaccgaga cctgggccgg tgagtgcggg       180
     tcggcaggga aatggcctct gtggggagga gcgaggggac cgcaggcggg ggcgcaggac       240
     ccggggagcc gcgccgggag gagggtcggg cgggtctcag ctcctcctcg cccccaggct       300
     cccactccat gaggtatttc cacaccgcca tgtcccggcc cggccgcggg gagccccgct       360
     tcatcaccgt gggctacgtg gacgacacgc tgttcgtgag gttcgacagc gacgccacga       420
     gtccgaggaa ggagccgcgg gcgccatgga tagagcagga ggggccggag tattgggacc       480
     gggagacaca gatctccaag accaacacac agacttacgg agagagcctg cggaacctgc       540
     gcggctacta caaccagagc gaggccggtg agtgaccccg gcccggggcg caggtcacga       600
     ctccccatcc cccacgtacg gcccgggtcg ccccgagtct ccgggtccga gatccgaccc       660
     cctgaggccg cgggacccgc ccagaccctc gaccggcgag agccccaggc gcgtttaccc       720
     ggtttcattt tcagttgagg ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg       780
     ggggactggg ctgaccgcgg ggccggggcc agggtctcac accctccaga ggatgtacgg       840
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggcat aaccagtacg cctacgacgg       900
     caaggattac atcgccctga acgaggacct gcgctcctgg accgccgcgg acacggcggc       960
     tcagatctcc cagcgcaagt tggaggcggc ccgtgtggcg gagcagctga gagcctacct      1020
     ggagggcgag tgcgtggagt ggctccgcag atacctggag aacgggaagg acaagctgga      1080
     gcgcgctggt accaggggca gtggggagcc ttccccatct cctataggtc gccggggatg      1140
     gcctcccacg agaagaggag gaaaatggga tcagcgctag aatgtcgccc tccgttgaat      1200
     ggagaatggc atgagttttc ctgagtttcc tctgagggcc ccctcttctc tctagacaat      1260
     taaggaatga cgtctctgag gaaatggagg ggaagacagt ccctagaata ctgatcaggg      1320
     gtcccctttg acccctgcag cagccttggg aaccgtgact tttcctctca ggccttgttc      1380
     tctgcctcac actcagtgtg tttggggctc tgattccagc acttctgagt cactttacct      1440
     ccactcagat caggagcaga agtccctgtt ccccgctcag agactcgaac tttccaatga      1500
     ataggagatt atcccaggtg cctgcgtcca ggctggtgtc tgggttctgt gccccttccc      1560
     caccccaggt gtcctgtcca ttctcaggct ggtcacatgg gtggtcctag ggtgtcccat      1620
     gaaagatgca aagcgcctga attttctgac tcttcccatc agacccccca aagacacacg      1680
     tgacccacca ccccatctct gaccatgagg ccaccctgag gtgctgggcc ctgggtttct      1740
     accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact caggacactg      1800
     agcttgtgga gaccagacca gcaggagata gaaccttcca gaagtgggca gctgtggtgg      1860
     tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg ctgccgaagc      1920
     ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc tcagggaaag      1980
     caggagccct tcagcagggt cagggcccct catcttcccc tcctttccca gagccgtctt      2040
     cccagtccac cgtccccatc gtgggcattg ttgctggcct ggctgtccta gcagttgtgg      2100
     tcatcggagc tgtggtcgct gctgtgatgt gtaggaggaa gagttcaggt agggaagggg      2160
     tgaggggtgg ggtctgggtt ttcttgtccc actgggggtt tcaagcccca ggtagaagtg      2220
     ttccctgcct cattactggg aagcagcatg cacacagggg ctaacgcagc ctgggaccct      2280
     gtgtgccagc acttactctt ttgtgcagca catgtgacaa tgaaggatgg atgtatcacc      2340
     ttgatggttg tggtgttggg gtcctgattc cagcattcat gagtcagggg aaggtccctg      2400
     ctaaggacag accttaggag ggcagttggt ccaggaccca cacttgcttt cctcgtgttt      2460
     cctgatcctg ccctgggtct gtagtcatac ttctggaaat tccttttggg tccaagacta      2520
     ggaggttcct ctaagatctc atggccctgc ttcctcccag tgccctcaca ggacattttc      2580
     ttcccacagg tggaaaagga gggagctact ctcaggctgc gtgtaagtgg tgggggtggg      2640
     agtgtggagg agctcaccca ccccataatt cctcctgtcc cacgtctcct gcgggctctg      2700
     accaggtcct gtttttgttc tactccaggc agcgacagtg cccagggctc tgatgtgtct      2760
     ctcacagctt gaaaaggtga gattcttggg gtctagagtg ggtggggtgg cgggtctggg      2820
     ggtgggtggg gcagaggg                                                    2838
//


spacer
spacer