spacer

EBI Dbfetch

ID   FN870143; SV 1; linear; genomic DNA; STD; HUM; 3148 BP.
XX
AC   FN870143;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*0203
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3148
RA   Qu J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Liao K.;
RT   "Identification of HLA-I gene's whole length";
RL   Unpublished.
XX
DR   MD5; 6ec792b8a5944a6edb0c1acc18ee1418.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3148
FT                   /organism="Homo sapiens"
FT                   /isolate="D1000957"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(57..129,260..529,771..1046,1647..1922,2022..2138,
FT                   2577..2609,2752..2799,2969..2973)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q2LC95"
FT                   /db_xref="IMGT/HLA:A*02:03:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2LC95"
FT                   /protein_id="CBM41443.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <57..129
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=1
FT   intron          130..259
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=1
FT   exon            260..529
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=2
FT   intron          530..770
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=2
FT   exon            771..1046
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=3
FT   intron          1047..1646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=3
FT   exon            1647..1922
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=4
FT   intron          1923..2021
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=4
FT   exon            2022..2138
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=5
FT   intron          2139..2576
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=5
FT   exon            2577..2609
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=6
FT   intron          2610..2751
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=6
FT   exon            2752..2799
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=7
FT   intron          2800..2968
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=7
FT   exon            2969..>2973
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0203"
FT                   /number=8
XX
SQ   Sequence 3148 BP; 615 A; 898 C; 970 G; 665 T; 0 other;
     cggttctaaa gtccgcacgc acccaccggg actcagattc tccccagacg ccgaggatgg        60
     ccgtcatggc gccccgaacc ctcgtcctgc tactctcggg ggctctggcc ctgacccaga       120
     cctgggcggg tgagtgcggg gtcgggaggg aaacggcctc tgtggggaga agcaacgggc       180
     ccgcctggcg ggggcgcagg acccgggaag ccgcgccggg aggagggtcg ggcgggtctc       240
     agccactcct cgtccccagg ctctcactcc atgaggtatt tcttcacatc cgtgtcccgg       300
     cccggccgcg gggagccccg cttcatcgca gtgggctacg tggacgacac gcagttcgtg       360
     cggttcgaca gcgacgccgc gagccagagg atggagccgc gggcgccgtg gatagagcag       420
     gagggtccgg agtattggga cggggagaca cggaaagtga aggcccactc acagactcac       480
     cgagtggacc tggggaccct gcgcggctac tacaaccaga gcgaggccgg tgagtgaccc       540
     cggcccgggg cgcaggtcac gacctctcat cccccacgga cgggccaggt cgcccacagt       600
     ctccgggtcc gagatccgcc ccgaagccgc gggaccccga gacccttgcc ccgggagagg       660
     cccaggcgcc tttacccggt ttcattttca gtttaggcca aaaatccccc caggttggtc       720
     ggggcggggc ggggctcggg ggaccgggct gaccgcgggg tccgggccag ggtctcacac       780
     cgtccagagg atgtatggct gcgacgtggg gtcggactgg cgcttcctcc gcgggtacca       840
     ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc gctcttggac       900
     cgcggcggac atggcagctc agaccaccaa gcacaagtgg gagacggccc atgaggcgga       960
     gcagtggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat acctggagaa      1020
     cgggaaggag acgctgcagc gcacgggtac caggggccac ggggcgcctc cctgatcgcc      1080
     tgtagatctc ccgggctggc ctcccacaag gaggggagac aattgggacc aacactagaa      1140
     tatcgccctc cctctggtcc tgagggagag gaatcctcct gggtttccag atcctgtacc      1200
     agagagtgac tctgaggttc cgccctgctc tctgacacaa ttaagggata aaatctctga      1260
     aggaatgacg ggaagacgat ccctcgaata ctgatgagtg gttccctttg acacacacag      1320
     gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1380
     gtgtgtgggg gtctgagtcc agcacttctg agtccttcag cctccactca ggtcaggacc      1440
     agaagtcgct gttccctctt cagggactag aattttccac ggaataggag attatcccag      1500
     gtgcctgtgt ccaggctggt gtctgggttc tgtgctccct tccccatccc aggtgtcctg      1560
     tccattctca agatagccac atgtgtgctg gaggagtgtc ccatgacaga tgcaaaatgc      1620
     ctgaatgatc tgactcttcc tgacagacgc ccccaaaacg catatgactc accacgctgt      1680
     ctctgaccat gaagccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac      1740
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag      1800
     gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt ctggacagga      1860
     gcagagatac acctgccatg tgcagcatga gggtttgccc aagcccctca ccctgagatg      1920
     gggtaaggag ggagacgggg gtgtcatgtc ttttagggaa agcaggagcc tctctgacct      1980
     ttagcagggt cagggcccct caccttcccc tcttttccca gagccgtctt cccagcccac      2040
     catccccatc gtgggcatca ttgctggcct ggttctcttt ggagctgtga tcactggagc      2100
     tgtggtcgct gctgtgatgt ggaggaggaa gagctcaggt ggggaagggg tgaagggtgg      2160
     gtctgagatt tcttgtctca ctgagggttc caagacccag gtagaagtgt gccctgcctc      2220
     gttactggga agcaccaccc acaattatgg gcctacccag cctgggccct gtgtgccagc      2280
     acttactctt ttgtaaagca cctgttaaaa tgaaggacag atttatcacc ttgattacag      2340
     cggtgatggg acctgatccc agcagtcaca agtcacaggg gaaggtccct gaggaccttc      2400
     aggagggcgg ttggtccagg acccacacct gctttcttca tgtttcctga tcccgccctg      2460
     ggtctgcagt cacacatttc tggaaacttc tctgaggtcc aagacttgga ggttcctcta      2520
     ggaccttaag gccctgactc ctttctggta tctcacagga cattttcttc ccacagatag      2580
     aaaaggaggg agctactctc aggctgcaag taagtatgaa ggaggctgat gcctgaggtc      2640
     cttgggatat tgtgtttggg agcccatggg ggagctcacc caccccacaa ttcctcctct      2700
     agccacatct tctgtgggat ctgaccaggt tctgtttttg ttctacccca ggcagtgaca      2760
     gtgcccaggg ctctgatgtg tctctcacag cttgtaaagg tgagagcctg gagggcctga      2820
     tgtgtgttgg gtgttgggcg gaacagtgga cacagctgtg ctatggggtt tctttccatt      2880
     ggatgtattg agcatgcgat gggctgttta aagtgtgacc cctcactgtg acagatacga      2940
     atttgttcat gaatattttt ttctatagtg tgagacagct gccttgtgtg ggactgagag      3000
     gcaagagttg ttcctgccct tccctttgtg acttgaagaa ccctgacttt gtttctgcaa      3060
     aggcacctgc atgtgtctgt gttcgtgtag gcataatgtg aggagggtgg ggagaccacc      3120
     ccacccccat gtccaccatg accctctt                                         3148
//


spacer
spacer