Dbfetch

ID   FN870142; SV 1; linear; genomic DNA; STD; HUM; 3241 BP.
XX
AC   FN870142;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*1103V
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3241
RA   Qu J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Liao K.;
RT   "Identification of HLA-I gene's whole length";
RL   Unpublished.
XX
DR   MD5; 6815ddd990a7231bc8dc40a414cba309.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3241
FT                   /organism="Homo sapiens"
FT                   /isolate="D1000765"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(133..205,336..605,847..1122,1702..1977,2080..2196,
FT                   2639..2671,2814..2861,3031..3035)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GM35"
FT                   /db_xref="IMGT/HLA:A*11:60"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7GM35"
FT                   /protein_id="CBM41442.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAARVAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            <133..205
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=1
FT   intron          206..335
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=1
FT   exon            336..605
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=2
FT   intron          606..846
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=2
FT   exon            847..1122
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=3
FT   intron          1123..1701
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=3
FT   exon            1702..1977
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=4
FT   intron          1978..2079
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=4
FT   exon            2080..2196
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=5
FT   intron          2197..2638
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=5
FT   exon            2639..2671
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=6
FT   intron          2672..2813
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=6
FT   exon            2814..2861
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=7
FT   intron          2862..3030
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=7
FT   exon            3031..>3035
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1103V"
FT                   /number=8
XX
SQ   Sequence 3241 BP; 622 A; 937 C; 996 G; 686 T; 0 other;
     ctcacgacgc ggacccagtt ctcactccca ttgggtgtcg ggtttccaga gaagccaatc        60
     agtgtcttcg cggtcgctct tctaaagtcc gcacgcaccc accgggactc agattctccc       120
     cagaccccga ggatggccgt catggcgccc cgaaccctcc tcctgctact ctcgggggcc       180
     ctggccctga cccagacctg ggcgggtgag tgcggggtcg ggagggaaac cgcctctgcg       240
     gggagaagca aggggccctc ctggcggggg cgcaggaccg ggggagccgc gccgggagga       300
     gggtcgggca ggtctcagcc actgctcgcc cccaggctcc cactccatga ggtatttcta       360
     cacctccgtg tcccggcccg gccgcgggga gccccgcttc atcgccgtgg gctacgtgga       420
     cgacacgcag ttcgtgcggt tcgacagcga cgccgcgagc cagaggatgg agccgcgggc       480
     gccgtggata gagcaggagg ggccggagta ttgggaccag gagacacgga atgtgaaggc       540
     ccagtcacag actgaccgag tggacctggg gaccctgcgc ggctactaca accagagcga       600
     ggacggtgag tgaccccggc ccggggcgca ggtcacgacc cctcatcccc cacggacggg       660
     ccaggtggcc cacagtctcc gggtccgaga tccaccccga agccgcggga ccccgagacc       720
     cttgccccgg gagaggccca ggcgccttta cccggtttca ttttcagttt aggccaaaaa       780
     tccccccggg ttggtcgggg ccgggcaggg cttgggggac tgggctgacc gcggggtcgg       840
     ggccaggttc tcacaccatc cagataatgt atggctgcga cgtggggccg gacgggcgct       900
     tcctccgcgg gtaccggcag gacgcctacg acggcaagga ttacatcgcc ctgaacgagg       960
     acctgcgctc ttggaccgcg gcggacatgg cagctcagat caccaagcgc aagtgggagg      1020
     cggcccgtgt ggcggagcag cagagagcct acctggaggg ccggtgcgtg gagtggctcc      1080
     gcagatacct ggagaacggg aaggagacgc tgcagcgcac gggtaccagg ggccacgggg      1140
     cgcctccctg atcgcctata gatctcccgg gctggcctcc cacaaggagg ggagacaatt      1200
     gggaccaaca ctagaatatc accctccctc tggtcctgag ggagaggaat cctcctgggt      1260
     ttccagatcc tgtaccagag agtgactctg aggttccgcc ctgctctctg acacaattaa      1320
     gggataaaat ctctgaagga gtgacgggaa gacgatccct cgaatactga tgagtggttc      1380
     cctttgacac cggcagcagc cttgggcccg tgacttttcc tctcaggcct tgttctctgc      1440
     ttcacactca atgtgtgtgg gggtctgagt ccagcacttc tgagtctctc agcctccact      1500
     caggtcagga ccagaagtcg ctgttccctt ctcagggaat agaagattat cccaggtgcc      1560
     tgtgtccagg ctggtgtctg ggttctgtgc tctcttcccc atcccgggtg tcctgtccat      1620
     tctcaagatg gccacatgcg tgctggtgga gtgtcccatg acagatgcaa aatgcctgaa      1680
     ttttctgact cttcccgtca gaccccccca agacacatat gacccaccac cccatctctg      1740
     accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga      1800
     cctggcagcg ggatggggag gaccagaccc aggacacgga gctcgtggag accaggcctg      1860
     caggggatgg aaccttccag aagtgggcgg ctgtggtggt gccttctgga gaggagcaga      1920
     gatacacctg ccatgtgcag catgagggtc tgcccaagcc cctcaccctg agatggggta      1980
     aggagggaga tgggggtgtc atgtctctta gggaaagcag gagcctctct ggagaccttt      2040
     agcagggtca gggcccctca ccttcccctc ttttcccaga gctgtcttcc cagcccacca      2100
     tccccatcgt gggcatcatt gctggcctgg ttctccttgg agctgtgatc actggagctg      2160
     tggtcgctgc cgtgatgtgg aggaggaaga gctcaggtgg agaaggggtg aaaggtgggg      2220
     tctgagattt cttgtctcac tgagggttcc aagccccagc tagaaatgtg ccctgtctca      2280
     ttactgggaa gcaccttcca caatcatggg ccgacccagc ctgggccctg tgtgccagca      2340
     cttactcttt tgtaaagcac ctgttaaaat gaaggacaga tttatcacct tgattacggc      2400
     ggtgatggga cctgatacca gcagtcacaa gtcacagggg aaggtccctg aggacagacc      2460
     tcaggagggc tattggtcca ggacccacac ctgctttctt catgtttcct gatcccgccc      2520
     tgggtctgca gtcacacatt tctggaaact tctctggggt ccaagactag gaggttcctc      2580
     taggacctta aggccctggc tcctttctgg tatctcacag gacattttct tcccacagat      2640
     agaaaaggag ggagttacac tcaggctgca agtaagtatg aaggaggctg atgcctgagg      2700
     tccttgggat attgtgtttg ggagcccatg ggggagctca cccaccccac aattcctcct      2760
     ctagccacat cttctgtggg atctgaccag gttctgtttt tgttctaccc caggcagtga      2820
     cagtgcccag ggctctgatg tgtctctcac agcttgtaaa ggtgagagct tggagggcct      2880
     gatgtgtgtt gggtgttggg cggaacagtg gacacagctg tgctatgggg tttctttgca      2940
     ttggatgtat tgagcatgcg atgggctgtt taaggtgtga cccctcactg tgatggatat      3000
     gaatttgttc atgaatattt ttttctatag tgtgagacag ctgccttgtg tgggactgag      3060
     aggcaagagt tgttcctgcc cttccctttg tgacttgaag aaccctgact ttgtttctgc      3120
     aaaggcacct gcatgtgtct gtgttcgtgt aggcataatg tgaggaggtg gggagaccac      3180
     cccaccccga tgtccaccat gaccctcttc ccacgctgac ctgtgctccc tctccaatca      3240
     t                                                                      3241
//