spacer

EBI Dbfetch

ID   FN870141; SV 1; linear; genomic DNA; STD; HUM; 3084 BP.
XX
AC   FN870141;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*0201V
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3084
RA   Qu J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Liao K.;
RT   "Identification of HLA-I gene's whole length";
RL   Unpublished.
XX
DR   MD5; fe25829d3992130e1ca423e98507b843.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3084
FT                   /organism="Homo sapiens"
FT                   /isolate="D1000070"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(43..115,246..515,757..1032,1633..1908,2008..2124,
FT                   2563..2595,2738..2785,2955..2959)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GM34"
FT                   /db_xref="IMGT/HLA:A*02:266"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D7GM34"
FT                   /protein_id="CBM41441.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTNHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   exon            <43..115
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=1
FT   intron          116..245
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=1
FT   exon            246..515
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=2
FT   intron          516..756
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=2
FT   exon            757..1032
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=3
FT   intron          1033..1632
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=3
FT   exon            1633..1908
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=4
FT   intron          1909..2007
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=4
FT   exon            2008..2124
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=5
FT   intron          2125..2562
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=5
FT   exon            2563..2595
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=6
FT   intron          2596..2737
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=6
FT   exon            2738..2785
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=7
FT   intron          2786..2954
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=7
FT   exon            2955..>2959
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0201V"
FT                   /number=8
XX
SQ   Sequence 3084 BP; 601 A; 874 C; 953 G; 656 T; 0 other;
     gcacgcaccc accgggactc agattctccc cagacgccga ggatggccgt catggcgccc        60
     cgaaccctcg tcctgctact ctcgggggct ctggccctga cccagacctg ggcgggtgag       120
     tgcggggtcg ggagggaaac ggcctctgtg gggagaagca acgggcccgc ctggcggggg       180
     cgcaggaccc gggaagccgc gccgggagga gggtcgggcg ggtctcagcc actcctcgtc       240
     cccaggctct cactccatga ggtatttctt cacatccgtg tcccggcccg gccgcgggga       300
     gccccgcttc atcgcagtgg gctacgtgga cgacacgcag ttcgtgcggt tcgacagcga       360
     cgccgcgagc cagaggatgg agccgcgggc gccgtggata gagcaggagg gtccggagta       420
     ttgggacggg gagacacgga aagtgaaggc ccactcacag actcaccgag tggacctggg       480
     gaccctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       540
     ggtcacgacc tctcatcccc cacggacggg ccaggtcgcc cacagtctcc gggtccgaga       600
     tccgccccga agccgcggga ccccgagacc cttgccccgg gagaggccca ggcgccttta       660
     cccggtttca ttttcagttt aggccaaaaa tccccccagg ttggtcgggg cggggcgggg       720
     ctcgggggac cgggctgacc gcggggtccg ggccaggttc tcacaccgtc cagaggatgt       780
     atggctgcga cgtggggtcg gactggcgct tcctccgcgg gtaccaccag tacgcctacg       840
     acggcaagga ttacatcgcc ctgaaagagg acctgcgctc ttggaccgcg gcggacatgg       900
     cagctcagac caccaagcac aagtgggagg cggcccatgt ggcggagcag ttgagagcct       960
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc      1020
     tgcagcgcac gggtaccagg ggccacgggg cgcctccctg atcgcctgta gatctcccgg      1080
     gctggcctcc cacaaggagg ggagacaatt gggaccaaca ctagaatatc gccctccctc      1140
     tggtcctgag ggagaggaat cctcctgggt ttccagatcc tgtaccagag agtgactctg      1200
     aggttccgcc ctgctctctg acacaattaa gggataaaat ctctgaagga atgacgggaa      1260
     gacgatccct cgaatactga tgagtggttc cctttgacac acacaggcag cagccttggg      1320
     cccgtgactt ttcctctcag gccttgttct ctgcttcaca ctcaatgtgt gtgggggtct      1380
     gagtccagca cttctgagtc cttcagcctc cactcaggtc aggaccagaa gtcgctgttc      1440
     cctcttcagg gactagaatt ttccacggaa taggagatta tcccaggtgc ctgtgtccag      1500
     gctggtgtct gggttctgtg ctcccttccc catcccaggt gtcctgtcca ttctcaagat      1560
     agccacatgt gtgctggagg agtgtcccat gacagatgca aaatgcctga atgatctgac      1620
     tcttcctgac agacgccccc aaaacgcata tgactaacca cgctgtctct gaccatgaag      1680
     ccaccctgag gtgctgggcc ctgagcttct accctgcgga gatcacactg acctggcagc      1740
     gggatgggga ggaccagacc caggacacgg agctcgtgga gaccaggcct gcaggggatg      1800
     gaaccttcca gaagtgggcg gctgtggtgg tgccttctgg acaggagcag agatacacct      1860
     gccatgtgca gcatgagggt ttgcccaagc ccctcaccct gagatggggt aaggagggag      1920
     acgggggtgt catgtctttt agggaaagca ggagcctctc tgacctttag cagggtcagg      1980
     gcccctcacc ttcccctctt ttcccagagc cgtcttccca gcccaccatc cccatcgtgg      2040
     gcatcattgc tggcctggtt ctctttggag ctgtgatcac tggagctgtg gtcgctgctg      2100
     tgatgtggag gaggaagagc tcaggtgggg aaggggtgaa gggtgggtct gagatttctt      2160
     gtctcactga gggttccaag acccaggtag aagtgtgccc tgcctcgtta ctgggaagca      2220
     ccacccacaa ttatgggcct acccagcctg ggccctgtgt gccagcactt actcttttgt      2280
     aaagcacctg ttaaaatgaa ggacagattt atcaccttga ttacagcggt gatgggacct      2340
     gatcccagca gtcacaagtc acaggggaag gtccctgagg accttcagga gggcggttgg      2400
     tccaggaccc acacctgctt tcttcatgtt tcctgatccc gccctgggtc tgcagtcaca      2460
     catttctgga aacttctctg aggtccaaga cttggaggtt cctctaggac cttaaggccc      2520
     tgactccttt ctggtatctc acaggacatt ttcttcccac agatagaaaa ggagggagct      2580
     actctcaggc tgcaagtaag tatgaaggag gctgatgcct gaggtccttg ggatattgtg      2640
     tttgggagcc catgggggag ctcacccacc ccacaattcc tcctctagcc acatcttctg      2700
     tgggatctga ccaggttctg tttttgttct accccaggca gtgacagtgc ccagggctct      2760
     gatgtgtctc tcacagcttg taaaggtgag agcctggagg gcctgatgtg tgttgggtgt      2820
     tgggcggaac agtggacaca gctgtgctat ggggtttctt tccattggat gtattgagca      2880
     tgcgatgggc tgtttaaagt gtgacccctc actgtgacag atacgaattt gttcatgaat      2940
     atttttttct atagtgtgag acagctgcct tgtgtgggac tgagaggcaa gagttgttcc      3000
     tgcccttccc tttgtgactt gaagaaccct gactttgttt ctgcaaaggc acctgcatgt      3060
     gtctgtgttc gtgtaggcat aatg                                             3084
//


spacer
spacer