Dbfetch

ID   FN870140; SV 1; linear; genomic DNA; STD; HUM; 3141 BP.
XX
AC   FN870140;
XX
DT   03-JUN-2010 (Rel. 105, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*2601V
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3141
RA   Qu J.;
RT   ;
RL   Submitted (28-MAY-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Liao K.;
RT   "Identification of HLA-I gene's whole length";
RL   Unpublished.
XX
DR   MD5; 9a1a6cdedaef2a3c66ca98f77622fe50.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3141
FT                   /organism="Homo sapiens"
FT                   /isolate="D1000055"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(86..158,289..558,800..1075,1676..1951,2051..2167,
FT                   2606..2638,2781..2828,2998..3002)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GM33"
FT                   /db_xref="IMGT/HLA:A*26:50"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D7GM33"
FT                   /protein_id="CBM41440.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHSIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            <86..158
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=1
FT   intron          159..288
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=1
FT   exon            289..558
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=2
FT   intron          559..799
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=2
FT   exon            800..1075
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=3
FT   intron          1076..1675
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=3
FT   exon            1676..1951
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=4
FT   intron          1952..2050
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=4
FT   exon            2051..2167
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=5
FT   intron          2168..2605
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=5
FT   exon            2606..2638
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=6
FT   intron          2639..2780
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=6
FT   exon            2781..2828
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=7
FT   intron          2829..2997
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=7
FT   exon            2998..>3002
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2601V"
FT                   /number=8
XX
SQ   Sequence 3141 BP; 604 A; 892 C; 983 G; 662 T; 0 other;
     agagaagcca atcagtgtcg tcgcggtcgc ggttctaaag tccgcacgca cccaccggga        60
     ctcagattct ccccagacgc cgaggatggc cgtcatggcg ccccgaaccc tcgtcctgct       120
     actctcgggg gccctggccc tgacccagac ctgggcgggt gagtgcgggg tcgggaggga       180
     aacggcctct gtggggagaa gcaaggggcc cgcccggcgg gggcgcagga cccgggaagc       240
     cgcgcctgga ggagggtcgg gcgggtctca gccactcctc gcccccaggc tcccactcca       300
     tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc ttcatcgccg       360
     tgggctacgt ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg agccagagga       420
     tggagccgcg ggcgccgtgg atagagcagg aggggccgga gtattgggac cggaacacac       480
     ggaatgtgaa ggcccactca cagactgacc gagcgaacct ggggaccctg cgcggctact       540
     acaaccagag cgaggacggt gagtgacccc ggcccggggc gcaggtcacg acccctcatc       600
     ccccacggac gggccaggtc gcccacagtc tccgggtccg agatccgccc cgaagccgcg       660
     ggaccccgag acccttgccc cgggagaggc ccaggcgcct ttacccggtt tcattttcag       720
     tttaggccaa aaatcccccc gggttggtcg gggcggggcg gggctcgggg gaccgggctg       780
     acctcggggt ccgggccagg ttctcacagc atccagagga tgtatggctg cgacgtgggg       840
     ccggacgggc gcttcctccg cgggtaccag caggacgctt acgacggcaa ggattacatc       900
     gccctgaacg aggacctgcg ctcttggacc gcggcggaca tggcggctca gatcacccag       960
     cgcaagtggg agacggccca tgaggcggag cagtggagag cctacctgga gggccggtgc      1020
     gtggagtggc tccgcagata cctggagaac gggaaggaga cgctgcagcg cacgggtacc      1080
     aggggccacg gggcgcctcc ctgatcgcct gtagatctcc cgggctggcc tcccacaagg      1140
     aggggagaca attgggacca acactagaat atcgccctcc ctctggtcct gagggagagg      1200
     aatcctcctg ggtttccaga tcctgtacca gagagtgact ctgaggttcc gccctgctct      1260
     ctgacacaat taagggataa aatctctgaa ggaatgacgg gaagacgatc cctcgaatac      1320
     tgatgagtgg ttccctttga cacacaccgg cagcagcctt gggcccgtga cttttcctct      1380
     caggccttgt tctctgcttc acactcaatg tgtgtggggg tctgagtcca gcacttctga      1440
     gtccctcagc ctccactcag gtcaggacca gaagtcgctg ttccctcttc agggactaga      1500
     attttccacg gaataggaga ttatcccagg tgcctgtgtc caggctggtg tctgggttct      1560
     gtgctccctt ccccatccca ggtgtcctgt ccattctcaa gatagccaca tgtgtgctgg      1620
     aggagtgtcc catgacagat gcaaaatgcc tgaatgttct gactcttcct gacagacgcc      1680
     cccaagacgc atatgactca ccacgctgtc tctgaccatg aggccaccct gaggtgctgg      1740
     gccctgagct tctaccctgc ggagatcaca ctgacctggc agcgggatgg ggaggaccag      1800
     acccaggaca cggagctcgt ggagaccagg cctgcagggg atgggacctt ccagaagtgg      1860
     gcgtctgtgg tggtgccttc tggacaggag cagagataca cctgccatgt gcagcatgag      1920
     ggtctgccca agcccctcac cctgagatgg ggtaaggagg gagacggggg tgtcatgtct      1980
     tttagggaaa gcaggagcct ctctgacctt tagcagggtc agggcccctc accttcccct      2040
     cttttcccag agccgtcttc ccagcccacc atccccatcg tgggcatcat tgctggcctg      2100
     gttctctttg gagctgtgat cgctggagct gtggtcgctg ctgtgatgtg gaggaggaag      2160
     agctcaggtg gggaagggat gaagggtggg tctgagattt cttgtctcac tgagggttcc      2220
     aagacccagg tagaagtgtg ccctgcctcg ttactgggaa gcaccatcca caattatgag      2280
     cctacccagc ctgggccctg tgtgccagca cttactcttt tgtaaagcac ctgttaaaat      2340
     gaaggacaga tttatcacct tgattacggc ggtgatggga cctgatccca gcagtcacaa      2400
     gtcacagggg aaggtccctg aggaccttca ggagggcggt tggtccagga cccacacctg      2460
     ctttcttcat gtttcctgat cccgccctgg gtctgcagtc acacatttct ggaaacttct      2520
     ctgaggtcca agacttggag gttcctctag gaccttaagg ccctggctcc tttctggtat      2580
     ctcacaggac attttcttcc cacagataga aaaggaggga gctactctca ggctgcaagt      2640
     aagtatgaag gaggctgatg cctgaggtcc ttgggatatt gtgtttggga gcccgtgggg      2700
     gagctcaccc accccacaat tcctcctcta gccacatgtt ctgtgggatc tgaccaggtt      2760
     ctgtttttgt cctaccccag gcagtgacag tgcccagggc tctgatatgt ctctcacagc      2820
     ttgtaaaggt gagagcctgg agggcctgat gtgtgttggg tgttgggcgg aacagtggac      2880
     gcagctgtgc tatggggttt ctttgcattg gatgtattga gcatgcgatg ggctgtttaa      2940
     agtgtgactc ctcactgtga cagatacgaa tttgttcatg aatatttttt tctatagtgt      3000
     gagacagctg ccttgtgtgg gactgagagg caagatttgt tcctgccctt ccctttgtga      3060
     cttgaagaac cctgactttg tttctgcaaa ggcacctgca tgtgtctgtg ttcttgtagg      3120
     cataatgtga ggaggtgggg a                                                3141
//