spacer

EBI Dbfetch

ID   FN869057; SV 1; linear; genomic DNA; STD; PRO; 461 BP.
XX
AC   FN869057;
XX
DT   15-JUN-2010 (Rel. 105, Created)
DT   03-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Ralstonia insidiosa partial fliC gene for flagellin, strain ULI795
XX
KW   .
XX
OS   Ralstonia insidiosa
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Ralstonia.
XX
RN   [1]
RP   1-461
RA   Ryan M.P.;
RT   ;
RL   Submitted (25-MAY-2010) to the INSDC.
RL   Ryan M.P., University of Limerick, CES Dept., Castletroy, Limerick,
RL   IRELAND.
XX
RN   [2]
RX   DOI; 10.1186/1471-2180-11-194.
RX   PUBMED; 21878094.
RA   Ryan M.P., Pembroke J.T., Adley C.C.;
RT   "Genotypic and phenotypic diversity of Ralstonia pickettii and Ralstonia
RT   insidiosa isolates from clinical and environmental sources including
RT   High-purity Water. Diversity in Ralstonia pickettii";
RL   BMC Microbiol. 11:194-194(2011).
XX
DR   MD5; 52c5ff8d30051ad9645547b9c424262f.
DR   EuropePMC; PMC3175462; 21878094.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..461
FT                   /organism="Ralstonia insidiosa"
FT                   /strain="ULI795"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:190721"
FT   CDS             <1..>461
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /product="flagellin"
FT                   /db_xref="GOA:D7GLG1"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:D7GLG1"
FT                   /protein_id="CBM40886.1"
FT                   /translation="NNLQRMRQLAVEANNGGLSTTDQANLDKEYQQLATANKNIETNAN
FT                   YNGAKLFDGSVTSTTFQYGQNSATDVATVTNANLASFGTLSSTSVTSTANATAAQAKID
FT                   ADLASLKAARADLGAQQSGLSSTINTLTSSNTALSAAKSAMVDTDYASE"
XX
SQ   Sequence 461 BP; 118 A; 162 C; 121 G; 60 T; 0 other;
     aaacaacctg caacgtatgc gccaactggc tgtggaagcc aacaacggcg gtctgtcgac        60
     caccgaccag gccaacctgg acaaggaata ccaacagctg gccacggcca acaagaacat       120
     cgagaccaac gccaactaca acggcgccaa gctgttcgac ggctcggtca cctcgaccac       180
     gttccaatac ggccaaaact cggcgaccga cgtcgctacc gtgaccaacg ccaacctggc       240
     cagcttcggt acgctgtcga gcacgagcgt gacttcgacc gccaacgcaa cggcagccca       300
     ggccaagatc gacgccgacc tggccagcct gaaggcagct cgcgctgacc tgggtgcaca       360
     gcaaagcggt ctgagctcga cgatcaacac gctgacctcg tcgaacaccg ccctgtcggc       420
     tgcaaagtcg gccatggtcg ataccgacta cgcatctgaa g                           461
//


spacer
spacer