spacer

EBI Dbfetch

ID   FN869041; SV 1; linear; genomic DNA; STD; PRO; 472 BP.
XX
AC   FN869041;
XX
DT   15-JUN-2010 (Rel. 105, Created)
DT   03-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Ralstonia pickettii partial fliC gene for flagellin, strain JCM5969
XX
KW   .
XX
OS   Ralstonia pickettii
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Ralstonia.
XX
RN   [1]
RP   1-472
RA   Ryan M.P.;
RT   ;
RL   Submitted (25-MAY-2010) to the INSDC.
RL   Ryan M.P., University of Limerick, CES Dept., Castletroy, Limerick,
RL   IRELAND.
XX
RN   [2]
RX   DOI; 10.1186/1471-2180-11-194.
RX   PUBMED; 21878094.
RA   Ryan M.P., Pembroke J.T., Adley C.C.;
RT   "Genotypic and phenotypic diversity of Ralstonia pickettii and Ralstonia
RT   insidiosa isolates from clinical and environmental sources including
RT   High-purity Water. Diversity in Ralstonia pickettii";
RL   BMC Microbiol. 11:194-194(2011).
XX
DR   MD5; 131c6dae385e957fca3499506d9f445b.
DR   EuropePMC; PMC3175462; 21878094.
DR   StrainInfo; 17904; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..472
FT                   /organism="Ralstonia pickettii"
FT                   /strain="JCM5969"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:329"
FT   CDS             <1..>472
FT                   /codon_start=2
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /product="flagellin"
FT                   /db_xref="GOA:D7GLE5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:D7GLE5"
FT                   /protein_id="CBM40870.1"
FT                   /translation="NNLQRMRQLAVEANNGGLSTTDQANLDKEYQKLATANKNIETNAN
FT                   YNGNKLFDGSVTSTTFQYGQNAATDVTSVSNADLSTFGTLSGTSVTSTANATAAQAAID
FT                   TDLTNLKAARANLGAQQSGLNSTINTLTSNNTALSAAKSSLIDTDYASETSNM"
XX
SQ   Sequence 472 BP; 122 A; 157 C; 125 G; 68 T; 0 other;
     aaacaacctg caacgtatgc gccaactggc tgtggaagcc aacaacggcg gtctgtcgac        60
     caccgaccag gccaacctgg acaaggaata ccagaagctg gccaccgcca acaagaacat       120
     cgagaccaac gcgaactaca acggcaacaa gctgttcgac ggttcggtca cgtccacgac       180
     gttccaatac ggccagaatg cggcgaccga tgtgacctcg gtctccaacg ccgacctgtc       240
     gaccttcggt acgctgagcg gcacgagcgt gacctcgact gccaacgcga ccgccgcaca       300
     ggcggccatc gacaccgatc tgaccaacct gaaggcggct cgcgccaacc tgggtgctca       360
     gcaaagtggt ctgaactcga cgatcaacac gctgacgtcg aacaacaccg cgctgtcggc       420
     tgccaagtcg tccttgatcg atacggacta tgcatcggaa acgtcgaaca tg               472
//


spacer
spacer