spacer

EBI Dbfetch

ID   FN827051; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN827051;
XX
DT   02-JUN-2010 (Rel. 105, Created)
DT   02-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*new3, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lu J.;
RT   ;
RL   Submitted (10-MAY-2010) to the INSDC.
RL   Lu J., Room 203, Chinese Marrow Donor Program, No.53 Ganmian Hutong,
RL   Dongcheng District, Beijing 100010, CHINA.
XX
RN   [2]
RA   Liu X., Li L., Zhang H.M., Liang X., Hu J., Li E.J.;
RT   "Identification of a novel HLA-DRB1 allele";
RL   Unpublished.
XX
DR   MD5; 1a88ecb62dd5052459d172edd70bb5b9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="China:Tianjing"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new3"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D7GL12"
FT                   /db_xref="IMGT/HLA:DRB1*15:49"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D7GL12"
FT                   /protein_id="CBM00859.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDTLEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new3"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 67 C; 101 G; 47 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacaccct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer