spacer

EBI Dbfetch

ID   FN827050; SV 1; linear; genomic DNA; STD; HUM; 268 BP.
XX
AC   FN827050;
XX
DT   02-JUN-2010 (Rel. 105, Created)
DT   02-JUN-2010 (Rel. 105, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*new2, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-268
RA   Lu J.;
RT   ;
RL   Submitted (10-MAY-2010) to the INSDC.
RL   Lu J., Room 203, Chinese Marrow Donor Program, No.53 Ganmian Hutong,
RL   Dongcheng District, Beijing 100010, CHINA.
XX
RN   [2]
RA   Liu X., Li L., Liang X., Zhang H.M., Ren H.F., Wang X.Y.;
RT   "Identification of a novel HLA-DRB1 allele";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..268
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="China:Tianjing"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>268
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new2"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D7GL11"
FT                   /db_xref="IMGT/HLA:DRB1*15:50N"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D7GL11"
FT                   /protein_id="CBM00858.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEQARRGGHLLQTQLRGCGELHSAAA"
FT   exon            1..268
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new2"
FT                   /number=2
XX
SQ   Sequence 268 BP; 54 A; 66 C; 99 G; 49 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacttcct ggagcaggcg cgccgcggtg gacacctact gcagacacaa ctacggggtt       240
     gtggagagct tcacagtgca gcggcgag                                          268
//


spacer
spacer