spacer

EBI Dbfetch

ID   FN824404; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN824404;
XX
DT   13-MAY-2010 (Rel. 104, Created)
DT   13-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*07new, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Emmerich F.;
RT   ;
RL   Submitted (09-MAY-2010) to the INSDC.
RL   Emmerich F., Universitaetsklinikum Freiburg, Transfusionsmedizin,
RL   Hugstetter Str. 55, 79106, GERMANY.
XX
RN   [2]
RA   Emmerich F., Driever S., Niemeyer C.;
RT   "A novel HLA-allele most similar to HLA-DRB1*0701, exon 2";
RL   Unpublished.
XX
DR   MD5; 1da50d5a6e68f0884f1447074c1da11a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="blood lymphocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D6CJD7"
FT                   /db_xref="IMGT/HLA:DRB1*07:19"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D6CJD7"
FT                   /protein_id="CBL94785.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAL
FT                   TELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*07new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 99 G; 50 T; 0 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggacg gagcgggtgc        60
     agttcctgga aagactcttc tataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcgttgacg gagctagggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaggacagg cggggccagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer