spacer

EBI Dbfetch

ID   FN824366; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN824366;
XX
DT   13-MAY-2010 (Rel. 104, Created)
DT   30-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 for MHC class II antigen gene, allele
DE   HLA-DRB1*new, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Schmich J.;
RT   ;
RL   Submitted (07-MAY-2010) to the INSDC.
RL   Schmich J., R.O.S.E. Europe GmbH, R&D Department, Industriepark Hoechst
RL   G830, Hessen, D-65926, GERMANY.
XX
RN   [2]
RA   Shi Z., Liang X., Hu L., Zhang A., Wang Z., Liu Y., Zhang R., Kang Y.,
RA   Duval-Koeppl F., Cocchiararo B., Schmich J.;
RT   "Report of new HLA alleles discovered in the Hebei Province, China";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Schmich J.;
RT   ;
RL   Submitted (27-SEP-2010) to the INSDC.
RL   Schmich J., R.O.S.E. Europe GmbH, R&D Department, Industriepark Hoechst
RL   G830, Hessen, D-65926, GERMANY.
XX
DR   MD5; 49463696855e581ff98ebdcd01d9f6d5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="new sequence is a derivate of DRB1*1101 with a
FT                   change in position 337 form G to C"
FT                   /db_xref="GOA:D6CJC9"
FT                   /db_xref="IMGT/HLA:DRB1*11:101"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D6CJC9"
FT                   /protein_id="CBL94701.2"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYRVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*new"
FT                   /product="MHC class II antigen"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactaccggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer