Dbfetch

ID   FN823237; SV 1; linear; genomic DNA; STD; HUM; 3098 BP.
XX
AC   FN823237;
XX
DT   13-MAY-2010 (Rel. 104, Created)
DT   13-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*07, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3098
RA   Qu J.;
RT   ;
RL   Submitted (06-MAY-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, China, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Liao K., Huang C., Wang L., Liu X.;
RT   "Sequencing the whole genome of HLA alleles Cw*03040101 variant";
RL   Unpublished.
XX
DR   MD5; df315cb1e89fca70587836e750b11737.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3098
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(138..210,341..610,861..1136,1724..1999,2124..2243,
FT                   2684..2716,2824..2871,3036..3040)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D6CJC1"
FT                   /db_xref="IMGT/HLA:C*07:149"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:D6CJC1"
FT                   /protein_id="CBL93953.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEDTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   exon            138..210
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=1
FT   intron          211..340
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=1
FT   exon            341..610
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=2
FT   variation       556
FT                   /replace="a"
FT   intron          611..860
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=2
FT   exon            861..1136
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=3
FT   intron          1137..1723
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=3
FT   exon            1724..1999
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=4
FT   intron          2000..2123
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=4
FT   exon            2124..2243
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=5
FT   intron          2244..2683
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=5
FT   exon            2684..2716
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=6
FT   intron          2717..2823
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=6
FT   exon            2824..2871
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=7
FT   intron          2872..3035
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=7
FT   exon            3036..3040
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07"
FT                   /number=8
XX
SQ   Sequence 3098 BP; 580 A; 912 C; 968 G; 638 T; 0 other;
     ctgaatactc atgacgcgtc cccaattccc actcccattg ggtgtcgggt tctagagaag        60
     ccaatcagcg tctccgcagt cccggttcta aagtccccag tcacccaccc ggactcacat       120
     tctccccaga ggccgagatg cgggtcatgg cgccccgagc cctcctcctg ctgctctcgg       180
     gaggcctggc cctgaccgag acctgggcct gtgagtgcgg ggttgggagg gaagcggcct       240
     ctgcggagag gagcgagggg ccctcccggc gagggcgcag gacccgggga gccgcgcagg       300
     gaggtgggtc gggcgggtct cagcccctcc tcgcccccag gctcccactc catgaggtat       360
     ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc gcttcatctc agtgggctac       420
     gtggacgaca cgcagttcgt gcggttcgac agcgacgccg cgagtccgag aggggagccg       480
     cgggcgccgt gggtggagca ggaggggccg gagtattggg accgggagac acagaagtac       540
     aagcgccagg cacaggctga ccgagtgagc ctgcggaacc tgcgcggcta ctacaaccag       600
     agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca cgacccctcc ccatccccca       660
     cggacggccc gggtcgccca gagtctcccc gtctgagatc caccccaagg tggatctgcg       720
     gaacccgccc agaccctcga ccggagagag ccccagtcgc ctttacccgg tttcattttc       780
     ggtttaggcc aaaatccccg cgggttggtc ggggcggggc ggggctcggg ggactgggct       840
     gaccgcgggg gcggggccag ggtctcacac cctccagagg atgtctggct gcgacctggg       900
     gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat       960
     cgccctgaac gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca      1020
     gcgcaagttg gaggcggccc gtgcggcgga gcagctgaga gcctacctgg aggacacgtg      1080
     cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcaggtac      1140
     caggggcagt ggggagcctt ccccatctcc tatagatctc ccgggatggc ctcccacgag      1200
     gaggggagga aaatgggatc agcactggaa tatcgccctc ccttgaatgg agaatggcat      1260
     gagttttcct gagtttcctc tgagggcccc ctctgctctc taggacaatt aagggatgaa      1320
     gtctctgagg aaatggaggg gaagacagtc cctggaatac tgatcagggg tctcctttga      1380
     ccactttgac cactgcagca gctgtggtca ggctgctgac ctttctctca ggccttgttc      1440
     tctgcctcac actcaatgtg tctgaaggtt tgattccagc ttttctgagt cctgcagcct      1500
     ccactcaggt caggaccaga agtcgctgtt cctccctcag agactagaac tttccaatga      1560
     ataggagatt atcccaggtg cctgtgtcca ggctggcgtc tgggttctgt gccgccttcc      1620
     ccaccccagg tgtcctgtcc attctcagga tggtcacatg ggcgctgctg gagtgtccca      1680
     agagagatgc aaagtgtctg aattttctga ctcttcccgt cagaaccccc aaagacacac      1740
     gtgacccacc accccctctc tgaccatgag gccaccctga ggtgctgggc cctgggcttc      1800
     taccctgcgg agatcacact gacctggcag cgggatgggg aggaccagac ccaggacacc      1860
     gagcttgtgg agaccaggcc agcaggagat ggaaccttcc agaagtgggc agctgtggtg      1920
     gtgccttctg gacaagagca gagatacacg tgccatatgc agcacgaggg gctgcaagag      1980
     cccctcaccc tgagctgggg taaggagggg aatggggggt cacatctctt atcagagaaa      2040
     gcagaagtcc ttctggagcc cttcagccgg gtcagggctg aggcttgggg gtcagggccc      2100
     ctcaccttct cctcctttcc cagagccatc ttcccagccc accatcccca tcatgggcat      2160
     cgttgctggc ctggctgtcc tggttgtcct agctgtcctt ggagctgtgg tcaccgctat      2220
     gatgtgtagg aggaagagct caggtaggga aggggtgaag agcggggtct gggttttctt      2280
     gtcccactgg gagtttcaag ccccaggtag aagtgtgccc cgccttgtta ctggaagcac      2340
     catccacaca tgggccatcc cagcctggga ccctgtgtgc cagcacttac tcttttgtga      2400
     agcacatgtg acaatgaagg acggatgtat caccttgatg attatggtgt tggggtcctg      2460
     attccagcat tcatgagtca ggggaaggtc cctgctaagg acagacctta ggagggcagt      2520
     tggtccagaa cccacaactg ctttccccat gtttcctgat cctgccctgg gtctgcagtc      2580
     gtagttctgg aaacttctct tgggtccaag actaggaggt tcccctaaga tcacatggcc      2640
     ctgcctcctc ccagtcccct catagggcat tttcttccca caggtggaaa aggagggagc      2700
     tgctctcagg ctgcgtgtaa gtgatggcgg cgggcgtgtg gaggagctca cctactccat      2760
     aattcctctt gtcccacatc tcctgcgggc tctgaccagg tctttttttt tgttctaccc      2820
     caggcagcaa cagtgcccag ggctctgatg agtctctcat cacttgtaaa ggtgagattc      2880
     tggggagctg aagtggtcgg gggtggggca gagggaaaag gcctgggtaa tggggattct      2940
     ttgattggga cgtttcgagt gtgtggtggg ccgttcagag tgtcatcgct taccatgact      3000
     gacctgaatt tgttcatgac tattgtgttc tgtagcctga gacagctgcc tgtgtgggac      3060
     tgagatgcag gatttcttca cacctctcct ttgtgact                              3098
//