spacer

EBI Dbfetch

ID   FN823236; SV 1; linear; genomic DNA; STD; HUM; 2997 BP.
XX
AC   FN823236;
XX
DT   13-MAY-2010 (Rel. 104, Created)
DT   13-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, allele HLA-C*03, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2997
RA   Qu J.;
RT   ;
RL   Submitted (06-MAY-2010) to the INSDC.
RL   Qu J., Bei Shan Industrial Zone, Yantian District, Shenzhen, China, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H., Liao K., Huang C., Wang L., Liu X.;
RT   "Sequencing the whole genome of HLA alleles Cw*03040101 variant";
RL   Unpublished.
XX
DR   MD5; 0ea8327e0b67ad6f90e5a44c1629c7d4.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2997
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(107..179,310..576,822..1097,1685..1960,2082..2201,
FT                   2641..2673,2781..2828,2993..2997)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D6CJC0"
FT                   /db_xref="IMGT/HLA:C*03:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D6CJC0"
FT                   /protein_id="CBL93952.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEEGPEYWDRETQKYKRQAQTDRVSLRNL
FT                   RGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAA
FT                   QITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHEA
FT                   TLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYT
FT                   CHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGK
FT                   GGSCSQAASSNSAQGSDESLIACKA"
FT   exon            107..179
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=1
FT   intron          180..309
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=1
FT   exon            310..576
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=2
FT   intron          577..821
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=2
FT   exon            822..1097
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=3
FT   intron          1098..1684
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=3
FT   exon            1685..1960
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=4
FT   intron          1961..2081
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=4
FT   exon            2082..2201
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=5
FT   intron          2202..2640
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=5
FT   exon            2641..2673
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=6
FT   intron          2674..2780
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=6
FT   exon            2781..2828
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=7
FT   intron          2829..2992
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=7
FT   exon            2993..2997
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03"
FT                   /number=8
XX
SQ   Sequence 2997 BP; 561 A; 862 C; 958 G; 616 T; 0 other;
     ctcccattgg gtgtcggatt ctagagaagc caatcagcgt ctccgcagtc ccggttctga        60
     agtccccagt cacccacccg gactcagatt ctccccagac gccgagatgc gggtcatggc       120
     gccccgaacc ctcatcctgc tgctctcggg agccctggcc ctgaccgaga cctgggccgg       180
     tgagtgcggg gttgggaggg aatcggcctc tgcggagagg agcgaggggc ccgcccggcg       240
     agggcgcagg acccggggag ccgcgcaggg aggagggtcg ggcgggtctc agcccctcct       300
     cgcccccagg ctcccactcc atgaggtatt tctacaccgc tgtgtcccgg cccggccgcg       360
     gggagcccca cttcatcgca gtgggctacg tggacgacac gcagttcgtg cggttcgaca       420
     gcgacgccgc gagtccgaga ggggagccgc gggcgccgtg ggtggaggag gggccggagt       480
     attgggaccg ggagacacag aagtacaagc gccaggcaca gactgaccga gtgagcctgc       540
     ggaacctgcg cggctactac aaccagagcg aggccggtga gtgaccccgg cccggggcgc       600
     aggtcacgac ccctcctcat cccccacgga cggcccgggt cgccccaagt ctcccggtct       660
     gagatccacc ccgaggctgc ggaacccgcc cagaccctcg accggagaga gccccagtca       720
     cctttacccg gtttcatttt cagtttaggc caaaatcccc gcgggttggt cggggcgggg       780
     cggggctcgg gggacggggc tgaccgcggg ggcggggcca gggtctcaca tcatccagag       840
     gatgtatggc tgcgacgtgg ggcccgacgg gcgcctcctc cgcgggtatg accagtacgc       900
     ctacgacggc aaggattaca tcgccctgaa cgaggatctg cgctcctgga ccgccgcgga       960
     cacggcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgaggcgg agcagctgag      1020
     agcctacctg gagggcctgt gcgtggagtg gctccgcaga tacctgaaga atgggaagga      1080
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctgtagatct      1140
     cccgggatgg cctcccacga ggaggggagg aaaatgggat cagcgctaga atatcgccct      1200
     cccttgaatg gagaatggga tgagttttcc tgagtttcct ctgagggccc cctctgctct      1260
     ctaggacaat taagggatga agtccttgag gaaatggagg ggaagacagt ccctagaata      1320
     ctgatcaggg gtcccctttg accactttga ccactgcagc agctgtggtc aggctgctga      1380
     cctttctctc aggccttgtt ctctgcctca cgctcaatgt gtttgaaggt ttgattccag      1440
     cttttctgag tccttcggcc tccactcagg tcaggaccag aagtcgctgt tcctccctca      1500
     gagactagaa ctttccaatg aataggagat tatcccaggt gcctgtgtcc aggctggcgt      1560
     ctgggttctg tgcccccttc cccaccccag gtgtcctgtc cgttctcagg atggtcacat      1620
     gggcgctgtt ggagtgtcgc aagagagata caaagtgtct gaattttctg actcttcccg      1680
     tcagaacacc caaagacaca cgtgacccac catcccgtct ctgaccatga ggccaccctg      1740
     aggtgctggg ccctgggctt ctaccctgcg gagatcacac tgacctggca gtgggatggg      1800
     gaggaccaaa ctcaggacac tgagcttgtg gagaccaggc cagcaggaga tggaaccttc      1860
     cagaagtggg cagctgtggt ggtgccttct ggagaagagc agagatacac gtgccatgtg      1920
     cagcacgagg ggctgccgga gcccctcacc ctgagatggg gtaaggaggg ggatgagggg      1980
     tgatgtgtct tctcagggaa agcagaagtc ctggagccct tcagccaggt cagggctgag      2040
     gcttgggggt cagggcccct caccttcccc tcctttccca gagccgtctt cccagcccac      2100
     catccccatc gtgggcatcg ttgctggcct ggctgtcctg gctgtcctag ctgtcctagg      2160
     agctgtggtg gctgttgtga tgtgtaggag gaagagctca ggtagggaag gggtgaggag      2220
     tggggtctgg gttttcttgt tccactggga gtttcaagcc ccaggtagaa gtgtgcccca      2280
     cctcgttact ggaagcacca tccacacatg ggccatccca gcctgggacc ctgtgtgcca      2340
     gcacttactc tgttgtgaag cacatgacaa tgaaggacag atgtatcacc ttgatgatta      2400
     tggtgttggg gtccttgatt ccagcattca tgagtcaggg gaaggtccct gctaaggaca      2460
     gaccttagga gggcagttgc tccagaaccc acagctgctt tccccgtgtt tcctgatcct      2520
     gccctgggtc tgcagtcata gttctggaaa cttctcttgg gtccaagact aggaggttcc      2580
     cctaagatcg catggccctg actcctccct gtcccctcac agggcatttt cttcccacag      2640
     gtggaaaagg agggagctgc tctcaggctg cgtgtaagtg atggcggtgg gcgtgtggag      2700
     gagctcaccc accccataat tcctcttgtc ccacatctcc tgcgggctct gaccaggtct      2760
     ttttttttgt tctaccccag ccagcaacag tgcccagggc tctgatgagt ctctcatcgc      2820
     ttgtaaaggt gagattctgg ggagctgaag tggtcggggg tggggcagag ggaaaaggcc      2880
     taggtaatgg ggatcctttg attgggacgt ttcgaatgtg tggtgagctg ttcagagtgt      2940
     gatcacttac catgactgac ctgaatttgt tcatgactat tgtgttctgt agcctga         2997
//


spacer
spacer