spacer

EBI Dbfetch

ID   FN821961; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   FN821961;
XX
DT   02-JUN-2010 (Rel. 105, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*17,
DE   exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Van Sandt V.S.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Van Sandt V.S., DVB/HILA, Red Cross Flanders, Zeutestraat 2B, 2800
RL   Mechelen, BELGIUM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01660.x.
RX   PUBMED; 21457147.
RA   Van Sandt V.S., Mahieu S., Emonds M.P.;
RT   "Eight new alleles found in Flanders (Belgium), including the
RT   HLA-DRB1*12:24N allele";
RL   Tissue Antigens 78(1):45-48(2011).
XX
DR   MD5; 0a692745b80ca8aceab89f0df605be27.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*17"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GK35"
FT                   /db_xref="IMGT/HLA:B*07:05:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D7GK35"
FT                   /protein_id="CBL88503.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*17"
FT                   /number=2
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*17"
FT                   /number=3
XX
SQ   Sequence 546 BP; 112 A; 171 C; 193 G; 70 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctataaccag agcgaggccg ggtctcacac cctccagagc atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagcggaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac aagctggagc       540
     gcgctg                                                                  546
//


spacer
spacer