spacer

EBI Dbfetch

ID   FN821959; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN821959;
XX
DT   02-JUN-2010 (Rel. 105, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*15, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Van Sandt V.S.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Van Sandt V.S., DVB/HILA, Red Cross Flanders, Zeutestraat 2B, 2800
RL   Mechelen, BELGIUM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01660.x.
RX   PUBMED; 21457147.
RA   Van Sandt V.S., Mahieu S., Emonds M.P.;
RT   "Eight new alleles found in Flanders (Belgium), including the
RT   HLA-DRB1*12:24N allele";
RL   Tissue Antigens 78(1):45-48(2011).
XX
DR   MD5; f06c2b69ca16089726f654bb434a5cab.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D7GK33"
FT                   /db_xref="IMGT/HLA:DRB1*15:48"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D7GK33"
FT                   /protein_id="CBL88501.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYQAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 66 C; 100 G; 47 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtacca ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer