spacer

EBI Dbfetch

ID   FN821090; SV 1; linear; genomic DNA; STD; HUM; 1293 BP.
XX
AC   FN821090;
XX
DT   09-MAY-2010 (Rel. 104, Created)
DT   09-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele
DE   HLA-C*05new, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1293
RA   Tourne S.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Tourne S., Laboratoire d histocompatibilite, EFS Alsace, 10 rue Spielmann,
RL   67065 Strasbourg Cedex, FRANCE.
XX
RN   [2]
RA   Froelich N., Weschler B., Schell A., Leisenbach R., Tourne S., Hanau D.;
RT   "A new HLA-C*05 allele identical to the HLA-C*05:01:01:01 and C*05:01:01:02
RT   alleles except a ponctual mutation in the exon 3 at position 488";
RL   Unpublished.
XX
DR   MD5; 52e0f85906f82f086cc619f6e04526f9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1293
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /PCR_primers="fwd_name: Amorce Int1C(A10), fwd_seq:
FT                   cctgggcctgtgagtgcga, rev_name: Intron 4C, rev_seq:
FT                   cctgaccyccaagcctcag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<131..400,578..853,1018..>1293)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D6CIE7"
FT                   /db_xref="IMGT/HLA:C*05:45"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D6CIE7"
FT                   /protein_id="CBL87902.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKEAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            <131..400
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=2
FT   intron          401..577
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=2
FT   exon            578..853
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=3
FT   intron          854..1017
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=3
FT   exon            1018..>1293
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=4
XX
SQ   Sequence 1293 BP; 232 A; 368 C; 428 G; 165 T; 100 other;
     gtgagtgcga ggttgggagg gaaacggcct ctgcggagag gagcgagggg cccgcccggc        60
     gagggcgcag gacccgggga gccgcgcagg gaggagggtc gggcgggtct cagcccctcc       120
     tcgcccccag gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc       180
     ggagagcccc gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac       240
     agcgacgccg cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg       300
     gagtattggg accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac       360
     ctgcggaaac tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       420
     ccaccccgag gctgcggaac ccgcccagac cctcgaccgg agagagcccc agtcaccttt       480
     acccggtttc attttcagtt taggccaaaa tccccgcggg ttggtcgggg ctggggcggg       540
     gctcggggga cggggctgac cacgggggcg gggccagggt ctcacaccct ccagaggatg       600
     tatggctgcg acctggggcc cgacgggcgc ctcctccgcg ggtataacca gttcgcctac       660
     gacggcaagg attacatcgc cctgaatgag gacctgcgct cctggaccgc cgcggacaag       720
     gaggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca gcggagagcc       780
     tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg gaagaagacg       840
     ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctccnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnngtg tctgaatttt ctgactcttc ccgtcagaac      1020
     acccaaagac acacgtgacc caccatcccg tctctgacca tgaggccacc ctgaggtgct      1080
     gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat ggcgaggacc      1140
     aaactcagga caccgagctt gtggagacca ggccagcagg agatggaacc ttccagaagt      1200
     gggcagctgt ggtggtgcct tctggagaag agcagagata cacgtgccat gtgcagcacg      1260
     aggggctgcc agagcccctc accctgagat ggg                                   1293
//


spacer
spacer