Dbfetch

ID   FN820511; SV 1; linear; genomic DNA; STD; HUM; 1145 BP.
XX
AC   FN820511;
XX
DT   09-MAY-2010 (Rel. 104, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele
DE   HLA-B*07:68var, exons 1-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1145
RA   Zingsem J.;
RT   ;
RL   Submitted (28-APR-2010) to the INSDC.
RL   Zingsem J., Universitaetsklinikum Erlangen Transfusionsmedizinische und
RL   Haemostaseologische Abteilung, Krankenhausstr. 12, D-91054 Erlangen,
RL   GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2011.01655.x.
RX   PUBMED; 21447138.
RA   Strobel J., Ringwald J., Hauck B., Eckstein R., Zingsem J.;
RT   "The novel allele, HLA-B*07:68:02, identified in a German cord blood donor
RT   and her father";
RL   Tissue Antigens 77(6):598-599(2011).
XX
DR   MD5; be76f16a7b952016995b357272e8356f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1145
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..23,124..393,494..769,870..>1145)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:68var"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D6CIC6"
FT                   /db_xref="IMGT/HLA:B*07:68:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D6CIC6"
FT                   /protein_id="CBL87063.1"
FT                   /translation="ALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDS
FT                   DAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQS
FT                   MYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQR
FT                   RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITL
FT                   TWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
FT                   "
FT   exon            <1..23
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:68var"
FT                   /number=1
FT   gap             24..123
FT                   /estimated_length=unknown
FT   exon            124..393
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:68var"
FT                   /number=2
FT   gap             394..493
FT                   /estimated_length=unknown
FT   exon            494..769
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:68var"
FT                   /number=3
FT   gap             770..869
FT                   /estimated_length=unknown
FT   exon            870..>1145
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07:68var"
FT                   /number=4
XX
SQ   Sequence 1145 BP; 183 A; 263 C; 285 G; 114 T; 300 other;
     ggccctgacc gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn        60
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnngctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc       180
     cccgcttcat ctcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg       240
     ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt       300
     gggaccggaa cacacagatc tacaaggccc aggcacagac tgaccgagag agcctgcgga       360
     acctgcgcgg ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnggtctca caccctccag agcatgtacg gctgcgacgt ggggccggac       540
     gggcgcctcc tccgcgggca tgaccagtac gcctacgacg gcaaggatta catcgccctg       600
     aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag       660
     tgggaggcgg cccgtgaggc ggagcagcgg agagcctacc tggagggcga gtgcgtggag       720
     tggctccgca gatacctgga gaacgggaag gacaagctgg agcgcgctgn nnnnnnnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnna ccccccaaag acacacgtga cccaccaccc       900
     catctctgac catgaggcca ccctgaggtg ctgggccctg ggtttctacc ctgcggagat       960
     cacactgacc tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac      1020
     cagaccagca ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga      1080
     agagcagaga tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag      1140
     atggg                                                                  1145
//