Dbfetch

ID   FN820510; SV 1; linear; genomic DNA; STD; HUM; 2689 BP.
XX
AC   FN820510;
XX
DT   09-MAY-2010 (Rel. 104, Created)
DT   09-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, allele HLA-B*580101, exons
DE   1-7
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2689
RA   Qu J.;
RT   ;
RL   Submitted (30-APR-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J.;
RT   "Identification of novel HLA alleles";
RL   Unpublished.
XX
DR   MD5; f767863cef7048fae33a69db2a67ffef.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2689
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,203..472,718..993,1569..1844,1949..2065,
FT                   2507..2539,2646..2689)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q5QT34"
FT                   /db_xref="IMGT/HLA:B*58:01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QT34"
FT                   /protein_id="CBL87046.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=1
FT   intron          74..202
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=1
FT   exon            203..472
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=2
FT   intron          473..717
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=2
FT   exon            718..993
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=3
FT   intron          994..1568
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=3
FT   exon            1569..1844
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=4
FT   intron          1845..1948
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=4
FT   exon            1949..2065
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=5
FT   intron          2066..2506
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=5
FT   exon            2507..2539
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=6
FT   intron          2540..2645
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=6
FT   exon            2646..>2689
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*580101"
FT                   /number=7
XX
SQ   Sequence 2689 BP; 494 A; 798 C; 862 G; 535 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggtgagtg cggggtcggg agggaaatgg cctctgtggg gaggagcgag       120
     gggaccgcag gcgggggcgc aggacctgag gagccgcgcc gggaggaggg tcgggcgggt       180
     ctcagcccct cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacccagttc       300
     gtgaggttcg acagcgacgc cgcgagtccg aggacggagc cccgggcgcc atggatagag       360
     caggaggggc cggagtattg ggacggggag acacggaaca tgaaggcctc cgcgcagact       420
     taccgagaga acctgcggat cgcgctccgc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg       540
     agtctccggg tccgagatcc gcctccctga ggccgcggga cccgcccaga ccctcgaccg       600
     gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg       660
     gttggtcggg gcggggcggg gctcggggga cggggctgac cgcggggccg gggccagggt       720
     ctcacatcat ccagaggatg tatggctgcg acctggggcc cgacgggcgc ctcctccgcg       780
     ggcatgacca gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct       840
     cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg       900
     tggcggagca gctgagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagatacc       960
     tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc      1020
     catctcctat aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc      1080
     gctagaatgt cgccctccct tgaatggaga atggcatgag ttttcctgag tttcctctga      1140
     gggccccctc ttctctctag gacaattaag ggatgacgtc tctgaggaaa tggaggggaa      1200
     gacagtccct agaatactga tcaggggtcc cctttgaccc ctgcagcagc cttgggaacc      1260
     gtgacttttc ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat      1320
     tccagcactt ctgagtcact ttacctccac tcagatcagg agcagaagtc cctgttcccc      1380
     gctcagagac tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct      1440
     ggtgtctggg ttctgtgccc cttccccaca ccaggtgtcc tgtccattct caggctggtc      1500
     acatgggtgg tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt      1560
     cccatcagac cccccaaaga cacacgtgac ccaccacccc gtctctgacc atgaggccac      1620
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      1680
     tggcgaggac caaactcagg acactgagct tgtggagacc agaccagcag gagatagaac      1740
     cttccagaag tgggcagctg tggtggtgcc ttctggagag gagcagagat acacatgcca      1800
     tgtacagcat gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga      1860
     ggggtcatat ctcttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag      1920
     ggcccctcgt cttcccctcc tttcccagag ccatcttccc agtccaccat ccccatcgtg      1980
     ggcattgttg ctggcctggc tgtcctagca gttgtggtca tcggagctgt ggtcgctact      2040
     gtgatgtgta ggaggaagag ctcaggtagg gaaggggtga ggggtggggt ctgggttttc      2100
     ttgtcccact gggggtttca agccccaggt agaagtgttc cctgcctcat tactgggaag      2160
     cagcatccac acaggggcta acgcagcctg ggaccctgtg tgccagcact tactcttttg      2220
     tgcagcacat gtgacaatga aggacggatg tatcaccttg atggttgtgg tgttggggtc      2280
     ctgatttcag cattcatgag tcaggggaag gtccctgcta aggacagacc ttaggagggc      2340
     agttggtcca ggacccacac ttgctttcct cgtgtttcct gatcctgcct tgggtctgta      2400
     gtcatacttc tggaaattcc ttttgggtcc aagacgagga ggttcctcta agatctcatg      2460
     gccctgcttc ctcccagtcc cctcacagga cattttcttc ccacaggtgg aaaaggaggg      2520
     agctactctc aggctgcgtg taagtggtgg gggtgggagt gtggaggagc tcacccaccc      2580
     cataattcct cctgtcccac gtctcctgcg ggctctgacc aggtcctgtt tttgttctac      2640
     tccagccagc gacagtgccc agggctctga tgtgtctctc acagcttga                  2689
//