spacer

EBI Dbfetch

ID   FN820204; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   FN820204;
XX
DT   03-MAY-2010 (Rel. 104, Created)
DT   03-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, allele
DE   HLA-DPB1*new2, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Bengtsson M.;
RT   ;
RL   Submitted (26-APR-2010) to the INSDC.
RL   Bengtsson M., Rudbeck Laboratory, University Hospital, Dep of Clinical
RL   Immunology, SE-751 85, Uppsala, SWEDEN.
XX
RN   [2]
RA   Bengtsson M.;
RT   "A new HLA DPB1 variant";
RL   Unpublished.
XX
DR   MD5; 222aec9b8babfe5226c3861c107c792b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new2"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D6CIB0"
FT                   /db_xref="IMGT/HLA:DPB1*128:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D6CIB0"
FT                   /protein_id="CBL86578.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMRRHNYELGGPMTLQRR"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new2"
FT                   /number=2
XX
SQ   Sequence 264 BP; 60 A; 68 C; 97 G; 39 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgcgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg ctgcggagta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca ggatgcgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//


spacer
spacer