Dbfetch

ID   FN813308; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN813308;
XX
DT   09-MAY-2010 (Rel. 104, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB3 gene for MHC class II antigen, allele
DE   HLA-DRB3*01xx, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Schiller J.J.;
RT   ;
RL   Submitted (21-APR-2010) to the INSDC.
RL   Schiller J.J., Histocompatibility, BloodCenter of Wisconsin, 638 N. 18th
RL   St., WI, 53233, USA.
XX
RN   [3]
RP   1-270
RA   Schiller J.J.;
RT   ;
RL   Submitted (03-DEC-2010) to the INSDC.
RL   Schiller J.J., Histocompatibility, BloodCenter of Wisconsin, 638 N. 18th
RL   St., WI, 53233, USA.
XX
RN   [4]
RX   DOI; 10.1111/j.1399-0039.2011.01719.x.
RX   PUBMED; 21707539.
RA   Schiller J.J., Gaba S.M., Hasse T.R., Fisher T.L., Ellis T.M.;
RT   "A novel HLA allele derived from a likely DRB1/DRB3 gene conversion event:
RT   HLA-DRB3*01:15";
RL   Tissue Antigens 78(5):405-407(2011).
XX
DR   MD5; aa86e2acd13139527b3333e39d3f587e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*01xx"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D6CI38"
FT                   /db_xref="IMGT/HLA:DRB3*01:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D6CI38"
FT                   /protein_id="CBL80807.2"
FT                   /translation="RFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*01xx"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 99 G; 50 T; 0 other;
     cacgtttctt ggagctgcgt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagttcct gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//