spacer

EBI Dbfetch

ID   FN806805; SV 1; linear; genomic DNA; STD; HUM; 1798 BP.
XX
AC   FN806805;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, allele HLA-A*11, exons
DE   1-8, isolate 1
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1798
RA   Qu J.;
RT   ;
RL   Submitted (01-APR-2010) to the INSDC.
RL   Qu J., Beijing Genomics Institute, Yantian District, Bei Shan Industrial
RL   Zone, Shenzhen, CHINA.
XX
RN   [2]
RA   Qu J., Li J., Chen H.;
RT   "Identification of 89 HLA-A,B,DRB1 novel genes";
RL   Unpublished.
XX
DR   MD5; f176c3017a688466749b6a06efd15ad9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1798
FT                   /organism="Homo sapiens"
FT                   /isolate="1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1412,
FT                   1513..1545,1646..1693,1794..1798)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D5H3U3"
FT                   /db_xref="IMGT/HLA:A*11:56"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D5H3U3"
FT                   /protein_id="CBL59231.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGYHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..1412
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=5
FT   gap             1413..1512
FT                   /estimated_length=unknown
FT   exon            1513..1545
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=6
FT   gap             1546..1645
FT                   /estimated_length=unknown
FT   exon            1646..1693
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=7
FT   gap             1694..1793
FT                   /estimated_length=unknown
FT   exon            1794..>1798
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11"
FT                   /number=8
XX
SQ   Sequence 1798 BP; 220 A; 331 C; 371 G; 176 T; 700 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctacca       180
     ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccagga       360
     gacacggaat gtgaaggccc agtcacagac tgaccgagtg gacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg acgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag ataatgtatg gctgcgacgt ggggccggac gggcgcttcc       600
     tccgcgggta ccggcaggac gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcttg gaccgcggcg gacatggcag ctcagatcac caagcgcaag tgggaggcgg       720
     cccatgcggc ggagcagcag agagcctacc tggagggccg gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcacggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna cccccccaag acacatatga cccaccaccc catctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca      1080
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga      1140
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagctg tcttcccagc ccaccatccc      1320
     catcgtgggc atcattgctg gcctggttct ccttggagct gtgatcactg gagctgtggt      1380
     cgctgccgtg atgtggagga ggaagagctc agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnatagaaaa ggagggagtt acactcaggc tgcaannnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnngcagt gacagtgccc agggctctga tgtgtctctc      1680
     acagcttgta aagnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnntgtga        1798
//


spacer
spacer