Dbfetch

ID   FN796427; SV 1; linear; genomic DNA; STD; HUM; 1152 BP.
XX
AC   FN796427;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, allele
DE   HLA-A*02new, intron 1 and exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1152
RA   Skrablin P.S.A.;
RT   ;
RL   Submitted (06-APR-2010) to the INSDC.
RL   Skrablin P.S.A., RCBDS Baden-Wuerttemberg - Hessen, Institute of
RL   Transfusion Medicine and Im, Sandhofstrasse 1, 60528 Frankfurt am,
RL   MainHessen, GERMANY.
XX
RN   [2]
RA   Skrablin P.S., Schulz M., Martin H., Seidl C.;
RT   "New HLA-A*02 allele found in a leukaemia patient and his brother";
RL   Unpublished.
XX
DR   MD5; 598f240515caac56752890d27f8eb1ea.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /isolation_source="blood cells"
FT                   /collected_by="Lena Thumerer"
FT                   /collection_date="12-Mar-2010"
FT                   /sex="male"
FT                   /cell_type="blood cells"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   intron          1..130
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=1
FT   CDS             join(<131..400,501..776,877..>1152)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:A*02:01:50"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D5H3I6"
FT                   /protein_id="CBL51955.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            131..400
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=2
FT   gap             401..500
FT                   /estimated_length=unknown
FT   exon            501..776
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=3
FT   gap             777..876
FT                   /estimated_length=unknown
FT   exon            877..1152
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=4
FT   variation       956
FT                   /replace="c"
FT                   /note="exon4 with nucleotide exchange from C to T at
FT                   position 80 of exon 4 in comparision to
FT                   HLA-*A02010101/02010102L"
XX
SQ   Sequence 1152 BP; 190 A; 281 C; 342 G; 139 T; 200 other;
     gtgagtgcgg ggtcgggagg gaaacggcct ctgtggggag aagcaacggg cccgcctggc        60
     gggggcgcag gacccgggaa gccgcgccgg gaggagggtc gggcgggtct cagccactcc       120
     tcgtccccag gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc       180
     ggggagcccc gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac       240
     agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg       300
     gagtattggg acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac       360
     ctggggaccc tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn gttctcacac cgtccagagg atgtatggct gcgacgtggg       540
     gtcggactgg cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat       600
     cgccctgaaa gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa       660
     gcacaagtgg gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg       720
     cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaaaacg catatgactc       900
     accacgctgt ctctgaccat gaagccaccc tgaggtgctg ggccctgagc ttctatcctg       960
     cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg      1020
     tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt      1080
     ctggacagga gcagagatac acctgccatg tgcagcatga gggtttgccc aagcccctca      1140
     ccctgagatg gg                                                          1152
//