spacer

EBI Dbfetch

ID   FN794394; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN794394;
XX
DT   30-SEP-2010 (Rel. 106, Created)
DT   24-OCT-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1*1216, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Qu J.;
RT   ;
RL   Submitted (31-MAR-2010) to the INSDC.
RL   Qu J., Yantian District, Bei Shan Industrial Zone, Shenzhen, CHINA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2010.01609.x.
RX   PUBMED; 21299540.
RA   Qu J.H., Li J., Chen H., Zheng Z.Z., Liao K.Z., Shen M.Z.;
RT   "Identification of nine novel HLA-DRB1 alleles, HLA-DRB1*04:91, DRB1*07:18,
RT   DRB1*11:01:12, DRB1*12:02:05, DRB1*12:22, DRB1*12:23, DRB1*13:100,
RT   DRB1*15:45, and DRB1*15:46 by polymerase chain reaction--sequence-based
RT   typing";
RL   Tissue Antigens 77(3):264-266(2011).
XX
DR   MD5; 4aebb7af8a5a5a4d92727e835526cc3e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1216"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:E1V2K1"
FT                   /db_xref="IMGT/HLA:DRB1*12:22"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:E1V2K1"
FT                   /protein_id="CBL51943.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDNYCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1216"
FT                   /number=2
FT   variation       186
FT                   /replace="t"
FT                   /experiment="putative SNP detected by direct sequencing"
FT   variation       203
FT                   /replace="g"
FT                   /experiment="putative SNP detected by direct sequencing"
FT   variation       217
FT                   /replace="c"
FT                   /experiment="putative SNP detected by direct sequencing"
FT   variation       218
FT                   /replace="c"
FT                   /experiment="putative SNP detected by direct sequencing"
XX
SQ   Sequence 270 BP; 56 A; 65 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer