spacer

EBI Dbfetch

ID   FN773171; SV 1; linear; genomic DNA; STD; HUM; 1842 BP.
XX
AC   FN773171;
XX
DT   27-APR-2010 (Rel. 104, Created)
DT   27-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, allele HLA-B*08,
DE   exons 1-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1842
RA   Nesci S.;
RT   ;
RL   Submitted (02-APR-2010) to the INSDC.
RL   Nesci S., Laboratorio Di Tipizzazione Tissutale, Azienda Ospedale San
RL   Salvatore, Via Lombroso, Pesaro 61100, ITALY.
XX
RN   [2]
RA   Ornella B.;
RT   "Identification of a novel HLA-B*08 allele by sequence based typing";
RL   Unpublished.
XX
DR   MD5; 78ed63070406f770214584116e63a7fe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1842
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=1
FT   CDS             join(1..73,202..471,717..992,1567..>1842)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D5H3H6"
FT                   /db_xref="IMGT/HLA:B*08:62"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D5H3H6"
FT                   /protein_id="CBL54108.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   gap             74..201
FT                   /estimated_length=128
FT   exon            202..471
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=2
FT   gap             472..716
FT                   /estimated_length=245
FT   exon            717..992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=3
FT   gap             993..1566
FT                   /estimated_length=574
FT   exon            1567..>1842
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08"
FT                   /number=4
XX
SQ   Sequence 1842 BP; 189 A; 288 C; 295 G; 123 T; 947 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn ngctcccact ccatgaggta tttccacacc gccatgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acgcagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggagtattgg gaccggaaca cacagatctt caagaccaac acacagactg       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc gnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc       720
     tcacaccctc cagagcatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gcataaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       840
     ctggaccgcg gcggacaccg cggctcagat cacccagcgc aagtgggagg cggcccgtgt       900
     ggcggagcag gacagagcct acctggaggg cacgtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggacacgc tggagcgcgc ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnaccc cccaaagaca cacgtgaccc accaccccat ctctgaccat gaggccaccc      1620
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg      1680
     gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga gatagaacct      1740
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg      1800
     tacagcatga ggggctgccg aagcccctca ccctgagatg gg                         1842
//


spacer
spacer