spacer

EBI Dbfetch

ID   FN692037; SV 1; circular; genomic DNA; STD; PRO; 2043161 BP.
XX
AC   FN692037;
XX
PR   Project:PRJEA46813;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   24-JUN-2010 (Rel. 105, Last updated, Version 3)
XX
DE   Lactobacillus crispatus ST1 complete genome, strain ST1
XX
KW   complete genome.
XX
OS   Lactobacillus crispatus ST1
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae;
OC   Lactobacillus.
XX
RN   [1]
RP   1-2043161
RA   Kankainen M.;
RT   ;
RL   Submitted (25-MAR-2010) to the INSDC.
RL   Kankainen M., University of Helsinki, Institute of Biotechnology, PO Box 56
RL   (Viikinkaari 5), FIN-00014, FINLAND.
XX
RN   [2]
RX   DOI; 10.1128/JB.00399-10.
RX   PUBMED; 20435723.
RA   Ojala T., Kuparinen V., Koskinen J.P., Alatalo E., Holm L., Auvinen P.,
RA   Edelman S., Westerlund-Wikstrom B., Korhonen T.K., Paulin L., Kankainen M.;
RT   "Genome sequence of Lactobacillus crispatus ST1";
RL   J. Bacteriol. 192(13):3547-3548(2010).
XX
DR   MD5; 75c5a47aa27b3ec3f6db2bfc06f8ab66.
DR   BioSample; SAMEA2272191.
DR   EnsemblGenomes-Gn; LCRIS_02025.
DR   EnsemblGenomes-Gn; LCRIS_02026.
DR   EnsemblGenomes-Gn; LCRIS_02027.
DR   EnsemblGenomes-Gn; LCRIS_02028.
DR   EnsemblGenomes-Gn; LCRIS_02029.
DR   EnsemblGenomes-Gn; LCRIS_02030.
DR   EnsemblGenomes-Gn; LCRIS_02031.
DR   EnsemblGenomes-Gn; LCRIS_02032.
DR   EnsemblGenomes-Gn; LCRIS_02033.
DR   EnsemblGenomes-Gn; LCRIS_02034.
DR   EnsemblGenomes-Gn; LCRIS_02035.
DR   EnsemblGenomes-Gn; LCRIS_02036.
DR   EnsemblGenomes-Gn; LCRIS_02037.
DR   EnsemblGenomes-Gn; LCRIS_02038.
DR   EnsemblGenomes-Gn; LCRIS_02039.
DR   EnsemblGenomes-Gn; LCRIS_02040.
DR   EnsemblGenomes-Gn; LCRIS_02041.
DR   EnsemblGenomes-Gn; LCRIS_02042.
DR   EnsemblGenomes-Gn; LCRIS_02043.
DR   EnsemblGenomes-Gn; LCRIS_02044.
DR   EnsemblGenomes-Gn; LCRIS_02045.
DR   EnsemblGenomes-Gn; LCRIS_02046.
DR   EnsemblGenomes-Gn; LCRIS_02047.
DR   EnsemblGenomes-Gn; LCRIS_02048.
DR   EnsemblGenomes-Gn; LCRIS_02049.
DR   EnsemblGenomes-Gn; LCRIS_02050.
DR   EnsemblGenomes-Gn; LCRIS_02051.
DR   EnsemblGenomes-Gn; LCRIS_02052.
DR   EnsemblGenomes-Gn; LCRIS_02053.
DR   EnsemblGenomes-Gn; LCRIS_02054.
DR   EnsemblGenomes-Gn; LCRIS_02055.
DR   EnsemblGenomes-Gn; LCRIS_02056.
DR   EnsemblGenomes-Gn; LCRIS_02057.
DR   EnsemblGenomes-Gn; LCRIS_02058.
DR   EnsemblGenomes-Gn; LCRIS_02059.
DR   EnsemblGenomes-Gn; LCRIS_02060.
DR   EnsemblGenomes-Gn; LCRIS_02061.
DR   EnsemblGenomes-Gn; LCRIS_02062.
DR   EnsemblGenomes-Gn; LCRIS_02063.
DR   EnsemblGenomes-Gn; LCRIS_02064.
DR   EnsemblGenomes-Gn; LCRIS_02065.
DR   EnsemblGenomes-Gn; LCRIS_02066.
DR   EnsemblGenomes-Gn; LCRIS_02067.
DR   EnsemblGenomes-Gn; LCRIS_02068.
DR   EnsemblGenomes-Gn; LCRIS_02069.
DR   EnsemblGenomes-Gn; LCRIS_02070.
DR   EnsemblGenomes-Gn; LCRIS_02071.
DR   EnsemblGenomes-Gn; LCRIS_02072.
DR   EnsemblGenomes-Gn; LCRIS_02073.
DR   EnsemblGenomes-Gn; LCRIS_02074.
DR   EnsemblGenomes-Gn; LCRIS_02075.
DR   EnsemblGenomes-Gn; LCRIS_02076.
DR   EnsemblGenomes-Gn; LCRIS_02077.
DR   EnsemblGenomes-Gn; LCRIS_02078.
DR   EnsemblGenomes-Gn; LCRIS_02079.
DR   EnsemblGenomes-Gn; LCRIS_02080.
DR   EnsemblGenomes-Gn; LCRIS_02081.
DR   EnsemblGenomes-Gn; LCRIS_02082.
DR   EnsemblGenomes-Gn; LCRIS_02083.
DR   EnsemblGenomes-Gn; LCRIS_02084.
DR   EnsemblGenomes-Gn; LCRIS_02085.
DR   EnsemblGenomes-Gn; LCRIS_02086.
DR   EnsemblGenomes-Gn; LCRIS_02087.
DR   EnsemblGenomes-Gn; LCRIS_02088.
DR   EnsemblGenomes-Gn; LCRIS_02089.
DR   EnsemblGenomes-Gn; LCRIS_02090.
DR   EnsemblGenomes-Gn; LCRIS_02091.
DR   EnsemblGenomes-Gn; LCRIS_02092.
DR   EnsemblGenomes-Gn; LCRIS_02093.
DR   EnsemblGenomes-Gn; LCRIS_02094.
DR   EnsemblGenomes-Gn; LCRIS_02095.
DR   EnsemblGenomes-Gn; LCRIS_02096.
DR   EnsemblGenomes-Gn; LCRIS_02097.
DR   EnsemblGenomes-Gn; LCRIS_02098.
DR   EnsemblGenomes-Gn; LCRIS_02099.
DR   EnsemblGenomes-Gn; LCRIS_02100.
DR   EnsemblGenomes-Tr; LCRIS_02025.
DR   EnsemblGenomes-Tr; LCRIS_02026.
DR   EnsemblGenomes-Tr; LCRIS_02027.
DR   EnsemblGenomes-Tr; LCRIS_02028.
DR   EnsemblGenomes-Tr; LCRIS_02029.
DR   EnsemblGenomes-Tr; LCRIS_02030.
DR   EnsemblGenomes-Tr; LCRIS_02031.
DR   EnsemblGenomes-Tr; LCRIS_02032.
DR   EnsemblGenomes-Tr; LCRIS_02033.
DR   EnsemblGenomes-Tr; LCRIS_02034.
DR   EnsemblGenomes-Tr; LCRIS_02035.
DR   EnsemblGenomes-Tr; LCRIS_02036.
DR   EnsemblGenomes-Tr; LCRIS_02037.
DR   EnsemblGenomes-Tr; LCRIS_02038.
DR   EnsemblGenomes-Tr; LCRIS_02039.
DR   EnsemblGenomes-Tr; LCRIS_02040.
DR   EnsemblGenomes-Tr; LCRIS_02041.
DR   EnsemblGenomes-Tr; LCRIS_02042.
DR   EnsemblGenomes-Tr; LCRIS_02043.
DR   EnsemblGenomes-Tr; LCRIS_02044.
DR   EnsemblGenomes-Tr; LCRIS_02045.
DR   EnsemblGenomes-Tr; LCRIS_02046.
DR   EnsemblGenomes-Tr; LCRIS_02047.
DR   EnsemblGenomes-Tr; LCRIS_02048.
DR   EnsemblGenomes-Tr; LCRIS_02049.
DR   EnsemblGenomes-Tr; LCRIS_02050.
DR   EnsemblGenomes-Tr; LCRIS_02051.
DR   EnsemblGenomes-Tr; LCRIS_02052.
DR   EnsemblGenomes-Tr; LCRIS_02053.
DR   EnsemblGenomes-Tr; LCRIS_02054.
DR   EnsemblGenomes-Tr; LCRIS_02055.
DR   EnsemblGenomes-Tr; LCRIS_02056.
DR   EnsemblGenomes-Tr; LCRIS_02057.
DR   EnsemblGenomes-Tr; LCRIS_02058.
DR   EnsemblGenomes-Tr; LCRIS_02059.
DR   EnsemblGenomes-Tr; LCRIS_02060.
DR   EnsemblGenomes-Tr; LCRIS_02061.
DR   EnsemblGenomes-Tr; LCRIS_02062.
DR   EnsemblGenomes-Tr; LCRIS_02063.
DR   EnsemblGenomes-Tr; LCRIS_02064.
DR   EnsemblGenomes-Tr; LCRIS_02065.
DR   EnsemblGenomes-Tr; LCRIS_02066.
DR   EnsemblGenomes-Tr; LCRIS_02067.
DR   EnsemblGenomes-Tr; LCRIS_02068.
DR   EnsemblGenomes-Tr; LCRIS_02069.
DR   EnsemblGenomes-Tr; LCRIS_02070.
DR   EnsemblGenomes-Tr; LCRIS_02071.
DR   EnsemblGenomes-Tr; LCRIS_02072.
DR   EnsemblGenomes-Tr; LCRIS_02073.
DR   EnsemblGenomes-Tr; LCRIS_02074.
DR   EnsemblGenomes-Tr; LCRIS_02075.
DR   EnsemblGenomes-Tr; LCRIS_02076.
DR   EnsemblGenomes-Tr; LCRIS_02077.
DR   EnsemblGenomes-Tr; LCRIS_02078.
DR   EnsemblGenomes-Tr; LCRIS_02079.
DR   EnsemblGenomes-Tr; LCRIS_02080.
DR   EnsemblGenomes-Tr; LCRIS_02081.
DR   EnsemblGenomes-Tr; LCRIS_02082.
DR   EnsemblGenomes-Tr; LCRIS_02083.
DR   EnsemblGenomes-Tr; LCRIS_02084.
DR   EnsemblGenomes-Tr; LCRIS_02085.
DR   EnsemblGenomes-Tr; LCRIS_02086.
DR   EnsemblGenomes-Tr; LCRIS_02087.
DR   EnsemblGenomes-Tr; LCRIS_02088.
DR   EnsemblGenomes-Tr; LCRIS_02089.
DR   EnsemblGenomes-Tr; LCRIS_02090.
DR   EnsemblGenomes-Tr; LCRIS_02091.
DR   EnsemblGenomes-Tr; LCRIS_02092.
DR   EnsemblGenomes-Tr; LCRIS_02093.
DR   EnsemblGenomes-Tr; LCRIS_02094.
DR   EnsemblGenomes-Tr; LCRIS_02095.
DR   EnsemblGenomes-Tr; LCRIS_02096.
DR   EnsemblGenomes-Tr; LCRIS_02097.
DR   EnsemblGenomes-Tr; LCRIS_02098.
DR   EnsemblGenomes-Tr; LCRIS_02099.
DR   EnsemblGenomes-Tr; LCRIS_02100.
DR   EuropePMC; PMC2897677; 20435723.
DR   EuropePMC; PMC3386020; 22335941.
DR   EuropePMC; PMC3535711; 23282177.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01710; Lacto-usp.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01767; SMK_box_riboswitch.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; FN692037.
DR   SILVA-SSU; FN692037.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2043161
FT                   /organism="Lactobacillus crispatus ST1"
FT                   /strain="ST1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:748671"
FT   CDS             1..1368
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LCRIS_00001"
FT                   /product="Chromosomal replication initiator protein dnaA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00001"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49448"
FT                   /db_xref="GOA:D5H0B3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0B3"
FT                   /protein_id="CBL49448.1"
FT                   /translation="MFDINKFWEHFNDEMRARFNEVAYNAWFKNTKPISYNGKTHELKI
FT                   LVQNPVSKGYWEKNLSSQLIQSAYGYADIEILPVFKISEDADITERIVTPAPKHEAQVQ
FT                   QPNLPEKEFTKDLKLNEKYTFDNFVQGEGNKLAAGAALAVADSPGSFYNPLFIFGGVGL
FT                   GKTHLMQAVGHQMLAERPNAKVVYIQSETFVNDFINSIKNKTQDKFREKYRTCDLLLVD
FT                   DIQFFAKKEGIQEEFFHTFETLYNDQKQIVMTSDRLPTEIPDLSERLVSRFTWGLQVEI
FT                   TPPDLETRIAILRRKAETEGLTIDDGTLNYIASQVDTNIRELEGALVKVQAYATIEKAD
FT                   IDVNLAREALVDLKLVQKNRGLQISKIQEVVANYFQTSTAELKGKKRVRQIVVPRQIAM
FT                   YLSRELTDASLPKIGQEFGGKDHTTVMHAYDKIDKQMKLDSDIKTAVFDLKQILEH"
FT   CDS             1543..2673
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="LCRIS_00002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00002"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49449"
FT                   /db_xref="GOA:D5H0B4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0B4"
FT                   /protein_id="CBL49449.1"
FT                   /translation="MKFTINRNLFIENLNNVMRAISSRATIPILSGIKLDLTEDELTLT
FT                   GSDTDISIEIQIPVNDDLNVESTGSIVLPARFFSEIVKKLPGKDFSFEVKESFQTQIIS
FT                   ENSEFTINGLDANNYPRLPEIPDAASFTISGKTFREIINETQFATSNDQTRAILTGVRF
FT                   FFSPDKIKAVATDSHRLSQRTIALENGPQAETDLIIPGKSLQELARIIGEADPEVKVCP
FT                   GDNQALFVIGNLSFYSRLLDGNYPDTDRLIPTEKTTSVEFDISELSSALERASLLTHAG
FT                   RNNVVTLTLDIENQSAKLSGKSAEIGNVEEDVSFRNLEGNNLEISFNPDYMRDALRASV
FT                   TDSVIMSFTKPLRPFIINPDKEDIEFVQLITPVRTY"
FT   CDS             2890..3111
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00003"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49450"
FT                   /db_xref="GOA:D5H0B5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0B5"
FT                   /protein_id="CBL49450.1"
FT                   /translation="MKVSIIKYFKVDGDHITLGQFLKEESIISSGGQAKWYLKDNPVTL
FT                   NGELEDRRGKKMHVGDHVVVNGQEYEFR"
FT   CDS             3120..4247
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LCRIS_00004"
FT                   /product="DNA replication and repair protein recF"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00004"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49451"
FT                   /db_xref="GOA:D5H0B6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0B6"
FT                   /protein_id="CBL49451.1"
FT                   /translation="MYLDHFTVQNFRNLKKLDVNFDSNVNIFIGKNAQGKTNLLEAIYF
FT                   LALTRSHRTNNDKDLIGFGGEFTNLLGHVHKSQVELDLRVLITQKGKKVWINRVEQAKL
FT                   SKYVGQLNAILFSPEDLELIKGAPALRRRFMDQEFGQINAEYLYFASKYRQVLIQKNNY
FT                   LKQLAKGKAKDQVFLDVLSDQLAGIAAEVVFRRFKFLKYLSHYASDAYAHISLGSEQLS
FT                   IAYHPSVADIQADDSTEEIYQKILASYARNKASEIRKGTTTSGPHRDDIEFKLDGQNAH
FT                   LYASQGQQRSIALSVKLAEIQLVHQLTDEYPLLLLDDVMSELDHGRQSALLNYIHGKTQ
FT                   TFITTTDLEGISWEIIKKPRVYHIQSGKISLEKEN"
FT   CDS             4248..6212
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="LCRIS_00005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00005"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49452"
FT                   /db_xref="GOA:D5H0B7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0B7"
FT                   /protein_id="CBL49452.1"
FT                   /translation="MADNSKENLEKVKKYEKEADKYNASQIQVLGGLEAVRKRPGMYIG
FT                   STSSQGLHHLVWEIIDNSIDERLAGFATKIEVTINEDGSVTVQDDGRGIPVDIQEKTGR
FT                   PALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTKLDVTVMRDGKKYFIDFDH
FT                   GRVKDEMKQIGTVPLDEHGTIVHFYPDPDIFTETIVFDDKILKNRIRELAFLNKGLTLT
FT                   FTDKRKDTAETDVYKFEGGIKEYVAFLNKGQEVLFDDPIYVESTYNGIDVEVALQYTNG
FT                   YKTTLMTFANNIHTYEGGMHEAGFKTALTRVVNDYAHKSKILKDKDDNLSGEDIREGMT
FT                   AIVSVKHPSPQFEGQTKTKLGNSDARTAVDKAFSETFSRFLMENPSVGRKIVEKGQLAE
FT                   RARTAAKRAREVTRKKSGLEIANLPGKLADNTSNDPSISELFIVEGNSAGGSAKQGRSR
FT                   LTQAILPIRGKILNVEKASMDRILANQEIRSLFTALGTGFGADFDVSKARYHKLIIMTD
FT                   ADVDGAHIRTLLLTLFYNYMRPMIDKGYVYIAKPPLYQVRQGKVVRYLDTDEELHDYLG
FT                   SLQPSPKPTVQRYKGLGEMDPEQLWETTMNPENRRLDRVSPEYAKDADAVFELLMGNEV
FT                   SPRRDFIQKNAKYVENLDA"
FT   CDS             6222..8702
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="LCRIS_00006"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00006"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49453"
FT                   /db_xref="GOA:D5H0B8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0B8"
FT                   /protein_id="CBL49453.1"
FT                   /translation="MDENQTQDHRIKNVDLTSMMRSSFLDYAMSVIVARALPDVRDGLK
FT                   PVQRRILYGMSELGVTPDKPYKKSARIVGEVMGKFHPHGDSSIYLAMAHMAQDFSYRYM
FT                   LVDGHGNFGSVDGDEPAAMRYTEARMSKIAVEMLRDINKNTIDWQRNYDDTENEPVVLP
FT                   ARIPNLLVNGANGIAVGMTTNIPPHNLTEVISGLHMLMKNPDATTKDLMKVIPGPDFPT
FT                   GGIIMGRGGIYRAYESGKGNIVVRAKTNIETEKSGRERIIVSEIPFMVNKAELVKKIAD
FT                   LAREKTIDGITGVRDESDQTGMRITIDIRRDASASVVLNNLFKQTQMQANFGMNMVAIV
FT                   DGAPHFLTLKQMLQYYLDHQEDVVTRRTRFELAKAEARAHILEGLRIALDNIDEIVHII
FT                   RNSQSSDIAKATLISRFGLDDKQSQAILDMRLVRLTGLERDKVEAEYKELQAKIADYKD
FT                   ILAKPERIDQIIYDELLDIQKRFGDKRRTEIGASEVVSIEDEDLIEKQNILLTVTHNGY
FT                   IKRMPIQEFKTQNRGGKGIKGMGVQDGDFIEHLIYSSTHDLLLFFTNAGKVYSKKAYEI
FT                   PEYGRMAKGLPVVNLLQLEKGEKVQTVINIPENADDNYLFFITKMGTVKRTHVSEFSNI
FT                   RNSGLIALTLKDGDELSNVLTTDGKQNILIGTHLGYAVTFSENDVRAMGRTAAGVRGIN
FT                   LRENDYVVGSGVLGADDQVLVISEKGYGKRTPAAEYPVKGRGGKGIKTANITEKNGPLA
FT                   GVTIINSNNDVMVITTDGIMIRFKIEDVSQTGRSTMGVRLIKVNDGSQVASLTIVPTEE
FT                   EQDQTGDDDEPKNE"
FT   CDS             8920..9216
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="LCRIS_00007"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00007"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49454"
FT                   /db_xref="GOA:D5H0B9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0B9"
FT                   /protein_id="CBL49454.1"
FT                   /translation="MATTKYEVTYIIKPDVDEDNKKAVVENYDKVIADNGGTMVESKDW
FT                   GKRRFAYEIDKYREGTYHIMTFTADNADAVNEFSRLSKIDNAILRSMTVKLDK"
FT   CDS             9266..9784
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="LCRIS_00008"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00008"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49455"
FT                   /db_xref="GOA:D5H0C0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C0"
FT                   /protein_id="CBL49455.1"
FT                   /translation="MINRVVLVGRLTRDPELRTTGSGISVATFTLAVDRQFTNSQGERG
FT                   ADFVSCVIWRKSAENFCNFTSKGSLVGIDGRIQTRSYDNKDGQRVYVTEVVVDNFALLE
FT                   SRKDREARGQNGGYTPNSGNAGSQPANNFPNNGGSQGNSQTNNNQNNSQDPFSGSGDTI
FT                   DISDDDLPF"
FT   CDS             9812..10048
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="LCRIS_00009"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00009"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49456"
FT                   /db_xref="GOA:D5H0C1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C1"
FT                   /protein_id="CBL49456.1"
FT                   /translation="MAQQRRGGRRRRKVDYIAANHIDYVDYKDVDLLKRFISERGKILP
FT                   RRVTGTSAKNQRKVANAIKRARIMGLLPFVAED"
FT   CDS             complement(10107..10577)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00010"
FT                   /product="Prophage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49457"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C2"
FT                   /protein_id="CBL49457.1"
FT                   /translation="MAEDNNHRKKQLITYLFNYAYDHDIGYIFFESDPNNPSLSFKNER
FT                   EICINMNWHHHSPEVPFTIAHEIGHIMNGKPNLKQYNCCLDYGGFDDEERDADIYGLHL
FT                   IYQYSCAQEDNFYDPAAFIQSYAIPERMIKEAYKMFEAEGEFFYIGRSKIHN"
FT   CDS             10682..11560
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00011"
FT                   /product="Bacteriocin helveticin-J"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00011"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49458"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C3"
FT                   /protein_id="CBL49458.1"
FT                   /translation="MRKGVTTILRGYRGNKINSPILKLSDQAGGHTQTWEFAGNHKDIN
FT                   GNDRAGQWFVGVKPTKIQGSDIIWARQMARVDINTQAGPHADNTDFPRLSYLNRAGANP
FT                   YAGKVMTHAEAAVSPNYKKFLIATIENNRIGHFTIYDLDKINQALDKSGKYKDVSLDGF
FT                   EYEDSFTINNLYGNAEDAVVNSIQGYDLDNDGNIYISSQKAPDFDGSYHAYHKQIVKIP
FT                   WNGRSETKEDQWESVNLSAFGGLDISKKHSEVESIQILSENHCYLTVAYHSKLDGKNKT
FT                   TLNRIYELSWS"
FT   CDS             11701..12807
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00012"
FT                   /product="S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00012"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49459"
FT                   /db_xref="GOA:D5H0C4"
FT                   /db_xref="InterPro:IPR004903"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C4"
FT                   /protein_id="CBL49459.1"
FT                   /translation="MKTKITLISAATLMSIVPLFALNNTAQAADNSVKKTVMHTAIAYD
FT                   KDGNRTSQKYNAYSTVTVDSKPIAINDDQYYKILGKDQYLKTTNIDGITRKITHNTYIY
FT                   KSSSARTSYRGRWKLYRGETITTYGSSYKFKNGKSYFRVGGPRKQYIKSYNLGPVVNSD
FT                   VESTSAVATVVRRAHVWTEIGPNKFENKLSNLKVGTKVLVDRLEYNRLSENSPQDEDTG
FT                   MNFRYYHIKGTKNWISEEDVKVNKKVPFHNYNKEHYTYITFPKDTDVYNADGTIQDHNG
FT                   QKISKQKGQLKVDKLVYIWVPSENKAELFYHLVGTSFYASTTPTAHWSTINVGHDAYVK
FT                   ASDVKFVYGVKINPIKHCCRSTSSCTEK"
FT   CDS             13028..15049
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00013"
FT                   /product="Phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00013"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49460"
FT                   /db_xref="GOA:D5H0C5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C5"
FT                   /protein_id="CBL49460.1"
FT                   /translation="MKDFLRKLELPEFIKDSRLTASIIIALSLSLLGSIIAMIMNPLFG
FT                   LAMLLVFILTVAFAIYGTYILAGNANSFAVNLSYRIKRSEQEAMIKMPLGILLYDSDHQ
FT                   IQWVNPYLQLYLKSTDLVGHTIESVDPDLNKLLNEAIEAKTAENHLVDWDGHRFEMVVQ
FT                   NNLGVIYLLDITRYAKIEDKYKAERLAIGQIFIDNYDELSEAMHDQELTSMSSYVQNTL
FT                   SDYAKKFNAYLKRIDEDHFLILIHMQELAEMEKDKFSVLDKVRQETSRNNTPLTLSMGI
FT                   AFGSDSLSEIANQAQSNLDLALGRGGDQVVLRQPGKDARFYGGKSNPMEKRTRVRARMV
FT                   SQAISELFKDADQVFVVGHQRPDMDSVGSGIGVVKLARLHGVKANFVLDTNKTNYDVGR
FT                   LVTLMQQKNQDKDIFINPDVALAQVTDKSMLVMVDHSKYSITYSRSLYDRLKNRIIVID
FT                   HHRRGEEFPENPMLTYVEPYASSACELVTEMIEYQQPANGKRVLTDIEATAMLAGIVVD
FT                   SKEFSLRTGTRTFDAASYLRSIGADSAVVSMLLKEDIDSFLERTHLVATLKMVKPHMAV
FT                   LCGPDDKIIDPIITAQAADTALDLENVGASFAITRRSDNTIGISARSMGKINVQIIMEK
FT                   LGGGGHLSNAATQIKDVTIEEAKQKLLDAIDEYEKEND"
FT   CDS             15061..15516
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="LCRIS_00014"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00014"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49461"
FT                   /db_xref="GOA:D5H0C6"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C6"
FT                   /protein_id="CBL49461.1"
FT                   /translation="MKVIFTQDVRGRGKRGQVKDVPDGYAQNYLIKRGLAKEATKGNMN
FT                   TLKRVEANEKAAYEAEKAEAEKIKAELEKDDTVVNFKSKAGTDSRLFGSISSKKIVEGL
FT                   EKQYGIKVDKRKLNLPEPIKTLGYTNVHAKLFKGVEATIRVHVTEQD"
FT   CDS             15536..16927
FT                   /transl_table=11
FT                   /gene="dnaB1"
FT                   /locus_tag="LCRIS_00015"
FT                   /product="Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00015"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49462"
FT                   /db_xref="GOA:D5H0C7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C7"
FT                   /protein_id="CBL49462.1"
FT                   /translation="MDNIVSQQIPHDRDAERAVLGAIFIDPEAIADASAVVQPEDFYER
FT                   ANQIVFQAMLDLSDRGDAIDTLTLQDELNKRNQLEDIGGIGYVSELAMATPTAAHVTYY
FT                   AKIVHRKALLRRLISASQKIISNAIDGSDDVTDILDDAESEIMNVSSENSTGGFRTIKE
FT                   IVNSAINDINNIPDDGNMVTGLPTGFAELDKMTTGFHDDELIIVAARPGVGKTSFALNI
FT                   AQNVGLHTEKSVAMFSLEMSGEQLVQRMLASEGLINSQHLRTGQLDEEEWRKLVVASGS
FT                   LAGAQIFIDDTPGIKMSEIRAKSRRLAKEKGNLGLIVIDYLQLIEGPRSESRQQEVSAI
FT                   SRQLKKLAKELHVPVIALSQLSRSVEQRQDKRPVLSDIRESGSIEQDADIVSFLYRDDY
FT                   YRDEPDDGESSGSQDEVGAEDDNGEVEVIIEKNRSGSRGTVKLMFSKPFNRFSNLDYAH
FT                   DPNGN"
FT   CDS             17095..18030
FT                   /transl_table=11
FT                   /gene="phnD1"
FT                   /locus_tag="LCRIS_00016"
FT                   /product="Phosphonate ABC transporter, phosphonate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00016"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49463"
FT                   /db_xref="GOA:D5H0C8"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C8"
FT                   /protein_id="CBL49463.1"
FT                   /translation="MKFKKILLGACAVLAAVSLAACSNSKKSSSSSNEPKELNVEFVPS
FT                   TQANKMEAKAKPLGTLLQKQLHIPVHVTVSTDYSGLVEAMSSKKVDVGFMPPYSYILAH
FT                   KKGIADVLLQAERYGYDEPSGKMNHTLMHKYRGMIVVKKGSKIKSWKDLKGKKIAIGDP
FT                   SSSSGYVYPVAELYKKGLNVTKDCKLVNVKGDDQEVLSVLNGDVDAAFVFSDARNIAAK
FT                   DDKKAMTDVVPIYFTKWIPNDTIAVRKDMPKKFRVKLAKAFKNIAKSKKGKQIIESIYN
FT                   HYGYVEAKDSDFDGLRQYQKIVNKATGGSN"
FT   CDS             18140..19069
FT                   /transl_table=11
FT                   /gene="degV1"
FT                   /locus_tag="LCRIS_00017"
FT                   /product="DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00017"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49464"
FT                   /db_xref="GOA:D5H0C9"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0C9"
FT                   /protein_id="CBL49464.1"
FT                   /translation="MKIAVLTDSSAYLTKEQQEKYQIDVLPIPIIWGKKVYHDLVDIGY
FT                   EEFYQKLNTAKELPTTSQPSIGDLKQKIDEYVAAGYTDVIVITLSSGISSYFSTVQSVA
FT                   AEEDRIKVHPFDSKITCAGEADYAMLAGRLIEAGADIDLIMHDLKDLQKTMDVRFMVDD
FT                   LSHLKRTGRLSNAASFVGTLFKIKPILSMDVQNEGKISAIAKERQYKRAYRHVQNDFDN
FT                   LTKNLSYKIQDTIFDSLDPEKKQAWLDDYRAKFPKYKFDTSIIGPVVGVHVGQGTMSMI
FT                   WCRDLDTYFDENGRPIEGIESKVVEDPA"
FT   CDS             19185..20063
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /locus_tag="LCRIS_00018"
FT                   /product="Fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00018"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49465"
FT                   /db_xref="GOA:D5H0D0"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D0"
FT                   /protein_id="CBL49465.1"
FT                   /translation="MSEKKYVGSIEAGGTKFIVAVQDVETGEEVARDRIPTTTNKETLE
FT                   KTAEFFKKHPVDALGIGTFGPIDINPNSRTYGYILDTPKPGWSGTNVKGFFERELGIPV
FT                   AMTTDVNASCYGEYVARGRDDSKSYFYATVGTGVGAGIVQAGKLLGLNNHPEMGHMLVR
FT                   RYPGDDYEGHCPFHNDACVEGMSAGPSLEGRTGIPGEKLSRDNKVFTYSAYYIAQMLFN
FT                   VYMTARPDVMIVGGSVLNEDDLVKVRKFFDEFNNNYIATPDLNELIVRPAVAHNGSATL
FT                   GDFELAKNLLK"
FT   CDS             20211..20402
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00019"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00019"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49466"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D1"
FT                   /protein_id="CBL49466.1"
FT                   /translation="MNKSDSGLKDKVIGKVKEVEGKITGDKSREVQGKAQQAKGKVKDK
FT                   AKKLKDDLEKDHQIDEDC"
FT   CDS             20453..20710
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00020"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49467"
FT                   /db_xref="GOA:D5H0D2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D2"
FT                   /protein_id="CBL49467.1"
FT                   /translation="MLSWIWVLIVGAIIGLIAGFITGKGGSMGFLANLIAGLVGSTLGQ
FT                   AIFGSWGPQMAGMAIVPSILGAVILVLVVSFVLGMLRRTE"
FT   CDS             complement(20762..21991)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00021"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00021"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49468"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D3"
FT                   /protein_id="CBL49468.1"
FT                   /translation="MAGTLDYLRWRGDLSFKERSFNSVDASLFASIIYLPVDKSAKGHT
FT                   LSEVAEKLRVLPSFQVQMKDLAGDQVLLLPKSPRLGDIKILNWTNRLEKDPYPLQFTAA
FT                   TFRLTDNTIIIVYRGTDSSIIGWNEDMNMNYMPKVYGQDIAANYLKEMAAAFPHDKIYL
FT                   AGHSKGGNYAEYALSVAEPKLQDRIIKAFSFDGPGFFHQVWKAPGFVRALPKMKTYLPE
FT                   ASIIGTMLDHPERVLIIKSTAPMVQQHDPRRWAVGRDSFVLAESLTSGARSLRHSLIDF
FT                   NHSIPEKQRGELWDALFQAFDELNITDVFQITANKLLGTVRFSRVIMSLEPETRRYVLH
FT                   MFGEIINALRGNISLPFNENDFALYPKSNDSNKAPIFFEFYDKTVPSLLPEEVKHRFLA
FT                   EKENEHQKLK"
FT   CDS             complement(22089..22790)
FT                   /transl_table=11
FT                   /gene="mgtC"
FT                   /locus_tag="LCRIS_00022"
FT                   /product="Mg2 transporter-C (MgtC) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00022"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49469"
FT                   /db_xref="GOA:D5H0D4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D4"
FT                   /protein_id="CBL49469.1"
FT                   /translation="MQTLAPITTELDWLLRIVVAAFCGALIGYERAIQRKSAGVRTHIV
FT                   VAIASALFMIVSKYGFTDLLSMHDIALDPSRIAAQIVTGISFIGAGTILVRKEQVSGLT
FT                   TAAGVWATAAIGMAVGAGMYFIGILSTALLFIIQMIFHDDVIINKITPHVRFNIQIVAI
FT                   NQHHILSKIRQELADNHVENVTVKILDVSDDHIVFYVDGIINNKIDENSIVMNLRKYPD
FT                   ITRISYTRGGM"
FT   tRNA            22965..23037
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="LCRIS_02037"
FT                   /product="transfer RNA-Thr"
FT   CDS             23214..23435
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00023"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00023"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49470"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D5"
FT                   /protein_id="CBL49470.1"
FT                   /translation="MVNLGHLRISGQTGAKRSILICSVVLNLALFALLFIQTILNHETL
FT                   TWISVIALLIISFLVELAWRKKNKRNLH"
FT   CDS             23595..24662
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00024"
FT                   /product="putative protein without homology, LPXTG-motif
FT                   cell wall anchor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00024"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49471"
FT                   /db_xref="GOA:D5H0D6"
FT                   /db_xref="InterPro:IPR008456"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D6"
FT                   /protein_id="CBL49471.1"
FT                   /translation="MKKLLIGSAVLAALLIKENIAVNAAIEQNETTPRIAVTDKKEKPK
FT                   DQFDNSLAGHYDQETNFITWEIRLNPKKEKYTGDLKLENLIPEGLVLDPDTIEVIKNDN
FT                   FIQNSSLVKLKKNKLTAEFPAKKYSESTILIKYRTKVEAEPNEPNYLRVSQSFTLGDDR
FT                   VQEYEQEIKYDRSNKNFNIEAPHKSTFRDDNQISLIKKSKNNEERSEDWLKRLAELIIN
FT                   KKETTSDKGGEKVQGQVKDQKQQVSPENTNLSRTPTVKGLTGFDTKANEVKSTAKIDSD
FT                   SVKTTLDKDEIKDNASTISPKSQKHDTHVTLPKSDTSETKAKLPKAGETAGVMLSVLGI
FT                   ILIIAGWTVRTKFLK"
FT   CDS             24761..25534
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00025"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00025"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49472"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D7"
FT                   /protein_id="CBL49472.1"
FT                   /translation="MPYTISEIIVLFFTYSVIGWLWETFYCSIKDHHYDYRGFLFGPYC
FT                   PVYGFAVTTILICTKDVRDNLLLLFIVGTIVATIFEFVASWLLETIFHMKLWDYSKLWG
FT                   NIQGRVAPMISLFWGVGVVLLVKFIQPIIQKLINNEEKITHGWLAVGITIVMGIDLVLT
FT                   VISVERFHTTTKMWDVHINHFIERVRTKVESHMPEKGKLRVGDWHHSVMQHYDELQPQR
FT                   LSWNHKRYLKSFPKLKVTDAPKFMEIKKEVLKKES"
FT   CDS             complement(25602..25766)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00027"
FT                   /product="Adenosylcobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00027"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49473"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D8"
FT                   /protein_id="CBL49473.1"
FT                   /translation="MVKLSLNEQELSDDVLKYINRLSDYLFTLGRYANVLDNYTEIKSK
FT                   KREPNRING"
FT   CDS             25759..26073
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00026"
FT                   /product="putative protein without homology, LPXTG-motif
FT                   cell wall anchor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00026"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49474"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0D9"
FT                   /protein_id="CBL49474.1"
FT                   /translation="MTNIIATLSTPEKSGYTADRTVVPKPEQPATPVDNGTDIIATPST
FT                   PETTEEEHLTVKDHVGSSTLRRGLPQTGEKKSTLNAGFALACIGLALLAGMLFDPKKKH
FT                   "
FT   CDS             26168..26428
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00028"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00028"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49475"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E0"
FT                   /protein_id="CBL49475.1"
FT                   /translation="MNTLCISIVHFSEIVSIQDDLFEFPVFEGQPKSMEEFFSRLETIG
FT                   KAWHKAYDTIDSDTDRVIKRTKMDARTTLDLLEHLSPVQLS"
FT   CDS             26758..30456
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00029"
FT                   /product="Mucus-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00029"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49476"
FT                   /db_xref="GOA:D5H0E1"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR009459"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E1"
FT                   /protein_id="CBL49476.1"
FT                   /translation="MLERVPKYTLRKLSVGLASVMIGSGILMSSPKVLAATNADKSTNT
FT                   NVQPGTSNQNEDKGNSENQSRTSVPDDTHSTGTNVQPGTSNQNEDKGNSENQSRTSVPD
FT                   DTHSTGTDVQPGTSNQNEGKGNGESQSDATTPTTPSDSTSMAIVNDKNKLDKNWIKLDN
FT                   GKAQIYFTVKGNDQKPYVTSYMDKNVESTLYTKRFDPNSLELHIEYQNGDKDAGPGLVL
FT                   VWDDKYLQLNTSRIGAEDLVYTTNSGVKDYVPVSPGNGFYKSYNEWLKEKQDPSKLHLI
FT                   SLWQKVPANSTFTATLPFKYVGNADVVKSTRVDAYLKPYSTTLTFDPFELHPEQINPAP
FT                   KPTTDDATTTTGVYNNPLATSSDWIKMTHGKAIGYYTAKGKDGKTYVTGYAAAKDGSQS
FT                   IFNVNQIDVDSLEFHLIYHNGDKEVGSGLWFNFADGKTLKLDTSRLGADGPQLKSQQGW
FT                   SYKWAINGGADQGIYYNSWAEYLKAHNNVGDQANQISMTGVALKPDDTIEFKIPVKYTG
FT                   QLSDRTQSLSFEQDIDDYGSGFNRNKATLYFTTVRRDVSKINNVVLVPAEFVGEQPGHS
FT                   SWEIVKDILPDMPNGFDAVKITNFPTFKGSFNMDSLPKGSLPKVIYGTAQYYIDLAQIQ
FT                   NIFADHGYTVKYLLNNGKAQEMPFYAYVTLPLATYVNDSGTKPDPSIWYIQVQAVPALF
FT                   LNKDQHYVADPNAKPWDTTSMVDAIYEADDPGPRKNRDQLKQLPKTDVDISYTYQALGS
FT                   NDAVKADKVDLTKAGIYTVTYSHTYADGRVVSDSRKVYVDGVNQETKDITRTIIVHEPN
FT                   GTDQTVIQKATLTRTVTLDAPTGEIKSAGKWSTAKWERYSAPEFKGYTPAPAQIDETAV
FT                   NKDTQDTTVEISYTANEITKQETKDITRTIIVHEPNGTDQTVIQKATLTRTVTLYAPTG
FT                   KIKSAGKWSTAKWEAYSAPEFKGYTPDKAQIDETAVNKDTQDTTVEISYTANEITKQET
FT                   KDITRTIIVHEPNGTDQTVIQKATLTRTVTLYAPTGKIKSAGKWSTAKWERYSAPEFKG
FT                   YTPAPAQIDETTVNEDTQNTTVEISYTANETSEQPGHSKDNSNNDNNGGNSGVIVPINP
FT                   SANNSNNSNNSNTAPTDNNTDTSKPTRTNRTDDISPKANVMNMTKRTTKSGTISPKAGA
FT                   LANTTAGPATSAKANMENGIAKNNSQNSQTLPQTGENESKVAFAVAGLLAAALGIFGIA
FT                   INHKKEN"
FT   CDS             complement(30609..30776)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00030"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49477"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E2"
FT                   /protein_id="CBL49477.1"
FT                   /translation="MQSFIQAVKTGNTHELKLLINCQDQIGTLMHKTLLTFKHNLKAVL
FT                   NGAKLPYSNG"
FT   CDS             complement(30842..31225)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00031"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00031"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49478"
FT                   /db_xref="GOA:D5H0E3"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E3"
FT                   /protein_id="CBL49478.1"
FT                   /translation="MSYRQLHFICLDGDNHQVVQILRTRYKKTLLKYFGRFSLQARANV
FT                   KTVTMDLNFYYQDIVRACFPNAQIVIDRFHMIQMLTRSFNSLRDQVMKTFDKRSRQYQL
FT                   LKSPWKLYLKKFILTITGTTKTA"
FT   CDS             complement(31185..31433)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00032"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00032"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49479"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E4"
FT                   /protein_id="CBL49479.1"
FT                   /translation="MAQSELVNKYCSISNASKLKVLSALTEDRSMTSIARENNISINTV
FT                   QRVLGNYSHRFIDSYEYLPAHLAFDELPPAALYLPGW"
FT   CDS             complement(31856..33616)
FT                   /transl_table=11
FT                   /gene="oppA1"
FT                   /locus_tag="LCRIS_00033"
FT                   /product="Oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00033"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49480"
FT                   /db_xref="GOA:D5H0E5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E5"
FT                   /protein_id="CBL49480.1"
FT                   /translation="MSKAKRYFGALALVSGAALSLVACGNNKNAKTNDAADTHHKFSQT
FT                   VPVKSVKKGGTLNYAIESDSPFTGIFLPELSDTTTDSEVAGPGQEGLFSVNDQYKINNK
FT                   GAATFKLDRKAKTVTIEVKKGVKWSDGKQVNAKDVEYAYEIIANKDSKSQRYTDSLADI
FT                   VGLAEYHEGKSKKISGIEMPDGENGRKVVIHFKQMKPGMLQSGNGYFWEYAEPYHYLKD
FT                   VPFSKLMSSDKVRKQPLFYGPFRVSKLVRGQSVTWERNPHYWRGTPNLEKVSMTVIGTN
FT                   SVTQAIKSHKFDVAGVVNTQWEDVKNATDTNFIGNVPLSYSYLGFKVGKWDKKAGKNVE
FT                   NKNSKMNNPSLRKAMAYAMNVDAVAKRYYHGLAFRVNTLIPEQFGDYTDKSIKGYPYNL
FT                   KKANELLDKAGYKKKGEYRVQPNGKKLVINLAVRNNSTTAEPVWRNYIQQWKKVGLDVK
FT                   FVGGRPMEFNNWVQAVQSDDPRIDVFEGGWSLSSEPSPNDLYNEAAPYNLARFVSPKQT
FT                   KLLADIDSEKAFNPTYRANAFKKWQKWMYDEAYVVPTTNQYSITAVNKKVTGWSLKPSA
FT                   NTWFTAGFVK"
FT   CDS             33813..34847
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00034"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00034"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49481"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E6"
FT                   /protein_id="CBL49481.1"
FT                   /translation="MDTAWKKFKNNIPLRRFVVLLLIIACLYEIRAMMNTVLLTFIFTY
FT                   VIVHLIHLVQRYFPKIPTGLIVAVTYLIILALLYFVVTIYLPMLVGQISKMVKSVMAFY
FT                   ESNESSRLASHVTRYISKGEIVTQAKRVGTFALHTVTNFGSLTIATFMSLILSFFYTIE
FT                   LDRMIEFSKLFVKSGYFKWLFEDIRYFGKKFTNTFGVVLEAQFFIAICNTALTMIGLAF
FT                   MHMPQIIALGLMVFILSLVPVAGVIISLIPLSIIGYSVGGIRYVIYIFIMIMIIHAIEA
FT                   YVLNPKFMASKTELPIFYTFLVLLVAEHFWGTWGLIVGVPIFTFLLDVLGIKSAKKSKK
FT                   KANK"
FT   CDS             34847..35419
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00035"
FT                   /product="Esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00035"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49482"
FT                   /db_xref="GOA:D5H0E7"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E7"
FT                   /protein_id="CBL49482.1"
FT                   /translation="MRVLLTGDSIIARQEGKNEPHLNWNLQQLLPEIELENTAVSGINS
FT                   GAFFAKLNELVLSVKQCDNLVILLGTNDLAMHKQVPARQFKQNMEIISSAIICQYYPPH
FT                   VLLVSPPAVDEAKQRVRNNTLVAEYAQIVKEVAHEYHFRYADLAQAMRDTGDLSEICQG
FT                   VKNDGLHFGDRGYEILGKLIAENLKQM"
FT   CDS             complement(35453..35635)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00036"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00036"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49483"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E8"
FT                   /protein_id="CBL49483.1"
FT                   /translation="MLSLLLTLLLLWLFFKLGIGLIKVIGFLLVVGIMFFFFAYLLIPF
FT                   LAIALAGSLLWATLK"
FT   CDS             35819..37153
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00037"
FT                   /product="Sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00037"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49484"
FT                   /db_xref="GOA:D5H0E9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0E9"
FT                   /protein_id="CBL49484.1"
FT                   /translation="MEEKKTGLPTLASTTIWMISLGYLGVQIAFTLETSQMSRIFQTLG
FT                   ADPTKLGWFFILPPLAGLVVQPGIGSLSDRTWIPKIGRRLPYLLVGMIFAVITMILLPN
FT                   VGSFGLGYGSIEALIFGAVAIAILDVASNMAMQPFKMMIGDMVNDEQKSYAYGIQSMLS
FT                   NFGAVIAAFFPFLLTSLGVANTAKKGVVPQSVIISFYVGAAVLVITSLFTIFRVHEYDP
FT                   ETYARYHGIKESDNQEGGGWIELLKKAPKVFWQVSLVQFFCWISFQYLSTYATGAIAQN
FT                   VWNTTNASSAGYQIAGNWFGVLTAVQSIAAVVWSYVLAKVPNNHHKLGYGISLLLGGVG
FT                   YTSIFLIHSQGLLILSFILIGISWAGMNTYPLTMVSNALSGKHMGTYLGLFNCSICLPQ
FT                   IVASLLSFMIFPMVGNSMPAMMLITGISGFLGALSVLAIKETYVK"
FT   CDS             complement(37561..38322)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00038"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00038"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49485"
FT                   /db_xref="GOA:D5H0F0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F0"
FT                   /protein_id="CBL49485.1"
FT                   /translation="MSTILDLQNITTTVNAGTNEEKQILKNINLKLEDGDFVTLLGTNG
FT                   AGKSTLLNIINGSIFPTSGKIMLKDQDLTNLSEVKRAKYIAQVFQDPKMGTAPRMTVAE
FT                   NLLLATKRGEHRGLRLRGLDKHMQEFKRQAAQLPNGLNERLNTFVGNLSGGQRQTLSFL
FT                   MATIKRPDLLLLDEHTAALDPNTSRELLELTDKVVQEEHLTCIMITHQLKDAIKYGNRT
FT                   IILNNGRIVFDVKGDDKKRLTEEDILQYFTD"
FT   CDS             complement(38319..39215)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00039"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00039"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49486"
FT                   /db_xref="GOA:D5H0F1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F1"
FT                   /protein_id="CBL49486.1"
FT                   /translation="MSLITSSIGQGLLWGILALGLYLTFRILNFPDMTVEGTFPFGAAI
FT                   CVSALVHGVNPLAATILSFFAGMVTGLVTGLLYTKGKIPVLLAGILTMTSVYSVNLRIL
FT                   GKANVGLLNKNTLLNGQLLQKLPINFPTIVVGLIIAIIVIVLLAVFLDTDLGQAFIATG
FT                   DNEKMAQSLGINTDNMKILGLMLSNGLIGLAGGLLAQNGGYADVNMGIGTMVIGLAAII
FT                   IGEVVYGNLSLTARLVAVVIGSIIYRLILLLVLQLGFSTNDFKLISAIILAICMMLPLF
FT                   EQKFRTRKLLKKGVEKP"
FT   CDS             complement(39212..40204)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00040"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49487"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F2"
FT                   /protein_id="CBL49487.1"
FT                   /translation="MKRLIGTIIALFAFLAVAFVSEVNKKNAEKKTPTVGILQTMSHPA
FT                   LDQIHRGIIQGLKDEGYIEGKNLKIDFQNAQGDQSNLKSMSDRFSQENATVTIGIATPA
FT                   VQSLANTSGNIPVVMGAVSDPLGAHLVKSLTHPGGKITGVQDRQPIASQLALMQEILPK
FT                   AKNIGVIYTSSDDSSASEYREFRRLAEAKGLKVIPYTITSTNDIEQVAQTMVGKVQAVY
FT                   VPTDNTVASGITTLLKATNSAKIPVFPAADTMVKSGGLATRCVSQFDMGILTGKMAGQI
FT                   LHGKNPATLPVKRVTHYETVINEKAAHELNITIPNSVVQAAQKKGRIIK"
FT   CDS             complement(40487..42094)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00041"
FT                   /product="ABC transporter, ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49488"
FT                   /db_xref="GOA:D5H0F3"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F3"
FT                   /protein_id="CBL49488.1"
FT                   /translation="MSYLFKYLKKEPKLVMIVTLLTIITSSLRVTHALINVSIFNALIK
FT                   LQIDRFFKYVGLDIVVFAILSIFLILLQIQTTKTVQYLSIDLRKDIINQIEKKRITDFQ
FT                   KKDTGIYASWLTNDTTTIENQGFYNILQAIQIITDPLFSIIALVQFSWTFVPLILIVSL
FT                   LTVLLPQIIHKKLANAGLSTTKANERLLNVINDSLRGFTTFSIFGMERQLEKRIIGTAL
FT                   SVANKKIKQEKYQAVANNLAGFSNIIGQTGIQAWTGFLALNKIISIGVIGSSGNLSYNV
FT                   FNSLAVIAPIWTEMTALTPIFEKYHLDNNQNSKQEGYQLTDFKFKSLSTRNLQMTFDHK
FT                   RIFQHPLNTKINTNEKVGIYGQSGSGKSTLLKIISGQIQNYQGSIRLNNIEEKEISYDS
FT                   LRQTAIYIDQTPYLFDDTVLYNLTLGENFPSEQINKILEKIDLADFINQLPQGLNTQIG
FT                   EGGANLSGGQKQRLALARGLLRKKSLFLFDESTSNLDKKTALKVENDFLKQKDITVIFV
FT                   SHQLHEENKDRFDQLLEI"
FT   CDS             complement(42184..42996)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00042"
FT                   /product="Transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00042"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49489"
FT                   /db_xref="GOA:D5H0F4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F4"
FT                   /protein_id="CBL49489.1"
FT                   /translation="MTIGSALKQLRTKLGLTQAEMAAGIISVSFYSKVERDIHDIGTTE
FT                   LIELLNQHNIDVTTFFTTYISPKSKPDTDILEQINTAYERGDKKELLKIQTKLNALPKD
FT                   HVTEYYRLQLRLYLDVYLPRAKKIPLDLKMKLKEYVFRNDNWDVYSLQTFRETMRIYHL
FT                   DELSFLVNAILVKYPDPNKLTTMLAENVGAICVNYLDNCYEYNAPELISRPLNYLQRLP
FT                   YHKEILLVKILGNYYQAVFAKDRAKCAQILQVLKDAGCHDLIKVLPRL"
FT   CDS             43109..43816
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00043"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00043"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49490"
FT                   /db_xref="GOA:D5H0F5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F5"
FT                   /protein_id="CBL49490.1"
FT                   /translation="MRYKQIIFDVDDTIIDFAATEDFALHSLFNTHHWPLSAELQRQYH
FT                   SYNQGLWRRLEQGELTYEELSEMTFHDFILDHFGIEIDGKKAMDEYRSYFGEAHQLLPG
FT                   VEDTLIFAKKQGYKLTVLSNGEKFMQNHRLELAGVKKYFDLIVTSEEAHYSKPNPHAFD
FT                   YFFSRTEIGPSETVFFGDGLQSDILGAEKYGFDSIWYNHRHRKNTLNLHPKFVVETYPE
FT                   LVKLMQNDFEKKY"
FT   CDS             complement(43813..44682)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00044"
FT                   /product="Mg2 and Co2 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00044"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49491"
FT                   /db_xref="GOA:D5H0F6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F6"
FT                   /protein_id="CBL49491.1"
FT                   /translation="MLTNSQNIILKDQLTQNDIDHLIKKWDLDPTIFTYPNSSIEVARF
FT                   IPIDSNKLKNGHLLVSFDLLSNNLPIEQELIPIFTIFDQNHLFIDTTRSLSELKPQENI
FT                   IETIFQSLCIQIKHLHAELVTIKQKIDHLDQAARRTTKTKELKKVTDLTRQLVYLKHTL
FT                   DDQTPSLEEFCDYLVENKLANPARVKSIITRQKRITKMIHVYTDLLNSISGLFTAMMDS
FT                   HLNHLMKYLDSAALVIALPALISGIWGMNVGGLPGKENENGFWILIIFVSLLTIGWGIF
FT                   LKSKKYND"
FT   CDS             44798..45655
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00045"
FT                   /product="Oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00045"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49492"
FT                   /db_xref="GOA:D5H0F7"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F7"
FT                   /protein_id="CBL49492.1"
FT                   /translation="MELHSLTDTYTLNNGVEIPVIGFGTWQTPSGEVARESVEAALEAG
FT                   YRHIDTAAAYGNEESVGEAIKRSGVNRHELFVTTKLWNSDHGYDKTKKAIDTSLEKLDL
FT                   DYLDLYLIHWPNPVAMRDNWAELNAESWQAMEEAVKAGKIRAIGVSNFRKHHLDELMKT
FT                   AKIKPVVNQNYLNPSDLQPEVTVASKQYDLLNEAYSPLGTGGLLGNEVVNAVAENYGKS
FT                   PAQILIRWSLQHGFLPLPKSVHPKYIAANGDVFDFEISPEDMKKLDVLRGASGLANDPD
FT                   EVNF"
FT   CDS             complement(45722..46426)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00046"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49493"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F8"
FT                   /protein_id="CBL49493.1"
FT                   /translation="MKLNKSLLTLLTTVTLTTLLGAAPITVKASNYSSNVTANQKKHYV
FT                   IKNTPKLSKWGYVLNVNSSALPIFVGKSNYQKLLNNPYFKGTKSVSPKRLKNVRFKIVK
FT                   IMVFKDVNGTPEYLITSKNHKYNTWTPNAGLQYYDIHSKYLQRVMKPLKKIKERDLRVL
FT                   NRKIAGKESVSGQKRIVQNKHDFDLAVKSARKLKGNQRKFVLGSLHQMKQDDGIRNVMQ
FT                   EKQNNILLWTIN"
FT   CDS             complement(46846..47664)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00047"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00047"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49494"
FT                   /db_xref="GOA:D5H0F9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0F9"
FT                   /protein_id="CBL49494.1"
FT                   /translation="MTIGEALKKLRQSLELTQAQMIQGSKISITHYSKMEKGQNRIFVD
FT                   DLMLILQLHGVSPADFFKEYFPTKEDTISSKISQELNRSFYKNDIKKAKELQKLILNTK
FT                   HVSTELKDRAGLIIAVLTARDNKTDTTAITQAMHDFFKYKEWMNDDNAITLLSNSIRRD
FT                   NLKDLTPLIMMLIRKYKKLNEQNLTKQRRLATVGINYLYVLRKYFSNSDKIAFKILSWL
FT                   ESLTADPELCLYKELILYFHSVYTDKRQAILIKKLLKLSDYPKIADNLPE"
FT   CDS             complement(47721..47891)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00048"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00048"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49495"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G0"
FT                   /protein_id="CBL49495.1"
FT                   /translation="MTRRSKTNKFNERLIPNEETKRAIEIAHAEETGLIPDTAKDFTDS
FT                   DAAINYLFGKK"
FT   CDS             48029..49954
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00049"
FT                   /product="Translation elongation factor, homologous to
FT                   tetracycline resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00049"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49496"
FT                   /db_xref="GOA:D5H0G1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G1"
FT                   /protein_id="CBL49496.1"
FT                   /translation="MKKITTGIVAHVDAGKTTLSEALLYKVGNLRTLGRVDNGDAFLDT
FT                   DQLEKKRGITIFSHEAKLTTDDLEITLLDTPGHVDFSAQTEETLSVLDYAILVISITDG
FT                   VTSYTRTLWHLLKRYQVPVFIFVNKVDAIGADRGMALVDIQKNLSESCVDFSKIDDEFY
FT                   ENVAATDDALLEKYLDSGAMSDQDVQNAIVQRKVFPIYFGSALKLTGITEFLAGFSKWT
FT                   KEKEFSDKFAARCFKISHDNKGERLTWLRILGGSLKAKTELAGEKINQLRSYNGEKFVT
FT                   ITEAAAGEIVAATGLAKTYPGQGFGVGDAPAALLKPVLTYKVNPQDNDLHACLKALQTL
FT                   EDEDPQLHVTWSEHLQEIHVQVMGKIQLEILEQLMQERFGLNIVFEQGSILYQETITKP
FT                   IEAVGHFEPLRHYAEVHLLLEPLPRNSGIVFENKCSLEVLTKNWQHQIMTALKSKEHLG
FT                   VLTASPITDMKITLIGGKGSIVHSVGGDFREATYRAVRQGLMEEKLRQQTILLEPWYDF
FT                   RLEIGKDQVGRALNDIQRMNGKFSTPENIGERTVISGSAPVAEMQDYATEVRNYTHGEG
FT                   NLECVVSGYLPCHNAAEIIEEKNYDPVSDLENTPNSVFCSHGAGHTVTWDKVPETAQYP
FT                   YTYPLD"
FT   CDS             50123..50941
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00050"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49497"
FT                   /db_xref="GOA:D5H0G2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G2"
FT                   /protein_id="CBL49497.1"
FT                   /translation="MTQIPFKAVAVDLDGTFLTEKKTFDHALFAKVLRKLQANQIPFIC
FT                   ATGNQLIRSHEYFDEFTNEVDYVSENGAILEADGKVFKLIAIDYKIAQKLLHFIQTEYP
FT                   EAIIMVSAQHHCYILKSMDQTDKDDIRIYYRDVQEIDQFTDIDPADAILKVCLTADDEL
FT                   AQVIQDRFNEKYGDCIRGTSSGNMTIDLVHKGINKAKGVDDMLKHYGIAQKDLIAFGDG
FT                   ENDIDMLKACGYSYAMKNANAKAKAVAKYEAPTNDENGVLKVLAKYLDID"
FT   CDS             complement(51010..52023)
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="LCRIS_00051"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00051"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49498"
FT                   /db_xref="GOA:D5H0G3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G3"
FT                   /protein_id="CBL49498.1"
FT                   /translation="MTKIFAYAIRKDEEPFLNEWKDAHKDIDVDYTDKLLTPETAKLAK
FT                   GADGVVVYQQLDYTPETLQALADAGVTKMSLRNVGVDNIDMDKAKELGFEITNVPVYSP
FT                   DAIAEHAAIQAARVLRQDKRMDEKMAKRDLRWAPTIGREVRDQVVGVVGTGHIGQVFMR
FT                   IMEGFGAKVIAYDIFKNPELEKKGYYVDSLDDLYKQADVISLHVPDVPANVHMINDESI
FT                   AKMKDGVVIVNCSRGPLVDTDAVIRGLDSGKIFGFVMDTYEDEVGVFNEDWEGKEFPDK
FT                   RLADLIDRPNVLVTPHTAFYTTHAVRNMVVKAFDNNLKLINGEKPDSPVALDKNKF"
FT   CDS             52381..52632
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00052"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00052"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49499"
FT                   /db_xref="GOA:D5H0G4"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G4"
FT                   /protein_id="CBL49499.1"
FT                   /translation="MHFKEESQQHFSLRKLTIGVASVIIGTTFMFFGGHAVHADDLSRD
FT                   AEQTSSVVQKQSSEKIDVDAVKEADNVSNQRQDLPRRY"
FT   CDS             52592..53131
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00053"
FT                   /product="putative protein without homology, LPXTG-motif
FT                   cell wall anchor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00053"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49500"
FT                   /db_xref="GOA:D5H0G5"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G5"
FT                   /protein_id="CBL49500.1"
FT                   /translation="MFQIKDKTYPDGTKSTATGPVTVIAPNVPDVIYVPKGDKVPDPST
FT                   VVTNSNDIKDKIPDTTYTWKTTPDTPNTKVVINYKANNPGTPDTPVTPPVDPGDNPATP
FT                   VTPPVKPEQKPTTPTPHATKTPAKDNGGKKTVASEQKSTLPQTGKKDNVALTTIGVAIA
FT                   AAGSLLGLADSKKHRS"
FT   CDS             53686..54513
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="LCRIS_00054"
FT                   /product="Exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00054"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49501"
FT                   /db_xref="GOA:D5H0G6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G6"
FT                   /protein_id="CBL49501.1"
FT                   /translation="MILISWNIDSLNAALTGTSARAEETRQVLTKIHDANPDIIAIQET
FT                   KLRATGPTKKHKEVLAEKFPEYDYVWRSSEEPARKGYAGTMYLYKKGLTPAVSEPIIGA
FT                   PEPMDHEGRIITLEFDKYFVTQVYTPNSGSGLKRLAERQVWDQKYIEYLQKLDEKKPVL
FT                   ASGDYNCAHTEIDLKHPENNHHSAGFTDEERVDFTNLLNAGFTDTFRKVHGEITDVYSW
FT                   WAQRVRTAKANNSGWRIDYWLVSNRIADKVVRSEMIDTGKRADHCPILLEINL"
FT   CDS             54587..56029
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00055"
FT                   /product="Glutamate/gamma-aminobutyrate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00055"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49502"
FT                   /db_xref="GOA:D5H0G7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G7"
FT                   /protein_id="CBL49502.1"
FT                   /translation="MNNEKKEDWALEQDLKYNRLTAFKLFAMTSSMVISVDELAPFGKT
FT                   GATALFYLLIAGIAWFIPITQMAGEMASIDGWEKGGIFTWVKGSLGDKTGWTAMFYQWI
FT                   HITVGMDTMMYVIIGALSITFGTPWFNTTPIVRFILMMVILWGATAIQVIGVRKIGRIA
FT                   EWLFILGIATPVILLIISFFVYVIQGHPLHMTINWNTVIPHKLNGNTLVAFVPFMLAFC
FT                   GGEASAPHVKNLDHIKSYSKVMLGLAVTAICFDLLGSMAIGMTVPKDQIENSTGFVYTY
FT                   GKLLTSIGLPGDLLQKIVGIMLACGIIGELGNWIAGPNQGMYEAAKEGYMPKFFAKTTK
FT                   HGVPLRIMVLQSSIVTISALLITFTSGADADFAFNVSLAATTAQYLMVYMIMLIAYMVL
FT                   KRKHEDYHRMYYMSKNPNLSIAIAVLALIITVIAFFVTFVPAQGTPSNLRHVYVWTLIG
FT                   MCAIVSILPLILYRWHEKWQSQ"
FT   CDS             56095..58923
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00056"
FT                   /product="DNA/RNA helicase, DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00056"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49503"
FT                   /db_xref="GOA:D5H0G8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G8"
FT                   /protein_id="CBL49503.1"
FT                   /translation="MADAMRDAILNGFVDQNYLGSEELGPKILANNQQERIWQTLRQEL
FT                   YSCKSFTWAVAFITQDMLVPFKVIMADLAKNGISGTIITGDYLGFNNPRVFTELQKIPN
FT                   LEVRIANKAGFHTKGYLFDHENYQTVIIGSANFTRSALLANYEWALKVSSKKQADLTAQ
FT                   LVDKIADLKQDSFVLNSAWLTDYRKNWVKPERVATDRHQTKILPNKMQKAALKQIEALV
FT                   ASGEKRGLVVSATGTGKTYLGAFAVKKYQPRRFLYIVHREQIAKKSLESFYRVIGGPRS
FT                   DYGLLTGNRHNLQAKYLFATVQTISQPEMLANFNSDEFDYVLIDEAHRAAAPSYQRLLH
FT                   YFKPNFWLGMTATPERMDEQNVYQIFDYNLAYEIRLRDALEEKMLAPFHYVGVQDYEAD
FT                   GVAIDETTDLRYLASTSRVDYVLKELDYYGYCGTKAKGLVFCSRQDEARELARLFSQKG
FT                   HPAVALTNEDNEKRRNEVVASLVKGGIEYIVAVDLFNEGIDIPALNQIVMLRNTQSSIV
FT                   FIQQLGRGLRKYPGKDFTVVLDFIGNYKNNYIIPLALNQDTSRSKDQAKRETRLPSFID
FT                   VSTINFSKIASEKILASLDSVKLDGMRELRQSYHDLKNKLGRVPLLFDFYQYGSVAPIV
FT                   FAQNHGLASYADFLGKMGEDVNLSKYENEVLSFVTKELLNGKRIHELLLLEMLLEQDIV
FT                   KQEDYLAQLKRHHAYVNDELLASVDAILSLDFFDIKQGKTTKKAQYGKLPLVERSNLFD
FT                   YQLNGSLRSALDQHDFKNLFVDAIKTGLALNQEYDNQRQFTLYQQYDRKDACRLLNWPK
FT                   DVSAPMYGYRVGEQDTPIFITYHKDDHEKRNALYRNTLADGRSLRWYTRVPRHLDSDEV
FT                   QRLLNTRGMNLHIFVKRSDADGKQFFYLGKAKIQADSVREELLGVKKKPAVGMNLMLKH
FT                   PLSESMHELLFE"
FT   CDS             complement(58958..60010)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00057"
FT                   /product="Penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00057"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49504"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0G9"
FT                   /protein_id="CBL49504.1"
FT                   /translation="MRNFVRNTLAQNNTRGSIVIIKNGQPQQISYGYAWYGKKVGNGND
FT                   NVVYPTASLQKVVTAAMIIQLMNENWHTSQKFTQNTKISRWYPNLKNADNITIGQLMTH
FT                   TSGIQATNTELDRGKVLSENDAINWAIDNTNNGTQGTPGTYFYNNTNYLLLAGIIIKIS
FT                   GQSYENNFNNRIINKLGLANTFLYQDIPSWKTDPISYVWNNGKNYQDAEYVKKTLASQL
FT                   PGAGNMFTTPMDYYKIQLGLTNGSILSKSDFYYLTHLKSATTNYSGGLHLDDDHTKSAY
FT                   GSLSNTHFGNWIKMTTDNRYGIIMFLNQVSGDETAQKNIGTKILDHIKPRMFDKDNNQD
FT                   DQDLINISGN"
FT   CDS             complement(60241..61431)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00058"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49505"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H0"
FT                   /protein_id="CBL49505.1"
FT                   /translation="MNNQASFKLSPYHQLNQEQSLLVQKILHFSITHCSNKNHPAVFTI
FT                   YGEAGTGKSVVLSALFDQLQKLNHQTGSQLYKTQNYFLVNHPELLKVYKQIAGPIKELY
FT                   KKNYMRPTSFINQMDKKQTSADVVVIDEAHLLLSQPDHYNNFYHDNQLEEVIKRSKVVI
FT                   LVFDENQVLRMKSFWTRKRLEAITHHYPHEDYQLHHQFRMMAPDSLIEWFNFFTHNKLM
FT                   PLKKEMWHNYDFRIFTDAEKMRQEIVKRNQTDGLARILSTSGYPSTLDGGKHYIKEGKF
FT                   MLPWDQYNYTSTPWAEIPTTINEVGSIYTCQGFDLNYAGIIIGPPISLIPGTNQLKVNL
FT                   DKITDVEMFKKRNDLTNSKEKIEYEEKMVMNSLNVLFKRGIRGTYLYLMIPHSEQN"
FT   CDS             61493..61906
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="LCRIS_00059"
FT                   /product="Peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00059"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49506"
FT                   /db_xref="GOA:D5H0H1"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H1"
FT                   /protein_id="CBL49506.1"
FT                   /translation="MTAQKIIHDQLFLRQKSDLAGKNDLQVAINLRDTLLANRGKAAGL
FT                   AANMIGQTKQIIAFYAGPLPFVMLNPRIIQKKQMYLASEGCLSLEGERNVQRYEEITVT
FT                   YQNMELETVTQTFGDFIAETIQHEIDHCNGILI"
FT   CDS             complement(62484..62576)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00060"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49507"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H2"
FT                   /protein_id="CBL49507.1"
FT                   /translation="MHVLGTPPAFVLSQDQTLILKSLNDCSFLI"
FT   rRNA            62524..64075
FT                   /gene="16s rRNA"
FT                   /locus_tag="LCRIS_02033"
FT                   /product="16S ribosomal RNA"
FT   CDS             complement(62786..63220)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00061"
FT                   /product="PG1 protein, homology to Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00061"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49508"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H3"
FT                   /protein_id="CBL49508.1"
FT                   /translation="MEFHSPLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQR
FT                   LPPTYYRGCWHVVSRDFLVDYRQIKASYYLYPSSPTTELYDPKTFFTHAALLHQTCVHC
FT                   GRFPTAASRRSLGRVSVPMWPISLSTRLCIIALVSLYLTN"
FT   CDS             63654..64007
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00062"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49509"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZ89"
FT                   /protein_id="CBL49509.1"
FT                   /translation="MLLVASIKLGTLMRLPVTNRRKVGMTSSHHAPYDLGYTRATMGST
FT                   TRSEPAKASESLKAVLSSDCSLQLDCTKLESLVIADQHAAVNTFPGLVHTARHTMGVCN
FT                   AQSRWPNLREGAV"
FT   tRNA            64212..64286
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="LCRIS_02038"
FT                   /product="transfer RNA-Ile"
FT   tRNA            64343..64415
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="LCRIS_02039"
FT                   /product="transfer RNA-Ala"
FT   rRNA            64538..67443
FT                   /gene="23s rRNA"
FT                   /locus_tag="LCRIS_02029"
FT                   /product="23S ribosomal RNA"
FT   CDS             complement(65092..65562)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00063"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00063"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49510"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZ88"
FT                   /protein_id="CBL49510.1"
FT                   /translation="MIWAVSLSTTDLITRSLTPVYGYLEFVVYLDSVTPDGPLVQTELY
FT                   LHYPLHEASPKAISERTSYLQVRLEFHRYPQLIPAIFNLRGFGPPVRFTTPSAWSWVGH
FT                   LVSGLRHLTFRPIKTRFRSGSVFSDLTSLDNVTRRFILQKARHCTLMCFDYL"
FT   CDS             complement(66983..67300)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00064"
FT                   /product="Cell wall-associated hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00064"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49511"
FT                   /protein_id="CBL49511.1"
FT                   /translation="MLSALIPSAHSYPAMLLAEQLVHQRCVHPGPLVLRTAPLKFPTPT
FT                   TDRDRTVSRRSEPSSRAALMGEQPNPWDRLQPQDATSRHRGAKPPRRCELLGEISLLSP
FT                   G"
FT   rRNA            67516..67631
FT                   /gene="5s rRNA"
FT                   /locus_tag="LCRIS_02025"
FT                   /product="5S ribosomal RNA"
FT   tRNA            67644..67719
FT                   /gene="tRNA-Asn"
FT                   /locus_tag="LCRIS_02040"
FT                   /product="transfer RNA-Asn"
FT   CDS             68238..68672
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00065"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00065"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49512"
FT                   /db_xref="GOA:D5H0H7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H7"
FT                   /protein_id="CBL49512.1"
FT                   /translation="MDKNSDRLTLVPYFPNEKQTLKWYQDPKICKQVDNIDTVYDLTKL
FT                   RRMYEYLSVHGWCYYIQYQGKLIGDCTLLKDGEISIVICKEYQNLHLGRKCVDKLVQLA
FT                   RIQKMTQVKAHIYDFNIQSKKMFTRMGFKEQQPDWYSYDL"
FT   CDS             complement(68891..69112)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00066"
FT                   /product="Steroid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00066"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49513"
FT                   /db_xref="GOA:D5H0H8"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H8"
FT                   /protein_id="CBL49513.1"
FT                   /translation="MRKFTKETLSNYNGKNGRPAYIAFNGTVYDVTNNTHWLNGENNGI
FT                   HAGCDVSLDLAQSPVLELAHINQVGIYN"
FT   CDS             complement(69205..70074)
FT                   /transl_table=11
FT                   /gene="arbZ"
FT                   /locus_tag="LCRIS_00067"
FT                   /product="Phospho-beta-glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00067"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49514"
FT                   /db_xref="GOA:D5H0H9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H9"
FT                   /protein_id="CBL49514.1"
FT                   /translation="MIFGDNREAVIKNIKKAANERNFTAKVEIGDPQMSLDQRLKLVND
FT                   YWNKRNTFSSKLNNRIGHLLFGTLSRALAGSTEFVGLENLNNLPIGGAILTSNHYNQVD
FT                   SLPMKLLANKMHHQLSIVIEDTNLMLPGFFRYLMNYVGTIPLVQSPSYIGNEFPKHLSA
FT                   ALAKNNWVLIYPEQEMWWNYRKPRKLQRGAYYFAAKQNVPVISTFVEIKDLPKIEKKDP
FT                   NFYETKYIVHVLPPIFPDVSLNANENAHKMMELDYRQKVAAYEKIYGKKLNYDFLDWDI
FT                   AGWRGHLS"
FT   CDS             complement(70071..71018)
FT                   /transl_table=11
FT                   /gene="arbY"
FT                   /locus_tag="LCRIS_00068"
FT                   /product="Lipopolysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00068"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49515"
FT                   /db_xref="GOA:D5H0I0"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I0"
FT                   /protein_id="CBL49515.1"
FT                   /translation="MTIPIFYSISDDFTKYAAVSLNSLVKHTDPNKDYTVYFLNQDLSS
FT                   KHQKALSDLSSSNVHVKFFHIDDQLVQPIQNRKENFLRADFFTMSIFYRLFIPELFPEY
FT                   DKVIYIDSDTIVNDDLAKLYNSELGDNLFAACTDSSIQYVDKMIKYIKNVLALDPKKYI
FT                   NSGMLVMNARAFRAEHFIDHFMTLLEKYHFDCIAPDQDYLNEIGEGRILHLNPRWDAMP
FT                   NENTEPLTNPGLIHYNLFFKPWHFANVQYAQYFWDSAKQTQFFDELKNELNNYTDDERA
FT                   ADREKLDHMLAKEDKTEQDPNNWAKVKKREAVTL"
FT   CDS             complement(71032..71985)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00069"
FT                   /product="Lipopolysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00069"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49516"
FT                   /db_xref="GOA:D5H0I1"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I1"
FT                   /protein_id="CBL49516.1"
FT                   /translation="MKTIPVFYTISDNYTPYAYVSIKSLIDHTDPKKDYTITLLVQQIS
FT                   DEHKKSLEDLSTDNIHVQIFHIDDDMVKPIHNTKENYLRAQFFTMSIFYRLFIPELFPQ
FT                   YDKAVYLDADTIICTDIAKMYEIDIADNMFASCPDLSIRYMPLLQKYIKECQGIFPAEK
FT                   YINNGVILFNMKAFRDKKFVDKFYYLMNKYHFDNVDPDQAYMNEICEDEIYHLPKEWDA
FT                   MPNESIPEIQDPKIVHYNLFFKPWHFADVQYGHYFWDVAKTTPYYDELKQQLDNFTDED
FT                   RQKARADLEWMAKKVDMIVKEPNTWAKVKQTESVKI"
FT   CDS             complement(72003..72839)
FT                   /transl_table=11
FT                   /gene="arbx"
FT                   /locus_tag="LCRIS_00070"
FT                   /product="Lipopolysaccharide biosynthesis
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49517"
FT                   /db_xref="GOA:D5H0I2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I2"
FT                   /protein_id="CBL49517.1"
FT                   /translation="MNILFCGDENAQDGVLISTLSLIRNSGAQELHLYILTMEAHSDER
FT                   KYHPFSQHAADFLRSLVKKANPNSTVELIDCTKLFEQESPTANMNTRFTPYAMLRLFAD
FT                   QLPQIPDRILYLDDDIVIRGDITTFYNEDINGIELVGVLDYWGRFFFHNLKTKRAFDYL
FT                   NSGVLLLNMKKIKQTGLFAEVRHMMQVKQMFLPDQSAINKLAVAKRVAPRRYNEQYHLQ
FT                   KNTKIQHFTTSFRFWPYFHTQTVKPWDVDRVHSVLHLHEYDDLLNEYLKLRNNLKK"
FT   CDS             complement(72856..73617)
FT                   /transl_table=11
FT                   /gene="arbV"
FT                   /locus_tag="LCRIS_00071"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00071"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49518"
FT                   /db_xref="GOA:D5H0I3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I3"
FT                   /protein_id="CBL49518.1"
FT                   /translation="MKRIYYYQKTTDDVVDSHDQNFSLPDNYVILPNSLGARIWSTTAR
FT                   HLACAFGWVVFRFFDHVKVVGQEKLKQVNGGYFIYGNHTRPMGDVFTSLTIFPIKNFYA
FT                   IANQANWGIPFIGKYLVRYGGLPVGKNMKQSLKLIKAIQTVIKDKKGEILIYPEAHVWP
FT                   YYTKIRPFDATSMHFPVKLNAPSFVMTKTYHKKWLSKRPSAVIYIDGPFYPDTNLSRKE
FT                   AQNKLHDEIWQVMKQRAKNSDYEYCQYIQKK"
FT   tRNA            complement(73797..73869)
FT                   /gene="tRNA-Lys"
FT                   /locus_tag="LCRIS_02100"
FT                   /product="transfer RNA-Lys"
FT   CDS             complement(74002..74223)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00072"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00072"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49519"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I4"
FT                   /protein_id="CBL49519.1"
FT                   /translation="MNEAVFFNPGDAIASSHDFKEARRSAQIIKAERPTGRQIVIAKND
FT                   QSGVYAVYYADHMKQDQQGTAYHIQDKL"
FT   tRNA            complement(74342..74414)
FT                   /gene="tRNA-Lys"
FT                   /locus_tag="LCRIS_02099"
FT                   /product="transfer RNA-Lys"
FT   CDS             74551..75267
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /locus_tag="LCRIS_00073"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00073"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49520"
FT                   /db_xref="GOA:D5H0I5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I5"
FT                   /protein_id="CBL49520.1"
FT                   /translation="MPKKILVVDDEKPISDIIKFNLTKEGFDVDTAYDGEEAVKKVDEY
FT                   DPDLMILDLMLPKKDGLEVAREVRQTHDMPIIMVTAKDTEIDKVLGLEMGADDYVTKPF
FT                   SNRELVARVKANLRRRDIVKKAEAASQEETDKNIKIGNLVIMPDAYIVEKNGKKIELTH
FT                   REFELLYYLAQHMGQVMTREHLLQTVWGYDYFGDVRTVDVTVHRLREKIEDNPIQPQIL
FT                   VTRRGVGYYVKQPSEE"
FT   CDS             75338..77191
FT                   /transl_table=11
FT                   /gene="vicK"
FT                   /locus_tag="LCRIS_00074"
FT                   /product="Sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00074"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49521"
FT                   /db_xref="GOA:D5H0I6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I6"
FT                   /protein_id="CBL49521.1"
FT                   /translation="MKKFKARLNSTFNSINTKIAIVFMLMLLATIEVIGAYFTRQLEQN
FT                   SIENFQSSIQIQTIVSNQLANQLTSDNKNTNDRLNQIVNDYNNDAISEIIVVDNKDTIR
FT                   AVSNLNDKSKIGQRINNTDVKQVISTGHQINKVVDDHGNYMIQISPLTSGNGSNNTVGA
FT                   VYVKASMQDVFNNLRQISLTFLIASLIAALLGAFLSLVISRAITQPIEEMQKQALHIAD
FT                   GDYSSQVKIYSNDELGQLAKAFNTLSVRIERSQEESDSERRRLDSVLSHMSDGVLATDR
FT                   HGNVSVVNHMALNFLNKKEDEVINKPIAEVLGLEDTSSQDLISSQKEIVITLDPGTRDE
FT                   IILHASFSLIKRVTGFVSGSVCVLHDVTEQQKNEDSQRQFVSNVSHELRTPLTSLQAYI
FT                   EALNEGAWKNPEIAPKFLEVTQQETSRMIRMINDLLSLSRMDRGVSKMDLEFVNLNDFV
FT                   NHILNRFDMIVKTDKNKEKKKYTIKRELGSQALWVEIDTDKMMQVIDNIMNNAIKYSPD
FT                   GGVITVRMTQNQNHVILSISDQGLGIPRKDLGKIFDRFYRVDKARSRAQGGTGLGLAIA
FT                   KEIVEAHHGKIWADSSEGKGSTFYISLPYEPMTEEDDWDEV"
FT   CDS             77172..78533
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00075"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00075"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49522"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I7"
FT                   /protein_id="CBL49522.1"
FT                   /translation="MIGMKFKFKFGEFFLGLATLIVIVFSIVLWIFIMTSDQRFSNIGQ
FT                   QNQNNITKEQTRSHNFKSLYDLYIPTTSYGFANGNLCQLYDSKNNLTLEFTKEIKKAKA
FT                   TNKIKKIVDTRTKYEEYLNNPNYVQLVYPDEITFSLFNQLNNAANDNREFNRFFISQSN
FT                   HWIYLGNDHTNEIYQVKIAGANFDKLRKYARNAKSKYPVRLVRLKEGYSPFYIKTMNAK
FT                   VYSYLTNHQSYSYFVSRLLGTSGVTSKTNKNGQTVYSLNYYTRLRVPDSNSGEHNYLYT
FT                   HYEKNKIPNTTNRLLDSVYYVHQLGLTEQDLRFFDADGANVSYLNYIEGIPVFLNKHDL
FT                   QVKTTFSTDSINVAFNSVNFQIPIPFDGQTKRLKPTQDVVDELVNHGLKQEDIQRIIVG
FT                   FAEEKDSSHHSLINLIPTYYIKAYDEWKSLGEWEKQDVSTYREADQLTVNEGGK"
FT   CDS             78536..79360
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00076"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49523"
FT                   /db_xref="GOA:D5H0I8"
FT                   /db_xref="InterPro:IPR018604"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I8"
FT                   /protein_id="CBL49523.1"
FT                   /translation="MDHKRIEWLFFVVFFLIDIYLGIEILRSPVNLSNADTTTRSVASI
FT                   RNEMKSDNIDLPDKISDAPDSGYYLATKNRDYLSGKVSSLTNVNARYSKSDNVLYGEPR
FT                   QAVLLSKKPKEALEQIEDFKNDSKNIPYGKEFKYEPDMSSEDNYVFVQNSDYGEIYANS
FT                   AQLNINVKDNQIINFTETYMGQASPVRELQSTISAWRAVRAMYTDRELTNNSRVTQVKL
FT                   GYSKLTEVRGSTILLPTWLVWVENKTTKNITMKRINAYTAQMLQSSTYNVEK"
FT   CDS             79373..80170
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00077"
FT                   /product="Metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00077"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49524"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0I9"
FT                   /protein_id="CBL49524.1"
FT                   /translation="MKVSVLASGSTGNTSLIVTGQHKILMDAGLSGKKTKDLLAEVGVD
FT                   IDEIDMAFLSHDHTDHSGGLGVLMRRYPKIDAFANSGTWQYLLDTQKIGKLPAEQINTI
FT                   EPGQTKTFGDVDITAFATSHDAAEPQYYVFTSGGKRVAFLTDTGYVSEEVEGTIEDADA
FT                   YMMEFNYDNMMLRDGPYSWSLKQRILSDVGHLSNDEAAQALVDVVTPKTKHIFLAHRSQ
FT                   HNNTEYLAHETAKEMLLEGDANLDDDVKIIDTEPNQPTKLVEI"
FT   CDS             80232..81512
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="LCRIS_00078"
FT                   /product="Serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00078"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49525"
FT                   /db_xref="GOA:D5H0J0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J0"
FT                   /protein_id="CBL49525.1"
FT                   /translation="MRGEASMVENQNNNNNLQQPRKKNTNGKIIATAAIVGVVGGLIGG
FT                   GVSYYAADQMNNASVNNGAAQTSVSSSSSKVSEKSAKTSGTMTTAYNDVKGAVVSVINL
FT                   KRQSSSNSTNSLYNSLFGNDDSDDSSSSSSKGKLETYSEGSGVVYMKSNGKGYIVTNNH
FT                   VISGSDAVQVMLANGKTVNAKVVGKDSTTDLAVLSIDAKYVTKTAEFGDSKSLQAGQTV
FT                   IAVGSPLGSEYASTVTQGIISAPARTISTSSGNQQTVIQTDAAINPGNSGGALVNSAGQ
FT                   VIGINSMKLAQSSDGTSVEGMGFAIPSNEVVTIVNELVKKGKITRPQLGVRVIALQGIP
FT                   EGYRSRLKINSTLKSGIYIASVNKNSSAANAGMKSGDVITKVDGKKIDDVASLHSILYS
FT                   HKVGDTVNVTVNRNGKDVNLKVKLEGN"
FT   CDS             82030..82509
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="LCRIS_00079"
FT                   /product="Alpha/beta knot family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00079"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49526"
FT                   /db_xref="GOA:D5H0J1"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR016051"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J1"
FT                   /protein_id="CBL49526.1"
FT                   /translation="MNIKIVCVGKLKEKYFRDAIAEYEKRLSRFAKVSIVQVPDEKAPE
FT                   KFSAAEDEKVKEIEGQRILSKIKDKEYVYVTAIKGKQRSSEEFAKEIQDLATYGHSDIT
FT                   FVIGGSLGTSDAVNKRGNDLISFGKLTMPHQLMRVVLIEQIYRAFMINSGSPYHK"
FT   CDS             83009..83554
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00080"
FT                   /product="Peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49527"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J2"
FT                   /protein_id="CBL49527.1"
FT                   /translation="MGEKYYAYRAVTVNQSPITVNGAKFYKLADRDAYIKVTNISGQGR
FT                   VLKRNAYIYSTSKKRTTHNGAWKLYKGFIGSPYKKYPLGYWVAPNGVKPVVKHYLGRAQ
FT                   NMTNCGLPAIKDKLINSHLVVVWVGMFDGLSDHAITLTGYHGKTIYYNDPWTGTKRKIK
FT                   QEIFATHWALDAHRALSY"
FT   CDS             complement(83578..84459)
FT                   /transl_table=11
FT                   /gene="pepI"
FT                   /locus_tag="LCRIS_00081"
FT                   /product="Proline iminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49528"
FT                   /db_xref="GOA:D5H0J3"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005945"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:D5H0J3"
FT                   /protein_id="CBL49528.1"
FT                   /translation="MEVIEGKMPFMGYETYYRIVGRRSEKTPLVLLHGGPGSSHNYFEV
FT                   LDKLAEIDNRRIIMYDQLGCGKSSIPDDHPELYTKETWVKELMALREHLALRKIHLLGQ
FT                   SWGGMLALIYMCDYHPVGIQSLILSSTLSSASLWSKELHRMIKYLPIEEQAAIHRAELT
FT                   SNFNDPDYLKANEHFMNQHAIDMTKTWPECVMRKKCGGIVAYETAWGPNEYTPEGNLHD
FT                   YEYTEKLGKIKIPTLITSGTDDLCTPYVAKTMQDHLAGSKWQLFENCGHMSFVEKTDEY
FT                   VEMLRKWLDQHD"
FT   CDS             complement(84468..85121)
FT                   /transl_table=11
FT                   /gene="cbiQ1"
FT                   /locus_tag="LCRIS_00082"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00082"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49529"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J4"
FT                   /protein_id="CBL49529.1"
FT                   /translation="MNPSLKFILAFIISLEISLKASLVTNLLVITFALVYLIITRIKIK
FT                   ELILLIILPFIAAFTIFATLFWFSPTPNAYYAWNLSTRIYVYTLTIACVTRNNTATDFA
FT                   RSLEQNLHLPSKFAYGVLAAINIIPQMKMAVKQIRTSAMMRGIYLSFWSPVLYFKAILV
FT                   ALNSADNLAQGMESHGYVEGQRRSTIIAIPLTAIDWVIFFTLLILVNISLFLFK"
FT   CDS             complement(85126..86478)
FT                   /transl_table=11
FT                   /gene="cbiO1"
FT                   /locus_tag="LCRIS_00083"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00083"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49530"
FT                   /db_xref="GOA:D5H0J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J5"
FT                   /protein_id="CBL49530.1"
FT                   /translation="MKVTVNNLTFSYEKEPIINHLNIEIPHGFSLLIGPTGCGKSTLLK
FT                   IIAGLYPKYAGRLTGMVDLHGQKAAMMFQNAAEQFTMPTPREEIVFALENLQLDEGEYQ
FT                   TRLDQATAFTQIADLLDQKINTLSGGQQQRVALAVLIAMDVDLLLLDEPFASCDPKTRA
FT                   FLIKKLAILAHNGKTIILSDHVLDDYEPVCDHLFEFTNNQEVIELNASKKIALFEQNKK
FT                   LHERHYHFVLPNSEPIFTLKQVQIRQNKLLLKQNELNLHSGTTLITGANGVGKTSLFKV
FT                   MTKMIPYTGNFAYLNKEIAQISARKYLTQVAQIFQKASDQFLAVTVKDELELSKKGRNL
FT                   FFTEKKLNEWLEKLGLADHLDQVVYSLSGGQQKKLQILLMLMTKHQVLLIDEPLSGLDH
FT                   NSVKLVLELMRESQQKLHQTFFIISHQIDELAEFCDYRLILADQRLKYVER"
FT   CDS             86635..87576
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00084"
FT                   /product="Regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00084"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49531"
FT                   /db_xref="GOA:D5H0J6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J6"
FT                   /protein_id="CBL49531.1"
FT                   /translation="MAAVALDQYLASVLKSNSTDKNEIKLEAGNPDFDLFTIYLENHNT
FT                   GIHRYRMDVSTILYIAKGTVTIKSGEKIIQMKSGNVLLLTEGCKYEILSQKPDTVLIKL
FT                   KFKRGFLYRKYFKDFSCKGEREVKVIEQIVDSLENEHVLWLKNNQITRASQVMQHIIGG
FT                   YLNNDLFTKALIQAELTTMLIISIRTQRMATPTSLDKTKFEKKTLDNYIDLHFADVSLS
FT                   DAAKYFGFNPNYFSNMVKAKTGKSFVDHVDDRRMQEARELLAQPDISLREIIGRVGYSS
FT                   KSFFYKKFNQYYHITPAAMRAELFRQANINLK"
FT   CDS             complement(87612..88508)
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="LCRIS_00085"
FT                   /product="Probable protease htpX homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00085"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49532"
FT                   /db_xref="GOA:D5H0J7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J7"
FT                   /protein_id="CBL49532.1"
FT                   /translation="MLYQQIARNKRKTALIMFIFLVILGLVGAGIGYLWSNSPTMGVII
FT                   ALIGSLVYLFIMWQNPANMIMSLNHAQEIHEADNPELWHIVEDMAMVAQVPMPRVYIIP
FT                   DPSPNAFATGRDPEHSAVAVTQGILELLDREELEGVLGHELSHVKNYDILLSTIAVVLV
FT                   GVISFISNMASNIWFWGGVRSDDDDDRDSNALAMIFKVVALVFVLILGPLSASLAQMAL
FT                   SRNREYLADASSVKLTRNPQGLISALRKIENSQPMKVADSSSAGLYIENPFHNHGLTHL
FT                   FDTHPPTADRIKRLENM"
FT   CDS             complement(88527..89087)
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="LCRIS_00086"
FT                   /product="LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00086"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49533"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J8"
FT                   /protein_id="CBL49533.1"
FT                   /translation="MSPLIWIIIAIIVLIVAIYIVTYNGLQRAKVYAEEAWSQIDVQLK
FT                   RRNDLIPNLVETTKGYAKHEKSTFEEVANLRNQLVNVPQGNHEEAMKLSNQITDSLKSI
FT                   FALAEAYPDLKANQNFLKLQEELTNTENKIAYSRQLYNSTVATYDQKLLTFPSNIVAKW
FT                   HHFTKINYLETPSEEKNVPQVKF"
FT   CDS             complement(89184..90290)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00087"
FT                   /product="Cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00087"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49534"
FT                   /db_xref="GOA:D5H0J9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0J9"
FT                   /protein_id="CBL49534.1"
FT                   /translation="MTVLKNIAKDRILQITVIITVVSLFFARPRFSDINFHTLWSVAAM
FT                   LTIIQIYAYLHVLDVLAYKLTSIADNTRKLNTLFSLLAVISGMFLGNDITALTLIPLYL
FT                   NIAKRYKLPQILPVTLIGMGANIGAAFTPWGNPHNIFLVSRFNVGPLKFFEWSVPYLVV
FT                   SMLIMGLVFLFIPKEEIPVQKTEPIKISWRPTLITTAVFIFFFFGVFRTIDIIWPMLTS
FT                   VALALAINPRIMLKIDYALLLTFTGFFIFISDIQQIPVIVNLIHGTVYSEISTYFASII
FT                   SSQVMSNVPSTILVGKFTTYAQALFLGSNIGGFGSAIGSMANMLVLKTFNQHGSVSKKK
FT                   FFIQWTIMQFAGLIILTAVGLLLLIFRI"
FT   CDS             90490..90894
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00088"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00088"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49535"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K0"
FT                   /protein_id="CBL49535.1"
FT                   /translation="MTENAISINIKPDAAEIIKSKMDADHQIVILALDDGSTKYSKKGG
FT                   TCTIGDSFQFVILAEKDPKYNISIENNAGLDLYTAQPETTFFEPGLVVNARNSTLSLSS
FT                   DSGIIDGGMTVTQYEPEAITADDLKNGGQC"
FT   CDS             90988..92766
FT                   /transl_table=11
FT                   /gene="glpQ1"
FT                   /locus_tag="LCRIS_00089"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00089"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49536"
FT                   /db_xref="GOA:D5H0K1"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K1"
FT                   /protein_id="CBL49536.1"
FT                   /translation="MTFVKEIKAGSREFCQNWLRYLLLFMGLSLFNQFIVIPLFRYITT
FT                   FVLQASAIPFVSYQNVVTIITTHTVAFLILIIELLLLLVILYAQLAYLLHGVWDIKHQV
FT                   FTWKNSFIQTWQNIKKIRLGTLFILMLYFLLVVPLADVIFRTPLLSKVQISEFILDYLT
FT                   RTPILLAVLIAFYLAALILGARLVFALPIIVFDHLKSAQAVKRSWRLTAHYRWRTICWR
FT                   IIVLAVLSAAVMTIFYLAMYCLQLLVDLLPGKCPLIVAIINLSLVQIISEVALVYVSVL
FT                   GLSIILKALRQEKISQTGKTKKIILSTLVVFVLVMINAISTNYLYLTSVNAKAPVIISH
FT                   RGVDDKNGVQNTLQSLRKTAKEKPDYVEIDVHETKDKKFIVIHDENLLKLTGVNKAPND
FT                   LTLRQLEKLTAKEDGYHAKLVSFDQYLEEAKRLHQKLLIEIKTTAKDSKKMLQRFNQKY
FT                   GKTILKNAYQVQSLDYRVVEGLHLINPRLVVFYIQPYNFTYPQSVASGYSMEYSTLNSD
FT                   FIWQAHLQDRPVYAWTVNDEKLMKKMMYQQVDGLITDRVDLAKKAIKSFQKDASYATRI
FT                   LNYIVVLHLSKNFESA"
FT   CDS             93133..93999
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00090"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49537"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K2"
FT                   /protein_id="CBL49537.1"
FT                   /translation="MNKSNRHNILIYFDFIAALLFPVIAVFRVREYSVNIINGLFLILI
FT                   LAIVTGLLLPNVLVSWLIILLTTLAVGFLVMGYVVIPTEAKWLLLIAFPLEASFLAVFR
FT                   HYMLSWHFISKNRQGIRNYLERYNGDLKMQTRYTANKIYSKVICNIKERPKLHLWMHVS
FT                   MLRWANHEQFAQLHPEEHAQFLEKLADVLKKRRLAAEELFYLGDAKFLIISPELRDDII
FT                   KQINQETIANLKKVQDELPGGLKWTSQRIDETNAERFSNLDVIEKHLDRELETDLIVEY
FT                   LKDETSD"
FT   CDS             93983..94138
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00091"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00091"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49538"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K3"
FT                   /protein_id="CBL49538.1"
FT                   /translation="MRQVTNWFYFLALGISCFFFMAFVVAFICAFIIYFNVENTIIGIR
FT                   KKKKNG"
FT   CDS             94185..95438
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00092"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00092"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49539"
FT                   /db_xref="GOA:D5H0K4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K4"
FT                   /protein_id="CBL49539.1"
FT                   /translation="MSLTTFVGAIYFWLRHSKVLVKITPLKRYPKVTLVVPAHNEELVI
FT                   SKTTQAILNLNYPADRLEVFIYADNCSDGTAKVAQKIISQYPERRANIQVIERTGTGGK
FT                   AGVLNDALKIAHGEYLGVYDADAMPEENALYFLVKKILENPEKYKAAFGRNKTRNARQN
FT                   FLTKCINQEIVVTQRIQHCGIWQLFKIGRIPGTNFIINTDYVRSIGGWRNGALTEDTDI
FT                   SFKIMGSGSLIALAYNSEAFQQEPERLKDYYFQRLRWAKGNYEVVINNFHHLFDKSNWR
FT                   VKLETIYYSCTFFWFNLAIVLSDIIFIANLSALIIHIWDPTVELPFTISRSNILLAQIL
FT                   LFNWLLMILLYILQINVAMNTQYGQSTNEQLWLSLASYFTYSQLFIVVSVHAVNSVMMD
FT                   RIFHRDSTKWVKTKRFAD"
FT   CDS             95456..96559
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00093"
FT                   /product="Endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00093"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49540"
FT                   /db_xref="GOA:D5H0K5"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K5"
FT                   /protein_id="CBL49540.1"
FT                   /translation="MKKKWITFCFILVIVTFTGIMLYIRADNNLAVRNSFSNSWRKHYV
FT                   VEEKSIAYVNTSPEKEQVTVLSEGQGYGMFIAAVDPTVKKTDFAKLYQYYLDHRDRGTQ
FT                   LMAWRQTMKKGKWTSERNSATDGDLFIAQALFLAAERWENNQYQVQGQKLISDILRYEY
FT                   NPTTQALTVGNWADSKSKYYNLLRTSDVLPTMFDKFYQESDDSRWLVIKKSMLKRLNQL
FT                   SHQHKSGLVPDFAWLTTKNAKPVKGKITASEYDGDYYANACRVPMNLATSKEKLEKNTL
FT                   HRLLKFFSKQNTVTAGYTLKGKPLNNYQSASFSAPIYIAVNENRNQGYDNLFASQQYIF
FT                   AKKLPKDNYYDAALTTMAAVMTPLHGL"
FT   CDS             96648..97292
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00094"
FT                   /product="HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00094"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49541"
FT                   /db_xref="GOA:D5H0K6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR027366"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K6"
FT                   /protein_id="CBL49541.1"
FT                   /translation="MGLNAYIQGFNSLESIDRAPGYFKYHHHSVADHCFRTAELAQMMG
FT                   DIEEVHGGKKINWKALYEKSLNHDYTERFIGDIKTPVKYATPQLRKMIGDVEETMTTKF
FT                   IKDEIPEEFQEIYTKRLSEGKDDTLEGKILSICDKLDLLYEAYGEIELGNPNPVYMQMF
FT                   KESLETIKKFDDLVCVQYFIKKILPDLFKGDFAGKDKMQRIAFSILLLGDD"
FT   CDS             97293..98210
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00095"
FT                   /product="Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00095"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49542"
FT                   /db_xref="GOA:D5H0K7"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K7"
FT                   /protein_id="CBL49542.1"
FT                   /translation="MKFLCSSCGLRMDSLHFKQEGLMNPKLTSICDICLMRDLKPEDYA
FT                   NETVATFAQSLLYTFVGKKEGNPERDWIVKNKKNRKRYEAFLQDYDGNEIARSQIKRSD
FT                   LNIAIIKSEDGKLGYVPDQGVTFAQNLEKLGLEVNFQLNEVDFIDRERIRAKYKYRCQY
FT                   CGRRGRSVDHKDPVSLSHNNDLNNLTLSCAECNRIKSDMPYQLFIKLNNGIVDINKKLV
FT                   KYENALGTLKEEFEHRRRYLAAQVHLKCVINDPELNAIRKQNKSLQDAIDSLQSDYDDL
FT                   RLTRKTYFDTGWKLARIKEKKDII"
FT   CDS             complement(98280..98750)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00096"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00096"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49543"
FT                   /db_xref="GOA:D5H0K8"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K8"
FT                   /protein_id="CBL49543.1"
FT                   /translation="MTAYYNQEYHEPVDPDPVPQSNWKQILKETFLRPFTWNARTSRRT
FT                   YWIGFAILVVLSLVPTWYLIVTTSLQLMFVNSSVPMEYDPSFFVAIAIVIIFEVYFFLC
FT                   GLGLAIRRLHDINKSGYWYWINFIPTIGWIVLVYFLIQPTVKEPVRWGSYLL"
FT   CDS             complement(98832..99587)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00097"
FT                   /product="Amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00097"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49544"
FT                   /db_xref="GOA:D5H0K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0K9"
FT                   /protein_id="CBL49544.1"
FT                   /translation="MTESNEVILSLKHMQKSYGNHQVLKDISFDINKGEIVTIIGPSGG
FT                   GKSTTLRCINLLEEPTGGEIDFHGENILAPGYNRNTFRSKVGMVFQQFDLFENKNVLEN
FT                   CMIGQELVLKRSKDEARKIAMENLKKVGMDPFIKAKPQQLSGGQQQRVAIARAISMNPE
FT                   VLLFDEPTSALDPEMVGEVLDVMQKLATTGLTMVIVTHEMGFAKSISDRVLFISDGVIT
FT                   EQGAPEELFDHPKNEKTQKFLSNFRNNEF"
FT   CDS             complement(99587..101200)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00098"
FT                   /product="Amino acid ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00098"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49545"
FT                   /db_xref="GOA:D5H0L0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L0"
FT                   /protein_id="CBL49545.1"
FT                   /translation="MKSRFRWMAVIMSVLLSLFIGFSLSSNQTQAAKKDSGTLKIGMEA
FT                   NYPPYNWTQPTKANGAVPIDGSNSYANGYDVQIAKIIGKRLHKKVIVEKTQWDGLLPAL
FT                   TSGKIDLIIAGMSPTAERRKAINFSEPYRKSTFVVITNKASKYSNAKKLTDFKGAKLTA
FT                   QQGTLHYDLIKQLKGAKREPAMRDFSAMRQSLASGTIDGYVAEDIEFESYHNVNPNIIA
FT                   VNLNKMAGFKVDHDDSVTSIGVKKGNTKLLNEVNATLRTISNKKRDQLMSQAIKEQPKA
FT                   GNETKKENWLVTTWKQYGGMIMSGIGMTLLLALVSTIVGFFIGLLVGIIRTIPTPTTRG
FT                   KRWTLNVVKWLLSVYVEIFRGTPMMVQAAVIYYGIAQFWHLNLNRTVAALIIVSINTGA
FT                   YLAEVIRGGIISTPEGQFEAASALGMTHNQRMWHIILPQAIKNCLPSITNEFIVNIKDT
FT                   SVLSIISVSELFFVGTTIASQSFKFFPTYLMISAIYLILTFTITRIFNFIEKRLEGNKN
FT                   YNLMANQVQVGTPKDAEANN"
FT   CDS             complement(101533..102165)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00099"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00099"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49546"
FT                   /db_xref="GOA:D5H0L1"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L1"
FT                   /protein_id="CBL49546.1"
FT                   /translation="MNYSTYFSTNTTDYIAKDLIGRMLTFDNGQEKLGGYIVEAEAYMG
FT                   KKDRAAHSYGGRRSPANEGLYGKGGTIYIYAQRQYFFFDVATRVQNEPQGVLIRAIDPT
FT                   LGIETMIKNRHGKDGVLLTNGPAKMMQAFGIHDKNWNLHFLSDSPFAIDLDDRHKKIPQ
FT                   EIIAAARVGINQSDPVWANKKLRFYVAGNPYVSDMKKRNYETNNGWA"
FT   CDS             102198..102563
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49547"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L2"
FT                   /protein_id="CBL49547.1"
FT                   /translation="MTEIKLVRIYDHEQPAGYRILVDRLWPRGMSKVKADLAEWDKQIG
FT                   PSKELRQWFNHEDEKFPEFKQKYIEELNHNDYTAEFLQDVKKHLAKEDVLFLFGAKNKE
FT                   HNQAVVLKEYVLNTLNS"
FT   CDS             complement(102560..103348)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00101"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49548"
FT                   /db_xref="GOA:D5H0L3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L3"
FT                   /protein_id="CBL49548.1"
FT                   /translation="MSILKLYAPFFDGNNWLHVLTSGKDWMIILTLILMECLLSVDNAV
FT                   VLAAQTQVLPNKAEQRKSLVYGLWGAYLFRFIVIGIGTYLINFWEIKLAGSIYLFYLAF
FT                   KFFYDQRHPKQAAEHEKEKEEREAAHHKGKKKKRHVLSLFWRTVISIESMDIVFSIDSV
FT                   LAALAVSDNPVVVLIGGMIGILCMRGVAEIIIKLMDIIPELQPMAYLLIGIIALKLLLA
FT                   LPPLRFELPNTVFAIIVFAILILTILFHFWKVKKHGHKHI"
FT   CDS             complement(103335..103853)
FT                   /transl_table=11
FT                   /gene="ogt1"
FT                   /locus_tag="LCRIS_00102"
FT                   /product="Methylated-DNA--protein-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00102"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49549"
FT                   /db_xref="GOA:D5H0L4"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L4"
FT                   /protein_id="CBL49549.1"
FT                   /translation="MTEFFYYDYVTIEPWTYFLTASEAGLTYVGLKGDETVSPIFSFYP
FT                   HRMLVRDPKKMAPYIKQLKEYFAGIRKNFDVPIDISEFGTEFQRKVLAVVQHIPYGVTL
FT                   TYGDVANSLAEATSSRSVAHAVALNPVLIFIPDQRVILSNNKVGTYRLGQKEKIRLIKL
FT                   EKKQLHVNS"
FT   CDS             complement(103906..104604)
FT                   /transl_table=11
FT                   /gene="npdA"
FT                   /locus_tag="LCRIS_00103"
FT                   /product="NAD-dependent protein deacetylase, SIR2 family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00103"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49550"
FT                   /db_xref="GOA:D5H0L5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L5"
FT                   /protein_id="CBL49550.1"
FT                   /translation="MMDLAELQTDINNAQHIVFLTGAGVSTHSGIPDYRSKNGIYDGVQ
FT                   ESPETILSDSTLFNRPEFFHEFVMNNMYFPTAKPNLIHEKIAHFCNEKGNLITQNIDTL
FT                   DTKAGNQHVTEFHGNLYNIYCTKCHQRVSYEEYAKSYLHKDCGGIIRPGIVLYGESIDP
FT                   KVLNQSVEIMQKSDLIIICGTSFVVYPFAQLLAYRKEDAKIYSINKTEIPTPGVTQIIG
FT                   DALTAFQNLN"
FT   CDS             104694..105179
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00104"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00104"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49551"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L6"
FT                   /protein_id="CBL49551.1"
FT                   /translation="MKYMTYFYVAIDILLVVYACYSWYWQAKVDFRGRYRISSVVWALI
FT                   FIWLGFTWNYIEKGDPGLSVFLALFILISIVDGFSGFSKKRMVVSGYFKRTVKYDDLAS
FT                   VTLIQIPNQEKPLVMAIFRTSDGKAYMMRFNNEVNSVIKQLQEYAGREIPVEVQSMM"
FT   CDS             complement(105180..106637)
FT                   /transl_table=11
FT                   /gene="cls1"
FT                   /locus_tag="LCRIS_00105"
FT                   /product="Cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00105"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49552"
FT                   /db_xref="GOA:D5H0L7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L7"
FT                   /protein_id="CBL49552.1"
FT                   /translation="MIWWHDFVRIIIITNTILAFYVVFHRRRSVSTTWAWLIILLVLPV
FT                   VGITLYAFFGRGISQENIFAINKQKHIGLRNVQKSIAKAPKNTSPSDTSKAGNIAINFF
FT                   NHQQEAPLTKNNQVKLYTEGETFFHDMLKDMVRAKEIINVEFYTFYSDNIGNRVLQLLI
FT                   KKAKQGVKVRVIYDAWGSMGATKAWFDQLRAAGGEVLPFVTSRNMITRYRINYHLHRKI
FT                   VVIDGRISWTGGFNIGDQYLGKKKKFGHWRDSQVRIVGSASLLLQERFVMDWNASITNN
FT                   QQLIRFNSTLFPDLDEKNIHEGDVATQIISDGPDRYAPYMRNGMMRLMLLARKRLWIQT
FT                   PYLIPDDAVFATWQTIASSGVDVRIMIPCKPDHPFIYRATQWYANELTRLGVKIYIYED
FT                   GFLHAKTTIVDDHFSSVGSMNQDFRSYNLNFEDNAVFYDKKFNQKMVAAFEEDMKHSHL
FT                   LTKEEIKKQSRALRTLQAFSRMLSPIL"
FT   CDS             complement(106657..107583)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00106"
FT                   /product="Alpha/beta hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00106"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49553"
FT                   /db_xref="GOA:D5H0L8"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L8"
FT                   /protein_id="CBL49553.1"
FT                   /translation="MFFNTKKYAEEVEKDHKHDLQEEPSMFNMISLGLMATFAPTRIFL
FT                   KLHKRHIENKANIEKSDLKQVPIIYFHGFRGGDYTTRVMVKHATHDKGNPKFLKVTVDL
FT                   LGNFKLEGTWTSDKHPIVQVAFRQRIVGIYGIDYYLNFVLPFLAKRYGFKNYIAVAHSL
FT                   ACPCIIRTEMKHYRSKTFPHLKKCAFIAGPFDGVTYLGDIPNVNYLTESGRPSVMNPHY
FT                   LYLFFNRRKFNPDISVLNIYGNVLDNTNTDKFISVVSAKSIRYIVAPKAHFYQEVEVRG
FT                   KDDAEHSWMHDNPFVIDIIDKFLKLKK"
FT   CDS             107679..108449
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="LCRIS_00107"
FT                   /product="Ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00107"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49554"
FT                   /db_xref="GOA:D5H0L9"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0L9"
FT                   /protein_id="CBL49554.1"
FT                   /translation="MKFYAVKKGRTPGIYRTWDAAKEQVDGFSGAEYKSFEQITDATDY
FT                   LDWNAQTQSDILQKGEDNLQNAVKRVQQKSQEIKKAPRKKTKQYNHVNSNPADFFAVTY
FT                   TDGGTRNTGVYKGGHVKKTDKAAWAYLIEWDDQKVHGSGGEYGATNNKMEQTALINALK
FT                   KLLELGFNDKHLLFVLDSQYVLNAINKHWLQSWKKRGWRRSSGPLANVAEWQELDRLLK
FT                   EFPDSTFEWTKGHANNRGNEFVDHELNRYMDQKM"
FT   CDS             complement(108477..109430)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00108"
FT                   /product="Extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00108"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49555"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M0"
FT                   /protein_id="CBL49555.1"
FT                   /translation="MKKFITLLTAMLLSVVAMISFTKPVLADDDTPVVTLGTSLTDSQK
FT                   QGTLKTLTAPLNGGNYQTITVTGSDLVKYLNPSGDNFTTSSGVWSSAMIQKTSSGSGIN
FT                   VKILDYDGKNNITTITANQYKNAALTAGISDANIYVTSAIPIDGSGALAGVYAAYAKNG
FT                   NALNQKQVNAAQDEMNTLSGITQDNKNKKGYSDAQLNNAVAGAKNEMAKQGQNITDSQI
FT                   RDIVNNQININHLGDTINNNQKNQIVNLLIEIRDSGALKDGNFKQQASKLSSQIQNGAK
FT                   NIFNKFNTQENRNWLQNLWDQIVKFFSGLFGGVILN"
FT   CDS             109591..110403
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00109"
FT                   /product="Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00109"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49556"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M1"
FT                   /protein_id="CBL49556.1"
FT                   /translation="MLQVPKLTIIMPVYNTAQYLPRAFDALLNQVDKSFKLLVVDDGST
FT                   DNSVEVAESYANRFPYFKIIKKKNGGPSDARNVGMQYLDTPYVTFHDGDDWVDPGYTSF
FT                   FIHAFESHPDVSLVSCGYWMDYPDKKQRVVGRPEGGYLTRGETYLKLTNVFSSPMKGYS
FT                   WNKAYKTAIIKKYHLKFDRDISLLEDQIFNVKYISVAKGVYYTQKPYYHYWQRKGSIIH
FT                   QPNIKKVADNFRGNYRVWSKIISTMMKDREEEKMRKKLERQQALRDSE"
FT   CDS             110412..111068
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00110"
FT                   /product="Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49557"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M2"
FT                   /protein_id="CBL49557.1"
FT                   /translation="MKEKVNGVEIYYHKLGKGEPLLLLHGHHLDGGMFDKIVAPLSLYY
FT                   TVYVLDMRGHGLSEGDIAEHYKTEVEDVYTFIKQVGIEGCYCFGFDAGGLVAMMLARKH
FT                   PTIFKKMIVAGVFVNGAGIRPYHYLTEGFHRFLRLDRDSRVELTESFISVDDLKKITTP
FT                   TLCVVGEKDWVKVEHVRWYSQFMPNARLVIMPRQTHDSYAVRSLKLLDLIKGFCR"
FT   CDS             111137..111961
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00111"
FT                   /product="Transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00111"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49558"
FT                   /db_xref="GOA:D5H0M3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M3"
FT                   /protein_id="CBL49558.1"
FT                   /translation="MTIGEALKEEQKRLGLTSEAMAAGVITKGTYSKVVNGKLRLSSDL
FT                   LVEILFKHNIDISDFFEMIKSTYMPKEKLIEEKLFSEMQQALNDHEVEKAEECLTKIKN
FT                   QTSNKYLQQRAEITVAYLTNSTDKLSKNFKQAVVDELNNHSNWVKDLDALRLFNTALLI
FT                   LSSEKVEIEMNLFFIKLNRIKKISEQMEERYAILCCNYLDWKYRQQGEVNDNVKNALKY
FT                   LSDLKLTAHFESYKVCGKYFGYLFNKEIDSAKNMRKSLLALGITVGVENWPV"
FT   CDS             112158..112418
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00112"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00112"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49559"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M4"
FT                   /protein_id="CBL49559.1"
FT                   /translation="MLAATLLATTVTNPLAEVVAADAVQQPNQKGISSEKNNDIKLLQE
FT                   QIDQFDKFVVVKDNSYVLDSKVNQNFSTNEVLVVKEMLILK"
FT   CDS             112432..112845
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00113"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00113"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49560"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M5"
FT                   /protein_id="CBL49560.1"
FT                   /translation="MWVILIINVIIASIAIIAGFNNRAEAFSLFNAGVVFVAFSIVLLL
FT                   GAIPVYRNFDTSSVLMFVAGILIVLGIIMLIVSVIARSTRKINLQDLAIALMVAAVCLV
FT                   YFIHNASLNFANLLVPELALIVGLILLVYPKQK"
FT   CDS             113153..113908
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00114"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00114"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49561"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M6"
FT                   /protein_id="CBL49561.1"
FT                   /translation="MGGINCGQSNNRSPHNGRAGFSMHYAFVMKDVFTLNKIYSEVNIF
FT                   LEDLVVNELHNSQKALENRNSVIKALKTLNQELNTTKTDIKKAELTLEPYFAQRELKEG
FT                   FIRPFRENNTINESHEFWVKNGELLDENYVFNTVAKVLKEKGDLGYLQLLEKKIENLYE
FT                   NVQSLGYEFASDVAEEEIRKGMFQLAIRDAKNNVTALMTNLTAKLSALFSLVSSYCLLE
FT                   YTSHTSLTGANLTFKDLGIDSEKDMKKEA"
FT   CDS             113911..114963
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00115"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00115"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49562"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M7"
FT                   /protein_id="CBL49562.1"
FT                   /translation="MQIKVPDYGLPNFLTVRDVINGSFRPVATKYIGENKNVSEDAHSE
FT                   YLEVQDADLSCKHVVTLMNRNTSYYVHRPIDMHPCWWNLNKVSSDVDWYNSDDNRYVKF
FT                   VDWNNEVHFFPAAISIVMPKEKGLSWVTYSGYSHDKKLGKAYLKAIYELIERDDFAAWW
FT                   HKSLNIYLVDDWDSPLISEMMAYIQEGKKRRCQLFQIPNEWGLYTIMCIIESSIFPQIS
FT                   IGLGTNSIKESAIIHAIDECVGSYKGLLFEAFHGRINYSELNSRAVAKHIIKTKVSTTF
FT                   SNSISNLNLEELMKNTETFFAIINSQCGYTVKAFSTKLQPETLVDTTPLTSRLLLRTNR
FT                   PLIKGCMPFW"
FT   CDS             114986..116221
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00116"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00116"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49563"
FT                   /db_xref="GOA:D5H0M8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M8"
FT                   /protein_id="CBL49563.1"
FT                   /translation="MKRLKTAVLSDFLNDLPLGAFITYAYWYVYHQTHNQGIVSMLGTI
FT                   AMIALLFAILGGYISDKYSKIKLMRFLILIRFIFIALGTIFLVFKPKMGVAVVCFVVIA
FT                   SSVINIIYNPLTEAFAPALIDNDKELIEANSWVSLANNIATIISSGLATIFVTINRPLI
FT                   SLVILLVAVIISYILLGFIKPDTAPVHADKIKVKEIFDNFIGGMKLVEHNKLIMLMIPI
FT                   ALVVNFCFYVIWLLTPKFAITVFSQYWFVYNGIDIAYTVGGIIGALIFSKIRDNINSAI
FT                   ICPACLSLQALCLAVVGISSLLTRSLVSATICIVCWLAYGIFNSIFSIVYFSVVQMSSS
FT                   KDNTGLMIGAVMTIFSVINPIATAMSDPLGNMIQLPLLIFILGVVMVLVSVMTFMPIYQ
FT                   RIFKKYDKLYSK"
FT   CDS             116199..116945
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00117"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00117"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49564"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0M9"
FT                   /protein_id="CBL49564.1"
FT                   /translation="MTNYIQSEVVDLLNLDKKKLSKYDKLWGQLCSQNQDNNELLSIIE
FT                   RTSPILNLNNEFDLHLPYSATNLKSCRKFSNKKINISDFTWLLSNSFLSNEGGHRIYGS
FT                   AGALYPVEPLIICIKDNMVVGLPQGVYGIDYLNKALKKVNTKVDFKKLSHSISPYTGQL
FT                   ISSIFICYIFSMTRTIVKYNYRGLRHMLIEVGSMAQAFRLNGLARINNFGDVSWSGFDD
FT                   KALKDSLGLRIMKPVLLQFFGIQDYK"
FT   CDS             117568..118746
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00118"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00118"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49565"
FT                   /db_xref="GOA:D5GXT9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5GXT9"
FT                   /protein_id="CBL49565.1"
FT                   /translation="MNDFTKDMTNALFNQDKINDLFRQKLQQAVNDLLESELTAFLGYN
FT                   PYERDGWNTGNSRNGAYYRKVDTQFGQIEIKVPRDRNGEFHQHTMPDYKRHTDVLEQTV
FT                   IKLYSKGVTTREIADLIEKMYGGYYSPAMVSNISKEMIPKVEAYHQRHLSDKFFCVYLD
FT                   ATYIPLKRVTYEREAVYIAIGIKPNGHKEVIDYCIAPTENIEIWSEMLKGFKSRGLEQV
FT                   ELFLSDGVVGMKEAICQSYPKAHFQRCLVHVMRNISAKMRVDDRQKALDEFKQIHTQSN
FT                   KEMAVQVLHEFYQNWEKAYKNVVRDLRQVEPDLLTFYNYPPAIRASIYSTNMIESFNNR
FT                   LKRKTKPKTEFPTEQSLDTFIGVQAMDYNDRYFNRIHKGFGQVRDTLESYFD"
FT   CDS             118830..119501
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00119"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00119"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49566"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N1"
FT                   /protein_id="CBL49566.1"
FT                   /translation="MQKRFKLSSIAFLSVTLLATVAPTLTNAKVVDAAYEENSSNLSNN
FT                   NLSDSVQKKIEPYVEVRGNQYVLNNKVKDTVSTKDYEVAQRLIVQINSFVSQSDMVINK
FT                   ETKVATSDFVLEDDSSSSQENLLHSSGLLSKGRKKNHNGVNKVTVHWNYVHICIDKNTA
FT                   NMIKNGGIGAAGFLMGKVPNPYVGTVAGAVAGILSGLTINRGVWIDVNYFATGLSKFGW
FT                   Q"
FT   CDS             119501..119662
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00120"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49567"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N2"
FT                   /protein_id="CBL49567.1"
FT                   /translation="MLKKIIIPLVMILTALIISFLFPKIFSFDRNTIISLGIGIICYLV
FT                   GNLFLKNK"
FT   CDS             119816..121222
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00121"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49568"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N3"
FT                   /protein_id="CBL49568.1"
FT                   /translation="MESIITDIVKIIKSENNVIAREKALMCYFFNLIRELMKLALEEVD
FT                   AGLVEETKKQGYQIEKKNKRSVVTVFGEISYWRRRYICPGKKAKYPLDELMGYDKYKRY
FT                   SVLAVKDVLQVSAVATYRNTALAVNTLSCFNISHSQVGKLIVQAGKLIKNQQQSEERYD
FT                   GITQRKKVPVLYLEGDGVVIKGTKKRLEFHRYQVCEDIINLSQKRRKRVQAKEFVSLSR
FT                   LDALQEIKTYLANTYDLSDTLIISNADGGAGYAKKDFDEIVGYCRQHEHFLDVFHLNKK
FT                   IKDRLSFMPAMQGKLISAVEFKYDRHLTDVILDTIESNLIDELNTPENHENLKLLRSYL
FT                   HRRWADIKPFKMRHLSVIKAIGCCESNHRKYTYRVKGQGKYWSEDGAEGILRVLTCIKN
FT                   NELEYWLSSEFAGGQLDIGDQEELKGAVRASLRKMHETHLGIHHGIIESLTAGHSYLND
FT                   FGREINQINI"
FT   CDS             121360..122346
FT                   /transl_table=11
FT                   /gene="prs1"
FT                   /locus_tag="LCRIS_00122"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00122"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49569"
FT                   /db_xref="GOA:D5H0N4"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N4"
FT                   /protein_id="CBL49569.1"
FT                   /translation="MNKEELHQLLHPMKVIGLGGNPALNEKIAAILHQPLIETAVHHFS
FT                   DGEIQVNIGESVRGCDVFVIQSIQDPVNENFMELEIVLDALQRASAHVINVVVPYLAYS
FT                   RSDTKTRSREPITAKLVANLLQLTGMDRLITVDLHASQIQGFYNIPVDHLHAIPLLGQY
FT                   FLDNGIATKEDDDIVVVSPDHSGAKLARNFGQYFNAPIAIVDQRGARYDTEVHDMIGDV
FT                   KDKKCIIIDDLIDTGSRISSSTKSVLAAGAKKVYVAATHALLSKNATGVLNELPIEQIV
FT                   VTDTIKHKRYPDRMVRISVDQLLARGIDYVYNDRSIHQIFDEQNRLK"
FT   CDS             122511..123194
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00123"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00123"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49570"
FT                   /db_xref="GOA:D5H0N5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N5"
FT                   /protein_id="CBL49570.1"
FT                   /translation="MARRKNMKRRRVILGNTFHLIRENGMDNVSLQMIAEKSGISKSLL
FT                   QSYYPHKAKLTNDIIHNLFNTLGQQVNNYDMANSNLPYARTKAFIYTIAILGMHDEGLD
FT                   RIISEAFVSNATLDNWGIMLNEWIKENHLFDDINVDESELETGIAFVTSGIGRLYHDRK
FT                   KHHLTAEALANYATSALMFSFLHCSSEEIDQALKEGHEIIETADMEVVHRAIDTMFDEG
FT                   KEIFS"
FT   CDS             123207..124031
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00124"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00124"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49571"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N6"
FT                   /protein_id="CBL49571.1"
FT                   /translation="MVEGKRADLRRMGYEQNNQYKRLLAFVIFLIAALSLITATFLNPI
FT                   FMKKQIRTSYNRAVVVRQVNKNYDSLADLINADSEDNSNLLSDTQTQPIADHIIDYSLG
FT                   IHWFKVTSLPLANQILSDIDQGIAKGSSSGAQEVNRKLKKQGTNAPYAIIKAFNLSVIT
FT                   LGANIAGLLFIVNLIIIIVTIITMVSLLNDMKSRATIRMVIHDTMAAGMWAGFWLILIS
FT                   GLLALVPVIFNVDNIEFGFLLEIGSSVFLEYVIAGVIIYIICAIPWQITAAK"
FT   CDS             124158..125642
FT                   /transl_table=11
FT                   /gene="glnP1"
FT                   /locus_tag="LCRIS_00125"
FT                   /product="Amino acid ABC transporter, amino
FT                   acid-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00125"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49572"
FT                   /db_xref="GOA:D5H0N7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N7"
FT                   /protein_id="CBL49572.1"
FT                   /translation="MKKAKIIKTFLAFITMLSTLFLFNQPVNAANKEVETGSVMKKIKQ
FT                   SKELVVGTSADYPPLEFTTSENGNTKYVGVDIELAKDIAKDLHAKLVIKNMSFDSLLVA
FT                   LETGKVDMVISAMTPNPERKKSVDFSKIYYKPSGEYFLINKRDQAKYKKIKDFAGKTVG
FT                   AQTGSIQYSLIQKQMKQSKVKGLGKINNLVLALKSNKISGIVMEEMTAKAYQQNDNSLM
FT                   AVRSDLREQQAGNAVAIAKGQNDLVAAVNKTINRVEQKDLINKKYLPEAAKYMKTAQKT
FT                   NTMTKYIPYFIKGVGYTIVITIFSVLIGIILGMLLALMRLSKNKLLHWIAVCYIEFIRG
FT                   TPQMVQILFVYFGVGALISNLSAVVAGIIAIGLNSGAYVAEDIRSGIASVAKGQTEAAR
FT                   SLGLSQAKAYRYVIIPQALKNIWPALGNEFITLLKDSSLVSVIGVTELMYQTELIQTST
FT                   YRGVLPLFIAMIIYFIMTFTLTRLLNYFERRMKHND"
FT   CDS             125635..126372
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="LCRIS_00126"
FT                   /product="Amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00126"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49573"
FT                   /db_xref="GOA:D5H0N8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N8"
FT                   /protein_id="CBL49573.1"
FT                   /translation="MTKMIDIQHLKKTFGKNEVLKDISAEVDKGQVICIIGPSGSGKST
FT                   FLRCLNVLERPTAGKIVFDGTDLASLKDGKELDQLREKMGMVFQNFNLFPNMNVIENIK
FT                   LAPMKVKGVSEAQAEKTGLALLEKVGLADRAKQFPASLSGGQQQRVAIARALAMDPEVM
FT                   LFDEPTSALDPEMVGEVLKTMQDLANSGMTMVIVTHEMGFAREVADEVWFMADGYLQEK
FT                   GTPQEVFEHPTSERAKDFLSKVL"
FT   CDS             complement(126408..127658)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00127"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00127"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49574"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0N9"
FT                   /protein_id="CBL49574.1"
FT                   /translation="MLLRKFSIAAAATLFIPLAGQVTHAATFTTQEVNEVHNFQKEYAN
FT                   LDKTSYSAANIYAKKPNLSKKFKVGRLDPKYIKTQTDYINYYRSLFSLPAISTTDTLNK
FT                   NAQITAAVMAAINANPFINQHGLPSETKPSNISKFVWKLAKDTSETSNLNFNVSQQTAG
FT                   DVITDLITDHYNLTGSDTGHRAWLLSSRLTTTGIGAAYGTNGYRYSVQKVLNINDTFRP
FT                   ASQPVVAYPSMRLFPIELLQGKNIMWSLYLSDRTIKNKPTITITDLDTKVVTTAAHVKN
FT                   YSSCGYGNFRTILTYSPANTNLVAGHEYEVDVKGVQKYRFKLFKQDSTNDTTNYQVQQD
FT                   TTNTPTNQATTNLNSETDVRSPILLQNKILRAVIIPKATALPNNQNTFFNALIQKGWHQ
FT                   NFFVRQYVLSNPIITDE"
FT   CDS             127811..128893
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="LCRIS_00128"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00128"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49575"
FT                   /db_xref="GOA:D5H0P0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P0"
FT                   /protein_id="CBL49575.1"
FT                   /translation="MTKKLQVGLIFGGNSSEYEVSIVSGHNIYKAIDKDKFDVHPIWIT
FT                   NEGYFANEEESFKVLDDPSYQVKNPHKVNNISNLIELENLPEIDVFFPIVHGNLGEDGV
FT                   LQGLFRLMDKPFVGDDVLGAAVTMDKEFTKILAQRVGVPVADWISIKRFEYDDKKNAKL
FT                   NYEKVAEKLGRDMFVKPSNQGSSVGVSHVTNADEYTAALKEAFKYDDKVLVEKTVPGTE
FT                   VETAVLGNDKPIVAGVGQITNAKGSFYTYENKYDDNSTSKLQIPADLPQEIIDTVRENA
FT                   RKVYAATECSGMARIDSMLTPGGKVVLTEVNALPGFTNISMYPKLFEEAGVPYSELITR
FT                   LIEAGMDRFDHKKTLLHKHD"
FT   CDS             128921..129670
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00129"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00129"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49576"
FT                   /db_xref="GOA:D5H0P1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P1"
FT                   /protein_id="CBL49576.1"
FT                   /translation="MTTNKHDFEELAAPKAAAQELGISVATLRKYSLIVEKVTGKSDYF
FT                   ARTKQKARLYHQKDIDDLKAFHRLSKNSGLTLQEAARQIYAVSEKKPEPETKEPAPKPA
FT                   YNSTDVMDTEQVVKLLNTLQKTISNQNEAINSLQKQLNVIQKQNQDLIEAQKQLAAPQD
FT                   DLDKFAALPDISGIVSADEPKPKSEEEKRAEVKKDMNKSQEQMHDEIMSKAKENAKKRA
FT                   TSNVHRTLEDMQLTDQKEHWWQKIFKF"
FT   CDS             129761..130894
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00130"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49577"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P2"
FT                   /protein_id="CBL49577.1"
FT                   /translation="MKFKWKKRYTIAVIVAIVGALLTVLSYFATDIYHKDDVAVITDSK
FT                   IKDTLIEKSEDVYKNADETRQQILHLKVLSGKHKGETYTTKNVYYPSQLTTQKYRAGQR
FT                   IFVNIKKGDPAIVNPKRDWVLVLVVTITLALMVAAVGKHSLSLVVSMVISWLIFYLIII
FT                   WDVHLNGAHIILLFGLADIVFSFFSLLIVQGLNKKMLATWLATLLGVFVSFALCYVIMK
FT                   LTGESEMKYETGDYATQDPRGLFLAQTLIGILGAVMDEATDIISSLYELIQTKKNITMR
FT                   QLIHSGRTMGQEIMGPLINVLVLIFIAGALPETILYLRDNNTLASTFGFTLSLGATQSV
FT                   ISAIGIVLTVIFATGCSLFFLKKRDWKSLFKKEGENK"
FT   CDS             130891..131676
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00131"
FT                   /product="Multitransmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00131"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49578"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="InterPro:IPR014564"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P3"
FT                   /protein_id="CBL49578.1"
FT                   /translation="MSTLFALIVVLAILMTIVGGETGIRSFFSVLINTILLILVAMLIS
FT                   WGINIAILTLIFIPLKLVTIIFLGTHDYTVAKNSFYSSFLVCLIISLFILGCQYLAQAA
FT                   GLGPEAGELLVGLSQMPGLSYPMIAVTVAIFSTLGAIAEAAVAMSSGLLEVKKHNPAIG
FT                   EEELMASGTAIGNDVLGTAMNTILFGMFGSFLSLFLWYFRLHYTIGEVLNEKLFVNEAL
FT                   IIMYSLIGVILTVPLSSFMLSRGMSKKGPKHESRKSDAG"
FT   CDS             131648..132481
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00132"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00132"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49579"
FT                   /db_xref="GOA:D5H0P4"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P4"
FT                   /protein_id="CBL49579.1"
FT                   /translation="MRVENLTLANFNNREYQVHTYVLEPNPELVEQKRPLAIVVPGGSF
FT                   NHLSKREGEPVALAFNNQGFNSVVMEYNLVQDPGKIYPDAGLDVLSTVKYFRDHADEYQ
FT                   LDKDKILTVGFSAGGHVVSVANNMALNKNYQTKYDFDKTDVLPNKTILGYPLIDIKKIG
FT                   FPIPEDQKAKMPVEEDILDSALGVTRETPDTFIFQAWDDPVVLIGNSIEYIGALNNNKV
FT                   SAEAHLFNHGYHGFSLARHNVETKGQDWQDNPHAAHWFNLAMEWLKSEWGELCEA"
FT   CDS             132453..132722
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00133"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00133"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49580"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P5"
FT                   /protein_id="CBL49580.1"
FT                   /translation="MSGANYVKHKKSSNPNDNIYHTIVKNRKIDRMIMPFEAVYCVWLI
FT                   ITLVLNFKLFAYSIDAQFVLISLFFISGWVSSLIKKHRMKKSRK"
FT   CDS             complement(132772..135780)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00134"
FT                   /product="Alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00134"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49581"
FT                   /db_xref="GOA:D5H0P6"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P6"
FT                   /protein_id="CBL49581.1"
FT                   /translation="MTQNQIERHQLGQLIGANKRDHYYELHYSTGDIARLYILADGIFR
FT                   YFLDPAKKFDENHSSFVDLSQFNNDYFEKSQPKATSDSLIIKSGNYQLIFQQKPAVMSI
FT                   FDETLHRNRLVQLSPLELGNDQTTEILKQHKNEFYFGGGMQNGYFSHKGEIISIKRDKI
FT                   TGKGGVLTQVPFFWANSGFGELRNTESAGNYDFGKSNPDATILKHDTNMFDTFYLLGNS
FT                   PKNILAKYYMLTGKPLMPPKYALGLGHVGNFLTTLWQPGEAKERNAVMFEDGNYYTRTN
FT                   KPEDASGKGSLNGEEEYQFSARAMVDRYQKQHFKLSWIVPNYDVQEINEEAMASFSEYA
FT                   AIHDVSAGLWSQNNTPKASPDTTFIQTDTTDPKVLKNDALILRNNLKRKRPLIFSNTGI
FT                   AGSQNRTMLAFGDIGGNWENIPTQVAGFLGASLSGQPLVGSAVDGTAGGGNAQIAIRDF
FT                   EWKAFTPILFNLDDQGKFSKTPFAYNSKMTQINRAYLKLREQLQTYLYTLIYRAQVGEP
FT                   ILRPLFLEFPHEQVNYTPQVGHEFMLGPNLLISPIVNGREDGNGNSRKDNLYLPSHRTM
FT                   WVDLFDGKKYLGGRVYNKQSYPSWHLPVFVRGGAIFDLGERNYVLYPQGKSKMVTYDDN
FT                   GYNDYSRNHVATQITSDLEASKLTITIDPTQGDFNTFQTESTTNLNIMCDGYPDGLTVK
FT                   INDKEIPMQEYGTVDTFAHAKEGFFFNTNYSWMPEFDQYQEKKQTALQIKLAKRDITDS
FT                   KIEITIRNFRYGNETLVHAITDSLLRSPKQPMVDPDKISSHSLTVVWPQLTDQVQIEVN
FT                   GILHDGIDGNSFTFHELVPNTRYTLRLRYVAGNKVSEWSDPFGAITKPDPMNYAINDIH
FT                   VTSSLASPKDHPIDYLTDLKLASEWETIDGVSEDEPLELNFTFNHLEHLSRMVWVPRKI
FT                   DHQGDPVEVSVELSSDGVNFKPYGDHLTWKSDSKNKVVGLRNVDAKAIRLKVYKSSGPF
FT                   VAAKEVIFFRDKK"
FT   CDS             135934..137046
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="LCRIS_00135"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00135"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49582"
FT                   /db_xref="GOA:D5H0P7"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P7"
FT                   /protein_id="CBL49582.1"
FT                   /translation="MTYYIHADKFFLENRTENGGYLEVQDNGKFGFFYPESKKPEGEIV
FT                   DYAGKWVAPGLVDTHIHGSLREDVMKSDWEGINKISKGLLSAGVTSWMPTTITAASDTL
FT                   TRICKMFADHQGQEEGAKIQGIHFEGPFFTEEHAGAENPKYMMDPDINEFNKWLDASNG
FT                   MLKKISMAPERKGSKEFIREAVKEGIVVVLGHSSASFEEAVAGIEAGATMFTHTFNGMP
FT                   DPSHHTPSISNAAMTLNNVTDELICDGHHVQPCMAKTLINAVGPEHIALITDCMEAGMM
FT                   PDGDYMLGELPVYVKDGMARLKDGDNLAGSILQLKQAVKNVVDWNIVTPEKAVMMASYV
FT                   PAKSAHILDNCGTIAPDKDADFLILNPDLP"
FT   CDS             complement(137281..138459)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00136"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00136"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49583"
FT                   /db_xref="GOA:D5GXT9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5GXT9"
FT                   /protein_id="CBL49583.1"
FT                   /translation="MNDFTKDMTNALFNQDKINDLFRQKLQQAVNDLLESELTAFLGYN
FT                   PYERDGWNTGNSRNGAYYRKVDTQFGQIEIKVPRDRNGEFHQHTMPDYKRHTDVLEQTV
FT                   IKLYSKGVTTREIADLIEKMYGGYYSPAMVSNISKEMIPKVEAYHQRHLSDKFFCVYLD
FT                   ATYIPLKRVTYEREAVYIAIGIKPNGHKEVIDYCIAPTENIEIWSEMLKGFKSRGLEQV
FT                   ELFLSDGVVGMKEAICQSYPKAHFQRCLVHVMRNISAKMRVDDRQKALDEFKQIHTQSN
FT                   KEMAVQVLHEFYQNWEKAYKNVVRDLRQVEPDLLTFYNYPPAIRASIYSTNMIESFNNR
FT                   LKRKTKPKTEFPTEQSLDTFIGVQAMDYNDRYFNRIHKGFGQVRDTLESYFD"
FT   CDS             140215..140511
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00137"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00137"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49584"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0P9"
FT                   /protein_id="CBL49584.1"
FT                   /translation="MTTASINFKVDAKTKSLFNQAAEKMGLTSSALLNVFVTRVAREQA
FT                   VPFSLKVVPDKNKSFDEESKKAMVKELAIVNGLIPDDDNTVDNLDEYFKNLGV"
FT   CDS             140513..140866
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00138"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00138"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49585"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q0"
FT                   /protein_id="CBL49585.1"
FT                   /translation="MYKIKTTKLFDKRFANLKKIFDLSDDEATDATETLKYTMILLQRD
FT                   GKLPSNKDDFDNINDPNGPYYDHKLTDEPWIGFNEYHILNDLLVVYYKVDSKKTIRFTT
FT                   ITTHDELRKGKLK"
FT   CDS             141088..142485
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00139"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00139"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49586"
FT                   /db_xref="GOA:D5H0Q1"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q1"
FT                   /protein_id="CBL49586.1"
FT                   /translation="MFIGRKKELTKLEKMYQADKFQFAAIYGRRQIGKTALINEFVRNK
FT                   PTIYFTGLEENEFYNLERFSSAIEHFKDPDSLSSVNYGNFENCFREIARLAQKERIVLV
FT                   IDEYPYLANAVHAISSMLQSYIDHEFKQTNLFLILCGSSMSFMEEQVLSYKSPLYGRRT
FT                   GQFKLQPFTLHETQEYFPHMDKEEAFILNTITGGVPLYLSYMSEDKDVWENIEENFMDV
FT                   NAPLFQEPNNLLKQELRDPANYNSIINAIAGGASRINDIATKAHLSTPLVTSNVTNLIE
FT                   LGIIERKVPVTDQAKPKSRKTIYQIADGLFRFWYTYLGKYMSSIDRGQTSLVMKVIKQD
FT                   LHNFMGPEFEKLAQNYMWDHDEDDEVIPMPFIYLGNWWGNDPQEKKQVELDVVGLTADN
FT                   LVGYFGECKWKNEPIPRSVLEKLINLSNLISVAKRHYYLFSKSGFTDSCTELAEQVGCK
FT                   LISFDEM"
FT   CDS             142534..142686
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00140"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49587"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q2"
FT                   /protein_id="CBL49587.1"
FT                   /translation="MFKKGDNVVLILKPNGNLEMKKEKLIFGTKYQKCLLKKKDCRLKI
FT                   WDMIH"
FT   CDS             complement(142855..143331)
FT                   /transl_table=11
FT                   /gene="ntd"
FT                   /locus_tag="LCRIS_00141"
FT                   /product="Nucleoside deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00141"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49588"
FT                   /db_xref="GOA:D5H0Q3"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q3"
FT                   /protein_id="CBL49588.1"
FT                   /translation="MAKTKTLYFGAGWFNEKQNKAYKEAMEALKQNPTVDLENSYVPLD
FT                   NQYKGIRVDEHPEYLHDIEWASATYHNDLVGIKSSDIMLGVYLPEEEDVGLGMELGYAL
FT                   SKGKYILLVIPDEDYGKPINLMSWGVCDNAIKISELKDFDFNRPRYNFYDGAVY"
FT   CDS             143446..143943
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00142"
FT                   /product="PTS system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00142"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49589"
FT                   /db_xref="GOA:D5H0Q4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q4"
FT                   /protein_id="CBL49589.1"
FT                   /translation="MTNQNLFAPDAVFISNQTKQDLVFKEVYEHLRESGYVKGNFLNHI
FT                   VEREHNFPTGLDTATLGKNIPNIAIPHTEGEFVNTRLIVPVALKTSVTFHNMINPSQAI
FT                   EVKFLFMLLDNDPDGQATLLAQVMDFLANTPANELREVFNFTDPSAIYAFLEQKFSKKK
FT                   ED"
FT   CDS             complement(143961..144764)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00143"
FT                   /product="Protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00143"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49590"
FT                   /db_xref="GOA:D5H0Q5"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR025163"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q5"
FT                   /protein_id="CBL49590.1"
FT                   /translation="MTKKLTNQLIGITSGRNFRELGGYETLSGKKIKMHKLLRTGNLAD
FT                   LSPFDKQFLTDYGVKYDVDFRSKEEVDNQPDRVPDGVEYIYDPVFSEDLTNSSKSITDL
FT                   DTQAHDDADFGFNHMHYAYEDMIESEPAQKAYRKFFDVLLENTVDGESVIFHCTAGKDR
FT                   TGFGALLALSALGVPLNTIKKDYLLTNITTKDFVDSMVEHARQNGKNENVLQSIRDIQS
FT                   VRSEYLDHAVKVLNDEYGGINNYLRDVMKLSSADIMKLRNIYLED"
FT   CDS             144909..145394
FT                   /transl_table=11
FT                   /gene="usp"
FT                   /locus_tag="LCRIS_00144"
FT                   /product="Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00144"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49591"
FT                   /db_xref="GOA:D5H0Q6"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q6"
FT                   /protein_id="CBL49591.1"
FT                   /translation="MAKESILVPVDGSESAERAFDKAVKVGQRDGAHVDVLNVIDTRQF
FT                   IGEMQDTLISGDTIYQMTQDSEEYLKSLKKWAHDNFNFDDVDYHIRYGSPKRIISYDFI
FT                   KDHHNTLIVMGATGLNAVERMLMGSVTEYVNQHALADVLIVKTDMGNNPVKPTMKKN"
FT   CDS             complement(145477..146511)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00145"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00145"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49592"
FT                   /db_xref="GOA:D5GZK1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZK1"
FT                   /protein_id="CBL49592.1"
FT                   /translation="MTNSNSSISKHYHQLNSEQRGQIQALLDSGITSCTAIAQEVGCHK
FT                   STISREIRRGSVLQRDSSYVLYEHYYADTAQIYHEKRRRNCYKRNPLQHYAVFFRMLSR
FT                   RFKAKFDATSIDEFVGEFHRIMPNYPCPSTPTVYRYIDQGLLDISNIDLPMKLKRRRNK
FT                   RHHSHGGHAPHKKNLGNSIEQRPKEVENRKVPLHWEGDLVKGVRRKNQPALMTLTERTT
FT                   RFEVVIKIPDYRASTCQRLLQKEIDRHPNWFKSITFDNGSEFADMTKIKGCQIYFAHPY
FT                   SPWERGTNENCNGLLRQFFPKGKSMKDKSKAYVQQATNAINHKYRRILQYQTAEELFKQ
FT                   YISS"
FT   CDS             146916..147845
FT                   /transl_table=11
FT                   /gene="phnD2"
FT                   /locus_tag="LCRIS_00146"
FT                   /product="Phosphonate ABC transporter, phosphonate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00146"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49593"
FT                   /db_xref="GOA:D5H0Q8"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q8"
FT                   /protein_id="CBL49593.1"
FT                   /translation="MKRFRRILVAVVALLVAVVATACSNKSNSSKGGYTPKSLTIQFVP
FT                   SQAATKLQARAKPLEKMLSKRLGIPVHVSMSTDYNTVVEAMKSKKVDVGFLPPDGYVLA
FT                   HKQGAADLLLQAERYGVKQPGGKATNQLVKSYRAEILVKKGSKIKNWKDLKGKSISVQN
FT                   PTSSAGYVFPVAELKQKGLDVTKSCKLVTVTGHDQAVLNVLNGDTDAAFVFEDARNIVK
FT                   KDNPKIMSQVVPIYFTKPIPNDTISVIPSMSKSFRKKLAKAFIAVGKSKEGKKVIESVY
FT                   SHEGYAYAKDSDFNVIRKYDKIVESTKK"
FT   CDS             147876..148649
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="LCRIS_00147"
FT                   /product="Phosphonate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00147"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49594"
FT                   /db_xref="GOA:D5H0Q9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Q9"
FT                   /protein_id="CBL49594.1"
FT                   /translation="MADKPMIQLKDVSKIYDNGTVGLKDINLTINKGEFVVVVGLSGAG
FT                   KSTLLRSINRLHDVTSGDILIDGKSITSTKGKNLRELRRDIGMIFQNFNLVKRSSVLRN
FT                   VLVGRVAYYPTWKTTFNLFSKEDKQKAYEALQQVDLADKVYARADELSGGQQQRVAIAR
FT                   VLMQNPKIILADEPTASLDPQTSVRVMNDLKMLNEKYGMTVVANLHSIELAQQFGERVI
FT                   GIRAGQVVYDGKMKDTPKSVFTNIYNGGNGSEEDE"
FT   CDS             148649..149440
FT                   /transl_table=11
FT                   /gene="phnE1"
FT                   /locus_tag="LCRIS_00148"
FT                   /product="Phosphonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00148"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49595"
FT                   /db_xref="GOA:D5H0R0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R0"
FT                   /protein_id="CBL49595.1"
FT                   /translation="MPEQVNQLPKRKFKVMNLVWTIIMIAGLFISINVTNTHISVLFEN
FT                   WNQFADIFIQMSHPDWSYLNVVWPKLIETIKMAVLGTVIGSVVAFIYSLLIARNIVKNK
FT                   AVTGILRVIMNIVRTIPDLLLGAIFVAIVGIGPVAGVMALAVFTFGVVVKLFYEAIETI
FT                   DPGPIEALTAVGANKLQIIHQAVLPQIMTYFISYVLYAFEINVRASTVLGYIGAGGIGL
FT                   NLQQTLQVFNYAQTGTIIIVIIVVVVLIDYVSSKSREALMR"
FT   CDS             149440..150252
FT                   /transl_table=11
FT                   /gene="phnE2"
FT                   /locus_tag="LCRIS_00149"
FT                   /product="Phosphonate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00149"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49596"
FT                   /db_xref="GOA:D5H0R1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R1"
FT                   /protein_id="CBL49596.1"
FT                   /translation="MDTTMKKLPAKPVDRKKQVVHWLIAIVTIIIIVWSFTGINFGGIK
FT                   ATAGQIAGAIFSGIFHPDWKYVYNGSGEDLISQLWQTICIAFLGTFISAIISLPFAFWA
FT                   AHTKHKHWYTSRIGKIVLAIIRSFPEIVLALMFIKAVGPGSAAGVLALGFHSVGMLAKL
FT                   FSEAIENLDDGPNEAVVAAGGSKFHVVMFSTLPNLMPALISNTLYRFDVSIRSASILGL
FT                   VGAGGIGYPLIIALQYRQWDRVGIILLGIIIMVVIIDWISGWIRKKLV"
FT   CDS             complement(150307..150876)
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="LCRIS_00150"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49597"
FT                   /db_xref="GOA:D5H0R2"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R2"
FT                   /protein_id="CBL49597.1"
FT                   /translation="MNQEIIRCPWGDTKDEAVQEYHDHEWCKLNLDESHLYEMLVLELF
FT                   QSGLSWSTVLHKRDNFKAAFKNWQISEVAKMTDKDIESLMQNKGIIRNRMKINAAVKNA
FT                   RAFLAIEQKYCSVAKYLQNFVPTPIVHDIASFDDLPASNDLSQKISKQMKKDGFSFVGP
FT                   VVIYSYLQGIGLINDHLNQCQFKFHG"
FT   CDS             151035..151520
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00151"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49598"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R3"
FT                   /protein_id="CBL49598.1"
FT                   /translation="MEKLDTMMLADDLALSQDKILNGEQDFGAEAVYKVIDNLGVLNNP
FT                   IKDYFDMTEEQYYEAESDHKLTLIKMDSKLTDLHDRILTNHVDGFVDKDEINLTYNHEN
FT                   PYEDDLYDPTTDYREIVYSLKVIGAVQAIAAKDLQEVLSKDAVLSIGLAAYALAHNA"
FT   CDS             151577..152974
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00152"
FT                   /product="5'-nucleotidase/2',3'-cyclic phosphodiesterase
FT                   related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00152"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49599"
FT                   /db_xref="GOA:D5H0R4"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R4"
FT                   /protein_id="CBL49599.1"
FT                   /translation="MNLFKHTKGIVDRIVGAKKRSAMDKDSELLDPMQKYTTVGEYHVG
FT                   AVDGTPHGKDYVLTVYQDEDGVLRQALSPESTTKLAPEYLRKYNAKLGHFRAFHNKKTG
FT                   RRYWVENYLDNFTTEVKKHIRPGTNSVNIGVITDTHFKDKDSSDFYGFNGLQHVQEFSY
FT                   LDQSGLLDLKVHLGDWIDGSDAGLVSESELVKLNKSFKSDQVPYLSIKGNHDENDKFDE
FT                   HHDLKASFPENEFENIMWPDMYRQRGIHYVSRQHGVAYFDLDDVRVISVNTSDVPYELN
FT                   NRGQKRYDNKIVLAVREDQIEEIIEILANSSNKKIIFMSHANPINRKGSNALKYNGRSL
FT                   HELLVAFNQREKGRMHASNGVPTEFRLSNDFDFTNIKNARIIAYFCGHRHREDQYRING
FT                   IQYILFNCSALMGPNHSLTTKYNKNLDRRIDQNNEFAGYIVNVDLKRHRIQAFGYGAAS
FT                   RRRVYFI"
FT   CDS             153098..155047
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="LCRIS_00153"
FT                   /product="Asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00153"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49600"
FT                   /db_xref="GOA:D5H0R5"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R5"
FT                   /protein_id="CBL49600.1"
FT                   /translation="MCGIVAFYDPKINEKQAVIGKMMAAIKHRGPNSDGYYTNDEVALG
FT                   FRRLSIIDLRGGSQPIYNEDKTRAIIFNGEIYNFKPLREELIKAGHVFSTKADTEVLLH
FT                   GYEEWGMDGLLKRVRGMFAFLIWDDNNKTLYGARDFFGIKPMYYSNQNGHLLVGSELKS
FT                   FLEFPKFKRELNVEAVKPYLMNQYNDLEETFFKGVYRFPAGHWFEYKDGEMKTHQYWDA
FT                   EYKENNLSFEETLQKINEDLKETVDLYRNADVKVGAFLSEGIDSSYLTSLLNPDDVFSV
FT                   SFDDSTYDEASKAKALADINHWKFFSDKVDADEAMRDFPEMQYHMDEPDANPSIIPLWY
FT                   LCKLARKHVTVALSGEGADELFAGYVNYGMHTHNDIIKVFTSELKKLPEKKRVKLAHKI
FT                   KRMPNFPGKVHMYTNLAEPSEFYVGQSVIYDMDYPTIFTSKDANSILQPTYRNKLTVNG
FT                   IYQKDFKKVKGVDNVKQMQYIDLHHFMLNDIEQKADKISMAHSLEVRVPYLDKKIAELA
FT                   NSIPTKYLVNRHDTKYALRKASEKVLPDEWAKRPKLGFPTPIKQWLKEPRFYKQVHALF
FT                   EEEFVNDIFDQKKIIKLLDDNYEGDGSHRRQIWTIYTFLVWYKLFFVDYENTVKKYQHV
FT                   QPEVAKLISQGKLL"
FT   CDS             155069..156352
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00154"
FT                   /product="ATP-grasp enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00154"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49601"
FT                   /db_xref="GOA:D5H0R6"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R6"
FT                   /protein_id="CBL49601.1"
FT                   /translation="MSKKFTPILLGSDINVYGMARSFNEVYGIKVKALADVQLAATRYS
FT                   SIVDVELHHGFSSDPTFMDVMHKKMEEYKNHEEPVILIACGDGYAELLSKHQDELKKVF
FT                   IVPYIKYDLLEKLISKEGFYEIAEEYGLPYPKTKIITMDDYKSGKYEDVPFDFPVELKP
FT                   EDPVSWLKCQFEGRKKTFAIQDKAEFKDIVTKIYTHGYNADLILQDFIPGDDSNMRTLN
FT                   AYVDKNHQVKMMCLGHPLLEDPTPQSIGNYMAILPEYNEKLYEEVQQFLEKLNYTGMAN
FT                   FDIKYDPRDGEFKFFEINLRQGRSSFYVTLNGYNLAKWYIDDYVEDALKDKETVYGNKL
FT                   ESKYKLWLGVPKKIFNNYAYDNDYKTTADELIREGRYGTTVFYDKDRNFKRWLLMKYMF
FT                   HNYFKRYKTYYEVNKGKIFDEENKKLNK"
FT   CDS             156526..158733
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="LCRIS_00155"
FT                   /product="Anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00155"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49602"
FT                   /db_xref="GOA:D5H0R7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R7"
FT                   /protein_id="CBL49602.1"
FT                   /translation="MLKEEFNQQNVTKLNTPKTFVKRDGSKYPFAIFKLNMVLHNLDLD
FT                   NVAPAVIEKIVAKLDAADEVNAQDVAVAFRDSLNELGYLDEAKAYVQYRKHDEEEWIKQ
FT                   TDTRARLKRMVNGDPTIVNENANKDSEVFSTQRDLTAGTVGKTVGLTMMPEHIAKAHLR
FT                   GDIHWHDLDYTPLSPMTNCCLIDFKDMLTNGFKIGNAYMTSPNSINVATHQVTQIITNV
FT                   ASSQYGGCSFDRADEVLAPFAEKNYQKHLKDAGKFINDPEKLEEYAKSQTKKDIYDAMQ
FT                   GLEYEINTMFSSQGQTPFTTLGFGLGTSWIEKEIQKDILRIRIKGLGRERRTAIFPKLV
FT                   FTIKKGLNLHPGDPNYDVKQLAIQCSTKRMYPDVLMYDTIKKITGSFKAPMGCRSFLQG
FT                   WKDENGKEVNSGRMNLGVVTVNLPRIAMESHGDKKLFWEIFNTRMRTCHQALAFKGRRA
FT                   IQAKPENAPIMYQYGVFGKRLKPGDDVNELFKNGRATISLGYIGLYEVGTVFYGPDWEH
FT                   NEEAHDFTIEIVKKMHDLCAKWEKEAPYHWHYSLYSTPSESLTDRFCRLDTAKFGKVKD
FT                   ITDKEYYTNSFHYDVRKHPTPFEKLTFEAPYPYYAAGGFIHYCEYPNLKQNPAALEAVW
FT                   DWAYDKVGYLGTNTPIDKCYKCGFAGEFKSTAKGFECPKCGNHDPATCDCVKRTCGYLG
FT                   NPLKRPMVHGRHEEIVHRVKHMDFGMEDSLATEEEVKNGEY"
FT   CDS             158733..159446
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="LCRIS_00156"
FT                   /product="Anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00156"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49603"
FT                   /db_xref="GOA:D5H0R8"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R8"
FT                   /protein_id="CBL49603.1"
FT                   /translation="MPEKDKNTQEGPDIRSNLIKVNMGGDTMFVDPDQYKPQLDHQREL
FT                   KRMHRKPKNPKPQEWKTEDYSKHKIADYKPFNFVDGEGVRCSLYVSGCLFDCPGCYNLA
FT                   AQNFNYGFPYTQELEDRIIKDLGQPYVQGLTLLGGEPFLNTWVCLRIINRIRKEFGHSK
FT                   DIWSWSGYTWDELQKETPDKKEMLSKIDILVDGRFMNDLKDLTLQFRGSSNQRIIDVPK
FT                   SMKAGKVVIWDKLQK"
FT   CDS             159498..160076
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00157"
FT                   /product="Metal-sulfur cluster biosynthetic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00157"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49604"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0R9"
FT                   /protein_id="CBL49604.1"
FT                   /translation="MEEKNIKQVDQIMTALTQVIDPELQVDVVNLGLIYGIDIEGDKAT
FT                   IKMTLTIMGCPLSDYLEQHIQKAVLSVAGIKSCDIKLVWYPVWTTERLSSAAKKQLGVT
FT                   NHDDQIKQEKATKEKIIDFSVPIKKMADEYPDFVQIMYDCGFTRIKIPGLLKTVGRVMT
FT                   IPLGAQAMKLDLAKVKKAFEDKGYKVIND"
FT   CDS             160069..161265
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00158"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49605"
FT                   /db_xref="GOA:D5H0S0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S0"
FT                   /protein_id="CBL49605.1"
FT                   /translation="MTDKKRQDAILKILHYIQNGGDFATAKKMFQEEFDQVDVAEITAA
FT                   ERELIKQGLNPAEIQYLCNVHADVFKGNIKENAVNPDFATPGHPVHTIKLENMVLKSLV
FT                   NDALLPDLKKYQAGQDTLDKIRKELSDLATIDKHYRRKETSLFPLMNKYGITAPPEVMW
FT                   GVDDDIRNLIGDASKIAGEEHPDKDLLAEAIKKASHEVLEMIFKEESIMIPMIDEVVDQ
FT                   DDWYNVKREESQIGYTLIRKPMNWKPKEAKKEAGPISVSNLSSFLINFEEGRLNLEQLN
FT                   AILDMLPFALTFIDEHDKVAYFGGGAEIYPHSRNAIGNDVFSCHTAKSRPLIKKIFAQF
FT                   HSGEVDKYEFHFTPHKMKRCLYLRYYAVRDKNGKYLGCLEVAQDVTEIRSWTEEKKKI"
FT   CDS             161382..162599
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00159"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00159"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49606"
FT                   /db_xref="GOA:D5H0S1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S1"
FT                   /protein_id="CBL49606.1"
FT                   /translation="MRTAHGKQPADEIKLHWLLLGQLLTWLGSSFIWPLTSVYLHDHLG
FT                   VSLALVGVVLLFNCVANMIGSFISGWCYDHMDPYVLLIVGAALDAAVLFGMALNHSWPL
FT                   YWLWMTLTGFLGGWNGALINSIATSIKSKPGRYVFNMIYFAQNVGVVCGTLAVGYLYDY
FT                   SVTLLFVIAGLLFVGVCVNAIINYRPMIQFHKERLANKGESKKQAFEPMPKYNLIMSIG
FT                   FFVTIAVIWLMYMNWESNLSVYMVSLGIPFHLYSLLWTINAGIIVIVQAILSRFTIFKS
FT                   LFRQILFGTLMFAISFVTLIFAKDFAHFALSMVILTLGEATAMPSIPTYVNDLSPDSSK
FT                   GKYQGLTLSASSIGRALGPLFGGLIIEDFGYIQFFAVAAIGIFLLLVMLIPMHAKLQKK
FT                   LKLFVK"
FT   CDS             162681..164627
FT                   /transl_table=11
FT                   /gene="pepO1"
FT                   /locus_tag="LCRIS_00160"
FT                   /product="Endopeptidase O"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49607"
FT                   /db_xref="GOA:D5H0S2"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S2"
FT                   /protein_id="CBL49607.1"
FT                   /translation="MYFNVRGGAGDITKANTSARLQDNLYLAVNSEWLEKAKIPSDRSR
FT                   TSSFDGIDLNIEKNLMQDFADFAAGKKELPTVPNFKKAVELYKVAKNFDKRNADGAAPI
FT                   QADLHEILDLRNFADFNLKAADFYKNGFAVPFAFSVEADMKNTKIHSLNFGGPSTFLPD
FT                   TTTYKTPAAEKLLDVLKKQSIKLLTMAGLDEKDAEDYADLAIKYDAKIAKVVKSTEEWA
FT                   DYPATYNPISLADFEAKFDSFKMDYFLGGLFTKKPERIISTEPRYLDHAEELLNEENFA
FT                   EIKAWMLVKFINGVAYSLSQDFREAAFPFSQALSGQPELSSGVKQAYHITNGDFGEVVG
FT                   VYYGQTYFGAEAKADVTDMIHKMLDVYEKRIRENSWLSQATKDKAIVKLRALILKIGYP
FT                   DKIEEIYDRLQVDPTASLYENEVQFGREQIKYNLEKLYQDVDRTVWLMPGDMVNACYDP
FT                   QRNDLTFPAAILQKPFYDLKQSRATNYGGIGVVIAHEVSHAFDNNGAQFDEFGNMKNWW
FT                   TDEDFAEFKKRTQAEIDLFDGIEYGPVTLNGKQIVSENIADQGGLTAAVEANKGEGADK
FT                   KAMQELFENFARVWATKQLPESIKTQVSIDVHAPGPERANVQSQCQEEFYKAFDVTEND
FT                   GMWLAPEKRVVIW"
FT   CDS             complement(164796..166817)
FT                   /transl_table=11
FT                   /gene="kup1"
FT                   /locus_tag="LCRIS_00161"
FT                   /product="Potassium transport system protein kup"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00161"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49608"
FT                   /db_xref="GOA:D5H0S3"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S3"
FT                   /protein_id="CBL49608.1"
FT                   /translation="MNNKAKRMSAAGLLIAIGIVYGDIGTSPLYVMKSIVEGNGGIGNV
FT                   NRDFIIGSISLVLWTVTLLTTLQTVIIALKATNHGEGGIFALYTLVRKRAKWLVLPALI
FT                   GGAAILADGTLTPAVTVTTAIEGLKGLNFGGNVPVSTQNMVIAITVVILLVLFSIQKMG
FT                   TSIIGKAFGPIMFLWFTFLGVMGVMNMVGDWSILQAINPIYAIRLLVSPYNKAGLFILG
FT                   SIFLATTGAEALYSDVGHVGKSNIIGSWPFVFVCLSLNYFGQGVWILNNPTYRPADGGV
FT                   LNPFFEMIPANIRLFAIILATIAAVIASQALITGSFTLVAEASGLKFLPRMNINYPSNE
FT                   KGQIYIPSINKGICVATIAIVLYFQTSAHMEAAYGLSITISMLMTTILLYEWLVMKKVN
FT                   TVWNWIFLIFFGVLDIMFMISSLTKFTHGGYVSLFIAGAIGFVMYVWYYGNKVRDKREA
FT                   RNAYVRLDEYTDMLTNLSHDENYPTYATNLVYMANVKYNKFIKREILYSILDKRPKRAK
FT                   AYWFVTVNVTNEPFTAEYAVNTYGTKNVINIQLYLGFKKQTSVNVYIRQIVHDLIADGT
FT                   IEAQPQEYTTTPGRDVGDFAFVIVQDVISPQTQLVGYEKWLVEARVRLQNLSSNPASWF
FT                   GLEYADTIIERIPLILGRPNPSYIKRIKPKDYSNAKTK"
FT   CDS             complement(167039..167473)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00162"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00162"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49609"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S4"
FT                   /protein_id="CBL49609.1"
FT                   /translation="MTEEEKNAQAQADKENEENDDLKVVMPEANRTTMPQEEFKEQPDY
FT                   LKVFANFYIAEFDEDDLEVINLYDENHNMVDINRYVLNNIHFPRKKLVDHVLQYHDYNF
FT                   KDLLKTMEEKTGVKPEEMLTYEAWEKWDEDQRTKIPSSLS"
FT   CDS             167805..168041
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00163"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00163"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49610"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S5"
FT                   /protein_id="CBL49610.1"
FT                   /translation="MEINKILKALNKVGIRVAFCIDEVSNTPTIQKLAEEFNDWSLNNY
FT                   QVSVIMTGLLSEVAELSGTHNLTFLVRTDRFDV"
FT   CDS             168034..168369
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00164"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00164"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49611"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S6"
FT                   /protein_id="CBL49611.1"
FT                   /translation="MYENLSQKMTFEKVLEYTKLRFRDILFNQAYDVIAHELTDVDFQF
FT                   LYAMAQDNSISSVIRTMQKSKQYVNSYRAKLIKYDLIKPIIRGKVGFALPLFRDFIQAK
FT                   YDELNWG"
FT   CDS             168436..168642
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00165"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00165"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49612"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S7"
FT                   /protein_id="CBL49612.1"
FT                   /translation="MDYETKLAEEREYGEEKGILSATVNAIKKIIRRNRSYGVSDSKTL
FT                   EDLTEDYHDSVSRDQIEQMMKEA"
FT   CDS             complement(168787..169125)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00166"
FT                   /product="Transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00166"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49613"
FT                   /db_xref="GOA:D5H0S8"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S8"
FT                   /protein_id="CBL49613.1"
FT                   /translation="MIDAEPHAGHEMGGHDPEKGNIRRRYLVVSRHAYTKKSGLVIGLA
FT                   ITHNHITDDPFRFYVLDYASHTNGDALLFQMLSYDFIARHGKIIGHIKESTEFDNLLQQ
FT                   VRNIFSKE"
FT   CDS             complement(169148..169423)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00167"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00167"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49614"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0S9"
FT                   /protein_id="CBL49614.1"
FT                   /translation="MIVKARKQGNSIVLTIPSTIKVPLNTEFSVDVNKNGDIVYKRIAK
FT                   NNYDLWSDPAYDDYDYDTEIKREYQELGYNPREVKPVGKELANEKD"
FT   CDS             complement(169528..169947)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00168"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00168"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49615"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T0"
FT                   /protein_id="CBL49615.1"
FT                   /translation="MKKLVFWGVIAAMFILGGGGAGAYISHANTQTHNNTSYNNSNKKN
FT                   ADPDQQKSNNSDADSNKDNSSQDDSAKSSSDKDNSSRSKKSSSSNKKSDDQSSSSSSSS
FT                   DHQQEQSSSSQSSAASSSNDQSSAVSSSSAADDNK"
FT   CDS             170098..170313
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00169"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00169"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49616"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T1"
FT                   /protein_id="CBL49616.1"
FT                   /translation="MNYELTEQSIQYVFGNKKYKNGQKTRNLKNVKTGAKADELQKVGQ
FT                   AIASLQEDSLDEAYLVQKSRLVPAAE"
FT   CDS             170348..170620
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00170"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49617"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T2"
FT                   /protein_id="CBL49617.1"
FT                   /translation="MMAKTTKNMKLTFLNGEKKKISITLGDAVDNLTADQVRGAMNTIA
FT                   EADAFEKDGVAYYHTPQSAAYIERTVTDIFNDSAESAVEPAAKQD"
FT   CDS             171145..172545
FT                   /transl_table=11
FT                   /gene="slp1"
FT                   /locus_tag="LCRIS_00171"
FT                   /product="S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00171"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49618"
FT                   /db_xref="GOA:D5H0T3"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR004903"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T3"
FT                   /protein_id="CBL49618.1"
FT                   /translation="MKKNLRIVSAAAAALLAVAPVAASAVSTVSADAAATTTATTNSNV
FT                   TLNLNGAGSTATDAANTVNVSSNFSLNAPVKANNAVTADATLGGELTATLNGTSVSSSL
FT                   ADAAQDVTVSDGKTNLYSYNKETKKVENNLNNVVAGQSYTLTLTNVGFSFGSAMKNKTV
FT                   TVKLANGELSGKNVTKNTDGSYKLTLDQYGNATELTYTQSLKAYNQGNTNSVFFINQNS
FT                   GTTETKGLYLTLANGNGELNVADVLANIEKQYTAVQYNDSKFMSSTEKDSPVTITTNKD
FT                   AVIAELKKQNIPVNAAGNFTAPDTFTVTLNAKSSINGKTGQLVVTVSVPNGKKTTVASQ
FT                   EKTIMHNAYYYDKDAKRVGTDKVTRYNKVTVATSTTKIGDKTYYEVIENGKATGKYINA
FT                   DNIDGTKRTLKHNAYVYATSKKRANKVVLKKGEEVTTYGGTYTFKNGKQYYKIGNDTKK
FT                   TYVKASNF"
FT   CDS             173088..174203
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00172"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00172"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49619"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T4"
FT                   /protein_id="CBL49619.1"
FT                   /translation="MRHGDRSEKATPIEQNNLLLKGMNKTFDALPTSYKLPDVSFTLLA
FT                   ATFKKETGEDFDISRDLISMGFVTQDNIVTNAGLLLCDQGYLRQSKIVCTRWKGIEKGS
FT                   VDGDALDDEEFTDASLITLLSNAEAFIRTNSKNPWTIRGMRREENSDYPFKAVREVLVN
FT                   ALIHRDYQIQGSEVHVDMFDDRMEIVSPGGMINGSRIQDLNLKHVPSMRRNEIISDIFG
FT                   RLHYMDRRGSGIQRILSAYTDFVEQPIFYSDDTVFLATLPNRGIATPKSPLQSEKSPLQ
FT                   SEKSPLQNKESNIIKKWNEKGINKIFRGQTTKKLLEFYMRYSSKYSFNRNLLANFLEIA
FT                   PNSASKIIQKCREIGIMRMEKRGVYFFTDLG"
FT   CDS             complement(174360..174779)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00173"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00173"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49620"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T5"
FT                   /protein_id="CBL49620.1"
FT                   /translation="MFKLKVDIREFKTGTHVKVFNSKGNNHDLNQKMVDFLDYMNGIIN
FT                   HPEGYIASLQKDVDHYVNSGKWVEDMDKLEYEMNEVAKKATKKAKVEDAKKLVLTIKRM
FT                   DGTKDTVLQELTNNYGDMLSHDKIIKLVHEVYSKQ"
FT   CDS             complement(175321..175812)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00174"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00174"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49621"
FT                   /db_xref="GOA:D5H0T6"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T6"
FT                   /protein_id="CBL49621.1"
FT                   /translation="MTSQKYFEEAWKNRKLVGGALKAAHVRPDYHLYEDLLQEGVILYA
FT                   EMLRKLDGQKTRTEIDKLSFKKLLWHIIDTLRREQRVCERNTAIDKAYDLGEAAAWDNL
FT                   VALKNEAKKLSHLEQVILFEHLLEKKTITQLVEECGVPRITLKRLKKQLLGKLRAVMEQ
FT                   "
FT   CDS             complement(176025..176894)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00175"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00175"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49622"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T7"
FT                   /protein_id="CBL49622.1"
FT                   /translation="MDVSAYKQRNLGIISLPTDIKYRNWSKDLTKWRIENDAQLAQYIT
FT                   YDNKYRLNKNTLAVYEFKQNPILGKYKAVAFDLNRGIVLSQKSTHAMMQGLMRHAVHCD
FT                   MIWQRMLAREAGVDIYQGIVMYNVLYFSMHAFSGNFFTDWICLHWIKDFHVKRHDQAIF
FT                   NSIALDENGLVYNFAFDSPKPNLTKIIGQYLFHNHYYSDLYYQHMLQENNLRVTVINSD
FT                   SILHNSNYYVQLDLYAVDSFKKLADKFYNHVLNLHLLTIVKEFKPLDYLHREHRFFTKQ
FT                   IIKIRYNR"
FT   CDS             177087..177980
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00176"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00176"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49623"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T8"
FT                   /protein_id="CBL49623.1"
FT                   /translation="MKNTHNNRQWFGFSEDKVFGEIMSNPAFCRHVLQGILPEIPIKKI
FT                   FPPKKQEVIIDPEHRDQKDVRLDILVEDINGNLYNIEMQRSDDDDIARRMRYYASKNDQ
FT                   RYTLHQGYTYNDLKNVFIIFLCTFKTKQKVAIKSTYQTINVDNHADILQDGLTKIIINS
FT                   NGVPDGTETETLLNLVKLMKDLPVHGDKLFDKAQKRIESMNADPEWRDTIMDFETRMLE
FT                   REQVGEKKGRMEGEKKGRKEGEKKGLQQGLKTGALTLVASLKDVGCTSQQILQQLKQKY
FT                   GNVFSDKQLEEFLKQS"
FT   CDS             complement(178819..180291)
FT                   /transl_table=11
FT                   /gene="slp2"
FT                   /locus_tag="LCRIS_00177"
FT                   /product="S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00177"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49624"
FT                   /db_xref="GOA:D5H0T9"
FT                   /db_xref="InterPro:IPR004903"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0T9"
FT                   /protein_id="CBL49624.1"
FT                   /translation="MKKNLRIVSAAAAALLAVAPVAASAVSVNAADNTTVNATNSSSDY
FT                   SHINLGGSDVTKYIANVNPSFTLNGALRKNNDNTNANAQAVAAGSLTGSITANVGGVTA
FT                   TANLIHGNHGAANIKVVSATNASTVIYDGTGDHESNPVKNFNAVVSGQKYVITVNSVGF
FT                   NFGANNAGKKVTLALPKTADIKFTVAPNGWSIGNDGKTLTGSLDNNGTVNGIQLTETLT
FT                   AFDAANTNNVVFYNIATGQQVNSGNTMVLADYNGQLNVNSLKSTIESNFKAFQRLTTAS
FT                   NSDQNGQENTNTFDNPPVVTTVDEIKDQLEKAGIKVNAADNFTAPHSFTVTVTAKSNVN
FT                   GKTAQLPVTFTVANVAEPTVASQSKTIMHNAYFYKEDGTTRANNDKAKRYESVTVAMST
FT                   KKIGNKDFYEVIKDGKATGMYINADNIDGTKRTLKHNAYVYKTSKKRANKVVLKKGDTV
FT                   VTYGGTYTFKNGKQYYKINNNTEKTYVKASNF"
FT   CDS             180435..180872
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00178"
FT                   /product="Transposase DNA-binding domain family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00178"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49625"
FT                   /db_xref="GOA:D5H0U0"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U0"
FT                   /protein_id="CBL49625.1"
FT                   /translation="MRTGDTPEARILCTRFLPSDERVVFVRCVIFGMKKELRSRNLLKN
FT                   HALSQAISDVGWRSFLNMLAYKADLYGKEFLTIDPNYTTQRCHQCGSIMGQNGYKKLTL
FT                   KDREWTCPICRTHHIRDWNAAVNILEKGLGKWQNPKIKKAA"
FT   CDS             181240..181395
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00179"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00179"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49626"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U1"
FT                   /protein_id="CBL49626.1"
FT                   /translation="MSHAKLDKTGECESRVIAWSIAISITLGAVGKFVINLAKAYAIIK
FT                   KANHKG"
FT   CDS             181997..182617
FT                   /transl_table=11
FT                   /gene="cadD"
FT                   /locus_tag="LCRIS_00180"
FT                   /product="Cadmium resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49627"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U2"
FT                   /protein_id="CBL49627.1"
FT                   /translation="MGQTIISAIGVYISTSIDYLIVLIILFAQLSQNKQKWHIYAGQYL
FT                   GTGLLVGVSLVAAYVVNFVPEAWMVGLLGLIPIYLGIRFAIVGEGEEEEEEETIERLEQ
FT                   SKANQLFWTVTLLTIASGGDNLGIYIPYFASLDWAQTLVALLVFAIGVIIFCKLSQVLS
FT                   SIPLISETIEKYTRIIVPLVFIPLGLYIMYESGTIETFLNFIL"
FT   CDS             182799..182990
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00181"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49628"
FT                   /db_xref="GOA:D5H0U3"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U3"
FT                   /protein_id="CBL49628.1"
FT                   /translation="MVGLIQKHGEDILDRPQQKYTADFKLAAIDRVLLGGEALRQVSLD
FT                   LGLAKTVRLFIEIIKFVL"
FT   CDS             complement(183149..183307)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00182"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00182"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49629"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U4"
FT                   /protein_id="CBL49629.1"
FT                   /translation="MLFSTVELRHAQIILTYNSIDHPETTYFGFSVSWQERNKDGHQEH
FT                   SDHFIAY"
FT   CDS             183481..184707
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00183"
FT                   /product="N-acetylmuramidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00183"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49630"
FT                   /db_xref="GOA:D5H0U5"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U5"
FT                   /protein_id="CBL49630.1"
FT                   /translation="MKKRLLTSFAAAAMLTSVAVPAVNTTMMNQASSQRVSAATADQTA
FT                   FLNKAAKQAVKAAKKYGTLPSVMIAQAITESGWGKSGLAVNANNLFGMKADDSWTGETY
FT                   TAKTREEDKNGKSYYITAKFRKYPSFEQSFEDNGSKLRNGVSWDPLRYKGTWIENASTY
FT                   ASATKALTGTYATDSKYDRALNSHITSLNLTKYDPVTINTTRTYTAGKDSSTYNWPTAP
FT                   SVASAIGSVKAGEKVVVTKTITFHDGSSRMYIDGRGWVNGSVLDKSSSATKEPVTQAPK
FT                   NVKPVSKNLMHNAYVYDQNGKKLKGKMFKTSDENGGKWINTYGTKTIKGKTYYRVGENE
FT                   YIAAGNIDGSLRFLKKNAYVYNQYGNRDNNLKHKKNSQIATYGSAITINGKKYYKVGIR
FT                   QYVKKSNFM"
FT   CDS             184727..185815
FT                   /transl_table=11
FT                   /gene="cwlA"
FT                   /locus_tag="LCRIS_00184"
FT                   /product="Autolysin, amidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00184"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49631"
FT                   /db_xref="GOA:D5H0U6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U6"
FT                   /protein_id="CBL49631.1"
FT                   /translation="MKVRKFLIALIAFFGVIGVMSTNQVDAASINSLAKKYQYSGVTYL
FT                   YKMLKLEGIKYNEFPGVEYQNGKPEGIVVHETDDPGATAHDEAIYFNREWNKINAYVNA
FT                   FVDSKQIIQMCSPNVGTWGAGQQANNRFIQIELCEESSRDAFAKSVNNDAIYIAKLLHR
FT                   YDLKPDNACDDGDGTIWSHKAVSTFLGGTDHVDPDGYFAKWGYDMDQFYSLIKYYYDLQ
FT                   KKNENTNSKDPNKIKDEVSAEVQGAVTLGHDAYVYDKNGKKTKTLKLAGSPVTVLGYKL
FT                   INNKKYYQIGKNQYVVATNIDATVRTAKKNTYLRTRLGRIQKDNLVRKGSRVMTYGSKI
FT                   TINNQKYYALNATQYVLASDIR"
FT   CDS             185904..187742
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00185"
FT                   /product="Na /H antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00185"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49632"
FT                   /db_xref="GOA:D5H0U7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U7"
FT                   /protein_id="CBL49632.1"
FT                   /translation="MAQLSLFLVVLLALVIPIFMARFKISTVPTAIAEIIVGIIVGSSG
FT                   FNIVVSTHDLTFLSNLGVTLLMFLSGMEINFDLLQRKNNPKAKSQAGKTVDPLPTALTA
FT                   FAGIVIMAFILAYVLKLISLFSNIVLAAIIFMTVALGVVIATLKEKDILGRPIGQTILL
FT                   TAVLGEVIPLLLLTIYASVNGGNAEQLWLIILLFVAAIFLLRRFKQPYLWFSKVTKATT
FT                   QLDIRLAFFLIFALVTVAERVGAENILGAFLAGMVMKLLEPSEATKDKLTSIGYGFFIP
FT                   IFFIMTGVGLNLKSLFAHPSSLMLLPVLVIFLFLAKAPVVLIYMRYFEKKNAFAGGFLT
FT                   ATTITIVLPTLQVARKLHAITSTQSDVFILAAVIVCIVSPIVFNSNFVLSPEDRIKETV
FT                   TIVGANAFTVPVAHDLHDNWYSIKMFTDQKDQYETYDSRVKGLTLLNNLDNQSLERSGA
FT                   FDCDIFVAAGHHDQENARMAEYAKDLGVKRAIARMNEVDSDTLSHCQEAGVEVFNFTNV
FT                   RSALMRALIESPTVYKIMTDTNNVLYSVKVKNTRYTGRPLSDLEFVDKITVSRIRRGNE
FT                   WLIPHGWTVIEPNDILIFSGAFKDADQVKKLLSHQN"
FT   CDS             complement(187787..188434)
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="LCRIS_00186"
FT                   /product="Pyrrolidone-carboxylate peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00186"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49633"
FT                   /db_xref="GOA:D5H0U8"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U8"
FT                   /protein_id="CBL49633.1"
FT                   /translation="MKILVTGFDPFGSDKINPAIEAVKKLPDTIKGAKIIKLEIPTVFN
FT                   KSAQVVHQAIVKEQPDYVLNVGQAGGRSALTPERVAININDGRIPDNDDYQPLDEPIQP
FT                   DGDTAYFTQLPIKAMAKAIRAAGLPAIVSNTAGTYVCNHIFYQVQYMRTKEFPKLKAGF
FT                   IHIPFLPEQVITRPNQPSMALADIVKGLTAAIGAIVERDGQSDIKAVEGQNH"
FT   CDS             complement(188468..189433)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00187"
FT                   /product="Oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00187"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49634"
FT                   /db_xref="GOA:D5H0U9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0U9"
FT                   /protein_id="CBL49634.1"
FT                   /translation="MKLGIIGSGMIVHDFLTTADQIKNMTITAISSTKRSEKIAQDLAQ
FT                   QYHIARTYTDNDELLADPGVDTVYVAVPNFLHYEVAKAALEHGKNVICEKPFVQSTAEA
FT                   EELKKLADEKDLIIAEAITNLYLENFKQIKAEIAKIAPIHIINLNYTQYSSRYDAFLTG
FT                   KIAPVFDPKKDGGALMDLNIYNIHLVAALFGLPDQVQYYANMQKGVDTSGILHLSYPDK
FT                   QASLTAAKDSYVTPRSFIEGEKGSIYFDGSTGTLDNFTVEMRNEKPKRYSLNKYPHRMA
FT                   AEFNAFAQMINQHDTQKADLAFVNTLETMQILTKARNSMI"
FT   CDS             complement(189441..190247)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00188"
FT                   /product="DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00188"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49635"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V0"
FT                   /protein_id="CBL49635.1"
FT                   /translation="MKLKKTIIGLSFAALFLLGGCSKQEKKAAPALTKTQVVQKMKKGF
FT                   QSGQVIQSVTLGTDTSSQVALANTTFGGKNTVYHITNQTTNKGKTSSNEEWVNLNNVYI
FT                   NGQSTWYKADLEKLTGHNYAELTDAIMNNHMITNPSDQLVSAYKMKKSKKDGVYTYTLT
FT                   AKSTDQALMKKAAAPIFNTTAQSTNQAKVFKQIQKLGKYQSMNVKAVVKDDKLSTFNVF
FT                   VNLKLGKLMHVKVGQSYGNFGSHDFLKVPTSATNAKDLPTTNTKKK"
FT   CDS             complement(190332..191087)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00189"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00189"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49636"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V1"
FT                   /protein_id="CBL49636.1"
FT                   /translation="MKFKHQNIIITVLLALLFLTACSKTDSNKTANLPTAKTILTKAEK
FT                   DNFNSMHASWNESANQKTQQKAEAQYTKKPTVIYANVSSNSNHYQMWIEGKNNYIKMKG
FT                   TNSQHWFKTKLSKTSAYGAITDSLNGSLLMPFIPTAKSFKVKQNGKDYLLIYKGNNKKI
FT                   WNAIISDSAFTALIGIDLDNVKPIKNDIQINVDQNYHIKKVNIDSTYKDDGQKKNFTMQ
FT                   IDQINQVKKLTVPASVKKSAVDLGKLNTK"
FT   CDS             191243..191935
FT                   /transl_table=11
FT                   /gene="gpmA1"
FT                   /locus_tag="LCRIS_00190"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49637"
FT                   /db_xref="GOA:D5H0V2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V2"
FT                   /protein_id="CBL49637.1"
FT                   /translation="MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKE
FT                   HGLEFDQAYTSLLTRAIKTLHFALEESGQLWIPETKTWRLNERHYGALQGLNKKATAEK
FT                   YGDEQVHIWRRSYDVLPPAIDDDNEFSQAHDRRYANLDPHIVPKAENLHVCLDRVMPFW
FT                   EDHIAPDLLDGKNVIIAAHGNSLRALTKYIENISDEDIMNLEMKTGEPVVYTFDENLDV
FT                   VNKEKLDD"
FT   CDS             192213..192773
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00191"
FT                   /product="Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00191"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49638"
FT                   /db_xref="GOA:D5H0V3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V3"
FT                   /protein_id="CBL49638.1"
FT                   /translation="MQTIDNSLFQVSVDENGARMAHLVSLTDQFDYLGEQESEEGMALA
FT                   FPVMDQADNLANKLPWTVVDKGDTRVSLTLIDTPESYKSFPYHFEVMTTYALEGNQVNI
FT                   SFYLKNSSNKELPFSLGFILPTSWQSESQVNKISLTGKEHGIDLTSTDFKLSAKEGSVT
FT                   AFTDKIELEAKSSHNFALSLTLK"
FT   CDS             192879..193979
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00192"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00192"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49639"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V4"
FT                   /protein_id="CBL49639.1"
FT                   /translation="MKDRKQRSNHPHNSRVDTHSYKNRHIWVWVISIVALLAVAGAAYF
FT                   ASVYFRTKSAVDKTYDPKTAVKTTGEFDGKKKFAVLLMGTDTGALDRTEKRGRTDTMIL
FT                   AVVNPAKKRYTLVSTPRDTMAQMVGSESFKTEKINAAYELGGAKMSMDSVSKLINVPIK
FT                   YYAVVNMGGIMKMIRYVGGINIRPTLSFEYGGYIFKKGKLTHMGGAGALAYSRMRYDDP
FT                   RGDYGRQERQRQVITTLIKKAVSISSLSNLDSILTSVSSNVRTNLPFSAMQQIAMNYRS
FT                   CANSSSSDYLHGYNAMIDDAAYQVQPTSELQRISNLVRKELGLPKETISNNETFQNEKN
FT                   IANGFSFKSEKTQHYHIYDYTEEGDN"
FT   CDS             193979..194593
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00193"
FT                   /product="Acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00193"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49640"
FT                   /db_xref="GOA:D5H0V5"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V5"
FT                   /protein_id="CBL49640.1"
FT                   /translation="MARIWATLIGYVFGNFLTAMIVGKIFLKINPTEYGSHNPGTANMG
FT                   AVFGKKWGILTCLGDLLKSLIALFIVYFAFPAHINIAYTGLGLILGHCFPIWDHFRGGK
FT                   GVAVAAQVAVFYNWKVGFATLLVALVLTAIMQNLTIPPLVFMLLFSINTFLHNQEAGFV
FT                   FIVITLIMCFKFWHDIVDFFTGHGKKVDILLSIKKKLGIIK"
FT   CDS             194631..197621
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00194"
FT                   /product="Glucan modifying protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00194"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49641"
FT                   /db_xref="GOA:D5H0V6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V6"
FT                   /protein_id="CBL49641.1"
FT                   /translation="MSEINKKKSLNALQIICLIVAAFFMLVQMYSWGSTFGRLPLSTLM
FT                   RFIPGLLGHSTMVLVPMVFGAVYSKRKVHPTEAFKFWIIAVVTLVLLYLVNFFKRPGTF
FT                   NMWKLWGVFFPVLTSTSVLLAGLIFSMLVQPYLYELQHRITTKQNVLLLSALTLTGFAT
FT                   SAGTMIFNKSIYGIYLILYFAWGMFLANVKIPKKVFGWSIAAGVMSFFVMFIGVPGFNG
FT                   VYWYQRLSGRSGVYSWNPKFLSNIASPFLFLMVLAAFLIFRKVIVSYSAKQMHFFIPVI
FT                   IFMDAPIIGGFVKSFRFTNSAGFNKFLMIVIMMLAAWGLSWLYERYLFKVKPVKRTVAF
FT                   FKQHNNLAEIVEDAWTNFTAWIVENRVRLLTWGWFYVLSFASFLIESDNLRIQITTATD
FT                   INAVIFLLGTRFFAIILTAIFLDAMFAIFYFITTRYWTSTVLVTVITIGWAIANKIKLD
FT                   LRGEPIYPTELDEIVNWKTLMPMVGQQKIIMIAIALVIIIALTVFLEIKFPIKKKGSWK
FT                   RRGIWALLSLLLFMTPVRFNHDGGIIYHINRGFDNKQSFRNPERDIQINGPLLNFLNYF
FT                   DLQIMNKPTNYSKSTIQHLNEKYSKIANEINKTRKNTLKNQTIVYNLSESFVDPYTFPT
FT                   IKIDPKTPNPVKFIQSMKKRATYGSMLSAGYGGGTANMEWETLTGFNMGMFKSTLTPYV
FT                   QIVPNYDFYPTIGMDFNYKSAVHPFIGTYYSRVEDYKRFKFNKFVYLGSKYKIIDQKKL
FT                   GKSTYNSDFTAYANGLRQINSMKGGQFINLISIQNHMPYNNWYPNNEYMGKVSGELFNT
FT                   AAVREQMATYIKGTQYTDQAVKKFIGQIDKIKKPITIVFYGDHYPSILSQNYTGKYPVQ
FT                   MHSTRYFIYSNKYARQHGAKNKLTHNTNFVNTSDFTAMMLEQTNTKVTPYQALLTEVHE
FT                   KLPAITINFNGDKGFQLVDQKGHFVDPKKLTSEQQAILNDYEMVQYDMTAGQAYGLKAK
FT                   GFYKIGD"
FT   CDS             197723..199117
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00195"
FT                   /product="Fibronectin domain"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00195"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49642"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V7"
FT                   /protein_id="CBL49642.1"
FT                   /translation="MKKIITMALAGAALFGSSATTVQAGTYNPKNTTSFNINRRNYVAK
FT                   GKIYKLHLPAAGRLVTNGNVTLKNSMEWTCIPYGKDKNTYYLRKGTYYLTSSKNISVKT
FT                   TYTRLTKIRKNLETYVETKKNNDNSSLKARKIEIGQDIKAMGEMYDYDSVDYYTFTIDS
FT                   PQMVTMRMINNPIYQLGKGNIFSKMNVIMFSENNPVGGSTMLYPESFEINGNKIASQSW
FT                   YLSKGNYTFSVNTRGLYNFQLTAVPDTRVVPADTEIESLQNTKDGVVANLRDARHAKTY
FT                   ELAWREKGSKAAPFTSSSNTTEVSTAPATRYIDKNDRKIPVSIGKKLVNGQSYYFVARG
FT                   VSNPDYIRYGNPEKDNYFGAWSNPVEHTCYAPSDATPGAVDLTTAKADSTYHNIHVAWN
FT                   KIASAQSYRIAYRQKGTNKWYYEVTDQATNAITGITRNRNYEVKLQALNGEKTGPWSAI
FT                   KTIFVK"
FT   CDS             199371..200633
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="LCRIS_00196"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00196"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49643"
FT                   /db_xref="GOA:D5H0V8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V8"
FT                   /protein_id="CBL49643.1"
FT                   /translation="MAKFDILEDLKWRGAINQETDEEGLRKYLAEHDDLALYCGTDPTG
FT                   DSLHIGHLIPFMILKRFQMAGYHPVILIGGGTGAIGDPSGRKTERTLQTAEQVKHNEES
FT                   LTNQMKKLFGTENFEIRNNAEWLSKLNLIDFLRDYGKFFQVNNMINKDVVASRLENGIS
FT                   FTEFTYQILQAIDFYHLNKDDGVQLQIGGSDQWGNITAGIDLIHKLEGADRPAFGLTIP
FT                   LMLKADGTKFGKSAGGAVWLDPEKTSPYEFYQFWINQDDRDVVKYLKYFTFLSREEIED
FT                   LAEKTEKEPWKRAAQKKLAEEVTKFVHGEAGLEEAKMITDALFSGNIKNLSVAQIEQGL
FT                   KNAPSAEAGNEKKNIVDFLVDTKIEPSKRQAREDVKNGAIYVNGDREQSTDFEVDPSSD
FT                   FDGKYVIIRKGKRKYTLVTIK"
FT   CDS             201059..201415
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00197"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00197"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49644"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0V9"
FT                   /protein_id="CBL49644.1"
FT                   /translation="MLESKKAIKIISSLVIGLSLGCVLTPIAQATSFTAPKLGTATQAP
FT                   TNPAIKKGDKIFVVIKDTKNQKVAVYNKNAEKTSKKVAMGSTYTVKDVKKVNKKKIVRI
FT                   NKSQWLNIKDVVKN"
FT   tRNA            201534..201606
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="LCRIS_02041"
FT                   /product="transfer RNA-Thr"
FT   CDS             201641..202954
FT                   /transl_table=11
FT                   /gene="pepC1"
FT                   /locus_tag="LCRIS_00198"
FT                   /product="Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00198"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49645"
FT                   /db_xref="GOA:D5H0W0"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W0"
FT                   /protein_id="CBL49645.1"
FT                   /translation="MKHELTMNEIAKFQKEYEQKPQNRVAELAVVNNGVAKASLDSEKV
FT                   RKLNRTFSIEIPTDNVTDQKQSGRCWLFAALNTLRHGFAKKYNAKNFTFSQNYLFFWDR
FT                   IERANIFFDNILNTADRPLSDRTVHTYMQGPDTDGGQWAMAVSLIRKYGLVPTYAQDES
FT                   FTANNTAFFNRILNNKLREDGLVLRKLAQAGKNDEIEAKRQEFLSEVYRMAVIAFGQPV
FT                   QKFDLEFKDDEGKYHFDGDLTPLDFFHDYFTDDLDDYIVLFNAPDHEFDKLYALPFEDN
FT                   VEGGSPVHFLNTKIENLKEAAIKQLEAGETFWFGCDVGKDSDRQKGILAHNLYQTDTIF
FT                   NIETKLSKKERLETGASGSTHAMTMVGVDVVNGKPRQWKIENSWGSKVGEKGYFVMDDN
FT                   WFDEYLFKVVVKKQYVPEKLVKIWEGKATPVEAWDSMA"
FT   CDS             202954..203607
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00199"
FT                   /product="HD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00199"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49646"
FT                   /db_xref="GOA:D5H0W1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W1"
FT                   /protein_id="CBL49646.1"
FT                   /translation="MEIKQVIDFTQTHLKNEKTGHDFYHGERVANLASQMYLADHADAH
FT                   EDSRVVAIIKTAGYLHDTIDEKICADPQKVIDEIEELLPQVGFNELEAWDILFTIQHMS
FT                   FSANIEHHYHLPLSGQYVQDADRLESLGAIGIARAFTYGGKHGNKIYDPEIKPAVLTSH
FT                   DQYRNHVETTINHFYEKLFHLEDLMNTPAAKKEAERRTAYMRDFVREFMQEWNV"
FT   CDS             203775..205394
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00200"
FT                   /product="Oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49647"
FT                   /db_xref="GOA:D5H0W2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W2"
FT                   /protein_id="CBL49647.1"
FT                   /translation="MKFTKLFAAGATVLIAGSTLAACGSNSNSSSSSAKKTINWMDSAE
FT                   IPTMDISKATDVTSFNQLGNVEEGLYRLGKNSKVENALATDTKVSKDGKTWTFTLRNSK
FT                   WSNGDKLTAKDFVYSWRRTVNPKTASQYAYLFEGIHNATQISAGKAPVNSLGVKAEGDN
FT                   KLVVTLDKRIPYFKLLMGFPLFFPQNQKVVEANGSKYGTSSKTTAFNGPFVQKGWTGSN
FT                   LSWKLVKNKNYWDKKNVKLDAINYSVQKTPSTAYNLYQSNKLDATILDSQQTKNLKHQK
FT                   GYTLRDTAATFYLQFNQKKKIFQNADLRRAISMSINRKALGSALGGANTPATSLTSKGV
FT                   VNHDGKDWSEVVGDKKNAAYNPTEAKKLYKKALKELGVKNVSFTILSDDTDSGQKTTET
FT                   LQSQLEENLKGMKVSVANVPFKTRLNRSTSGNFDVVVSGWSADFADPISFVDLFTSKNA
FT                   QNNGKWSNSQYDKLIADSKTTADTTKRWDDLEKAEKILLSDEGIAPLYYKTEAWLVRPD
FT                   IKGIVYNGAGLNYNFKNTYVAN"
FT   CDS             205583..207211
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00201"
FT                   /product="Oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49648"
FT                   /db_xref="GOA:D5H0W3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W3"
FT                   /protein_id="CBL49648.1"
FT                   /translation="MKKWKKYFSASLLTVVSAATLAACSNKSSSSGTKQTLNWMTKSEL
FT                   QTLDLSKVTDATSLDQINNSMEGLYRLGKNSKVENALATKTEVSKDGKVWHFTLRKNAK
FT                   WSNGDPVTAKDFVYSWRRTVDPKTASQYAYLFSGVKNADDVVAGKKKVETLGVKADDNQ
FT                   HLTVTLDRRIPYFKLLMGFGVFFPQNEHAVEKYGKNYGTSSKTMVYNGPFVSKGWTGSN
FT                   LSWKLVKNKDYWDKSKVKLSKINYSVQKTPSTDYNLYQSGKLDVALLAPQATKQLKNQS
FT                   GYTIRPASSTQYLQLNEKNKLFQNTDFRRALSLSVNRKALASAVGGANKPVVTFSPNSM
FT                   TEVNGKDYTALVRTAETDKLMTYNPTLAKSYWKKAQKALGQSKVNFTLLTYDDDDAKKA
FT                   GEYLQSTIESNLKGVNVRVNSLPKKTALVRGQNGNFDALLMGWQADFTDPISFLDLNTS
FT                   NASYNWGKWANKEYDKYVAASKTTGNENTRFEDLAKAERVLLTEQGVVPLYQPAEAWMV
FT                   RPTVKGVVYNGAGANYNFKYAYVEK"
FT   CDS             207384..208526
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="LCRIS_00202"
FT                   /product="Inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00202"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49649"
FT                   /db_xref="GOA:D5H0W4"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W4"
FT                   /protein_id="CBL49649.1"
FT                   /translation="MSNWDTKFAKKGLTFDDVLLIPAESHVLPNEVDLSTTLADNIKLN
FT                   IPLISAGMDTVTEGAMAIAMALQGGLGVVHKNMSIQAQAGEVANVKSVVVPTSAAKAAT
FT                   DDQNHLLCAAAVGVTSDTFERAEALLEAGADAIVIDTAHGHSAGVLRKIKEIRDHFPEA
FT                   TLIAGNVATGDATRALFDAGVDVVKVGIGPGSICTTRVVAGVGVPQITAIYDAATAARE
FT                   YHKPIIADGGIKYSGDVVKALAAGGNAVMLGSMLSGTTEAPGEIFEDNGKKYKRYRGMG
FT                   SVGAMAQAHGSSDRYFQGGVNEANKLVPEGVEARVEYKGDVSDVVFQIDGGLRSGMGYC
FT                   GAANIPELIDKAQFVQITNAGLRESHPHDVQMTKAAPNYK"
FT   CDS             208695..209624
FT                   /transl_table=11
FT                   /gene="oppB1"
FT                   /locus_tag="LCRIS_00203"
FT                   /product="Oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00203"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49650"
FT                   /db_xref="GOA:D5H0W5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W5"
FT                   /protein_id="CBL49650.1"
FT                   /translation="MARYLLKRIFYMILTLLIVATVTFFLMKLMPGSPYANEAKMTLTQ
FT                   RQIMDQQYGLNKPIWQQYLIYIAGMLHGDFGTSFQYSNQPVASLIGARLGASVQLGLQA
FT                   LILGVVLGVIAGAIAAMRQGTWVDSTATVISILGKSVPNFVLAVLLQYYIGLKLGWFPI
FT                   AGWGQFSQTIMPTIALAVGPFAETARFIRTSMVDTLSSDYIELGKAKGLSRMEVIRKHA
FT                   MRNSMIPLVTLIGPYAVALMTGSMVIENIFNVPGIGEQFVKSILTNDYPTIMGITMVYC
FT                   IGLVVILLITDIVYGLIDPRIRLDESEA"
FT   CDS             209633..210664
FT                   /transl_table=11
FT                   /gene="oppC1"
FT                   /locus_tag="LCRIS_00204"
FT                   /product="Oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00204"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49651"
FT                   /db_xref="GOA:D5H0W6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W6"
FT                   /protein_id="CBL49651.1"
FT                   /translation="MTEEKLNLPADAFEPLPKDEAQDNENIAGPSLSFAQNVWLRFKQR
FT                   KAAIISAIIVILMIVVAFGSTPFINKSTLVKSHPQYANLPAKVPGMSAINGLNGKIKQN
FT                   GKWVDAYAQNGVPKDKYFIAGTDYLGRSLGQRIIYGTKISLIVALVAAFFDLTIGVAYG
FT                   IVSGWKGGGVDNVMQRIIEIISSVPNLIIVVLMLVVLKPGIKSIILAIAISSWTTMARQ
FT                   VRAETLSLKNEEYVLAARSLGESPWKIAWKHLVPNLSSIIIIQTMYTIPTAIFFEAFLS
FT                   FIGIGISAPETSLGVLLNEGQKNFQFLPYQMWYPAIVLCVLMIAFNLLGDGLRDAFDPR
FT                   GQR"
FT   CDS             210680..211738
FT                   /transl_table=11
FT                   /gene="oppD1"
FT                   /locus_tag="LCRIS_00205"
FT                   /product="Oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00205"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49652"
FT                   /db_xref="GOA:D5H0W7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W7"
FT                   /protein_id="CBL49652.1"
FT                   /translation="MPEERVLDVKNLKIDFHTYAGEVKAIRNVSFHLNKGETLAIVGES
FT                   GSGKSVTTRSIIGLLARNAQIEGGEIDFHGKNLLELSEKEMQKIRGNEISMIFQDPMTS
FT                   LDPTMKIGQQIAEPLIKHKGASKKEAWAKALEMMKAVGIPNAEERINQYPHQFSGGMRQ
FT                   RIVIAIALICEPEILLADEPTTALDVTVQAEILDLMKDLQKRVKTSIIFITHDLGVVAG
FT                   MADRVAVMYAGEFLEFGGVDEIFYDPQHPYTWGLINSMPTLNSDTLESIPGTPPNLLDP
FT                   PKDDPFAPRNKYAMKIDVERKPPFFKVTDTHYAATWLLAPGAPKVEPPAEITRRWKKYN
FT                   LMKQEDKLPEVN"
FT   CDS             211759..212703
FT                   /transl_table=11
FT                   /gene="oppF1"
FT                   /locus_tag="LCRIS_00206"
FT                   /product="Oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00206"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49653"
FT                   /db_xref="GOA:D5H0W8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W8"
FT                   /protein_id="CBL49653.1"
FT                   /translation="MPEKKKILEVKHLKQYFKNGRNVTKAVDDVSFNIYEGETFGLVGE
FT                   SGSGKTTTGRSILQLYKPTSGEVIFEGKNVADLKSRADKLAFTRDAQMIFQDPYASLNP
FT                   RMTVEDIIAEGLDIHHLVKNKDERTERVEELLETVGLNASHASRFPHEFSGGQRQRIGI
FT                   ARALAVEPKFIVADEPISALDVSIQAQVVNLMIELQKKRGLTYLFIAHDLSMVKFISDR
FT                   IGVMHYGKLLEVGPADDVYDRPLHDYTKSLISAVPIPDPEVERSRTRIPYDAQKEEMDG
FT                   KQRSMHEIRPGHFVRCSDDEVKHYEEVAASYEN"
FT   CDS             complement(212799..214115)
FT                   /transl_table=11
FT                   /gene="pepC2"
FT                   /locus_tag="LCRIS_00207"
FT                   /product="Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00207"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49654"
FT                   /db_xref="GOA:D5H0W9"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0W9"
FT                   /protein_id="CBL49654.1"
FT                   /translation="MAHELTVQELEKFSAEFNKKPENKVVARAAQRSGVLEASYNDRVQ
FT                   GQLTRVFSTELDTNNVTNQKHSGRCWLFATLNVLRHAFGKKYKAKDFTFSQAYNFFWDK
FT                   IERANMFYNRILDSADMPLDSRQVKADLDFAGSDGGQFQMAAALVEKYGVVPSYAMPET
FT                   FNTNDTTGFATALGDKLKKDALVLRHLKQYGKDDEIKKVREKFLSEVYQMTAIAVGEPP
FT                   KTFDLEYRDDDKKYHLEKNLTPLEFLHKYMGDVDFDDYVVLTNAPDHDYNKLYGLPAED
FT                   NIEGSLRIKLLNVPMEYLSSAAIAQLKDGEAVWFGNDVLRQMDRKTGYLDTNLYKLDDL
FT                   FGVDLKMSKADRLKTGVGQVSHAMTLVGVDEDNGEVRQWKVENSWGDKSGVKGFYVMNN
FT                   EWFKDYVYEVVVHKKYLTENQKKLAEGPITDLPAWDSLA"
FT   CDS             complement(214257..214682)
FT                   /transl_table=11
FT                   /gene="hsp"
FT                   /locus_tag="LCRIS_00208"
FT                   /product="Heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00208"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49655"
FT                   /db_xref="GOA:D5H0X0"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X0"
FT                   /protein_id="CBL49655.1"
FT                   /translation="MANNMMNRRNDMMDAMNDWFGFPRNFFDDNEIENIMQSDVAETDK
FT                   DYLVKIDMPGMDKQDINVNYNDGTLNVSGTRKSFKDTSDKNRNIIHKERSEGSISRSYR
FT                   LANVVASEIHAKYDNGVLTITLPKETAGDDGNSIKID"
FT   CDS             214924..215385
FT                   /transl_table=11
FT                   /gene="greA1"
FT                   /locus_tag="LCRIS_00209"
FT                   /product="Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00209"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49656"
FT                   /db_xref="GOA:D5H0X1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X1"
FT                   /protein_id="CBL49656.1"
FT                   /translation="MVYFQKMTPEGYQQIEDEIARLKKDRPRRIKILQAARALGDLSEN
FT                   TEYTEAKRDLGHLQSRLRYLGKQLKYAEIVKAEDDGKVDLGKTVVLKFDDDDETEEYKV
FT                   VGRMEADLAAGKVSFDSPLGQAIMKKEAGTTATVAAPAGEYQVTIVEVK"
FT   CDS             215465..216127
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00210"
FT                   /product="Abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49657"
FT                   /db_xref="GOA:D5H0X2"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X2"
FT                   /protein_id="CBL49657.1"
FT                   /translation="MNTPQSREGNVIRYAVYLAGYVAVFAVVKLVTRKSPVHIWDLILF
FT                   GLVAAMILLFYVYRFNREQRFFARDFKLPWLGSLSTVVLLTLVITVTQISISYLQSYGR
FT                   ISHYDFQLIYAKSESVNMFWFLIVVQGIVLPILQEFLATGFLFNYAFRRNTKQVAIMGI
FT                   IVSGLIYSLLNFQNSVVLFIIDAIYGMVFAWSYMYTQTLLMPIYLAVVSGVLTVIMI"
FT   tRNA            complement(216175..216245)
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="LCRIS_02098"
FT                   /product="transfer RNA-Gly"
FT   CDS             complement(216255..216848)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00211"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00211"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49658"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X3"
FT                   /protein_id="CBL49658.1"
FT                   /translation="MCNQFRLPNLKQIQQYLKSDLDLPLVTPNFDIQAQDIFPNQVAPV
FT                   LLYQNGQLQLSNKKWGYPSPVDPKKPLFNARIERFYDSAPSMWDKSFAKQRCLILTEKF
FT                   FEYAKTTHIAENGRKYHDRYAFRTNQPLTLIAGIYDQDYFSMVTTAPNKDIAPIHNRMP
FT                   LVVMPNELRRWLFQNFTSLIDRKSVDLQIEKMLK"
FT   CDS             216966..217988
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="LCRIS_00212"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00212"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49659"
FT                   /db_xref="GOA:D5H0X4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X4"
FT                   /protein_id="CBL49659.1"
FT                   /translation="MAKEILLTGDRPTGKLHIGHYIGSLKNRVKLQNSGKYDPYIMIAD
FT                   TQALTDNARNPEKIRNSLIQVALDYLAVGIDPAKSTIYVQSQIPALFELTAYYMDLVTV
FT                   ARLERNPTVKTEIKQKDFKDSIPIGFLNYPVSQAADITAFKATVIPVGDDQEPMLEQTR
FT                   EIVRTFNRVYNCDVLVEPKGYFPPKGQGRLPGLDGNAKMSKSLGNAIYLADDAKTVQKK
FT                   VMSMYTDPNHIHVEDPGKVEGNTVFTYLDVFDPDKDKVAELKAEYQKGGLGDVKIKRYL
FT                   NKVLEAELAPIRERREKFAQDEDAVYEMLLEGSKKANKVANATLEQVRDAIGLNYFKNR
FT                   "
FT   CDS             218004..218483
FT                   /transl_table=11
FT                   /gene="comEB"
FT                   /locus_tag="LCRIS_00213"
FT                   /product="dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00213"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49660"
FT                   /db_xref="GOA:D5H0X5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X5"
FT                   /protein_id="CBL49660.1"
FT                   /translation="MHDRIPWKQYFMMQALVIAQRSTCNRALVGSVLVKNNRIIGTGYN
FT                   GSVSGQPHCDDVGHQMVDGHCVRTIHSEMNAIIQCAKFGVSTENTEIYVTHFPCYNCCK
FT                   SLLQAGVKKINYYFDYRDNPLAMQLLHDSEVPYEQIKINRKYVESLAHKLEEDEN"
FT   CDS             218497..219081
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00214"
FT                   /product="Beta-propeller domain of methanol dehydrogenase
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00214"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49661"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X6"
FT                   /protein_id="CBL49661.1"
FT                   /translation="MGLVTVFLITTGFVQPNIEDHAHILDKETRTLVTEKNNRYFQTKE
FT                   QPQIVVITVKRLNKLTPKMLDHSKRTVFIMVGQKGKKRNVQIYSTKDLHSAFTEVARGN
FT                   ILRAEVDKLRSQNNATFNKGIRFVFRACATRVDQQYQYALDKYDLTQAEQNKVARPHSV
FT                   ALPIALALAFLITGITYFLRRFSHRDPISKK"
FT   CDS             219380..222046
FT                   /transl_table=11
FT                   /gene="mgtA"
FT                   /locus_tag="LCRIS_00215"
FT                   /product="Magnesium-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00215"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49662"
FT                   /db_xref="GOA:D5H0X7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X7"
FT                   /protein_id="CBL49662.1"
FT                   /translation="MLKAASKKRSNIDIQSIQRIARESRSETLARLQASAEGLSTNKAE
FT                   ENRREYGKNEIITNTNASKWRLLWESVATPFTVVLLVLTLLTLFTSYILIPQGNSDSIT
FT                   IIVMVIMLIVSVLVNFIQKIKIARVTDQLLNRVSVTTNIRRDGHNVELPTDEVVIGDVI
FT                   NLSAGDMIPADMKLLTSKDLFCSSSYLDGDPEPAEKVANVIIKPSMSNDYLNYPNILYE
FT                   GTTIVSGSGTGIVFAIGNHTVFGKEVQAISRKKVKTTLFDREMKQLAKILIVATAIIIP
FT                   LLFVINGLTKGDWGESLIFALAAAVGLTPEVLPIIVNSNLTKGALEMSKSGAVVKQMNA
FT                   IQNLGSTDVFCIDKTGTLTQNQVVLERHYDLDMQETPQILKFSYLNAYYQTGVKDLIDK
FT                   AVIDAAGDELDVNEIQRDYNKIDEIPFDYTRKRMSVVVVDNDEHHGQHLLVTKGAAEGM
FT                   LAISNKVELNGKVEDLTSEWKERILNQINELNDDGLRVLLVGYKLNPAPVGEFSAKDEH
FT                   DLTIIGYLAYLDPPKETTKEALEDLKNDNVDVKIFTGDNEAVTRAIALQVGLNVDTVYD
FT                   GKQIDEASPEELKEIVEKCDIFVYLTPELRVKIINALKTNGHTVGYMGDGNKDALAMKV
FT                   ADVTVTSNSSVDITKESADIVFEQKDLQLLEEMIMVGRKVFSNTMKYIKTFLVTNMGSI
FT                   IAMAVSSLLLPFLPLLPLQVLILNLLFSLSCLVIPFDSVSENYVKKPQKWSIRMWPKFV
FT                   LNFGPIPAIVDFIAMALMFYVICPYLVGSNYHHWVFISLFYSGIFVESLWTRVMIIHTL
FT                   RDERFPFFKQHATPIVFLVTFGLAILGTMLPSSSIAPSLGLMQLPFSFWGVVLLLEVIY
FT                   VLLTTLVKHLYLRKEKF"
FT   CDS             222145..224121
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="LCRIS_00216"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00216"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49663"
FT                   /db_xref="GOA:D5H0X8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X8"
FT                   /protein_id="CBL49663.1"
FT                   /translation="MADKDTFYITTPIYYPSGRLTIGNAYTTIAADTMARYKRSQGYDT
FT                   FFLTGTDEHGLKIEQKAEAQGIKPQEFVDKMAASYKKLWKSLNISYDKFIRTTDEQHVQ
FT                   AVQKIFEKLLKKGDIYLGEYTGWYSVEDEEYFTESQLAEVYKDDDGNVIGGKAPSGHEV
FT                   RLVKEPSYFFKMSKYADRLVEYYKEHPDFILPHSREKEMLNNFIKPGLEDLSVTRTTVN
FT                   WGIPVPSDPKHVVYVWIDALSNYITALGYGSDDDSLFKKYWPADVHLVGKEIVRFHTIY
FT                   WPIMLMALDLPLPKHIIGHGWVLMKNGKMSKSKGNAVYPESLTSRYGVDPLRYYLMRAL
FT                   PFGDDGIFTPEDFVERINYDLANDLGNLLNRTVSMINQYQAGHVDAVPVAQAEFGKDLQ
FT                   DTAASVINDYRENMNSLHFSKALDNIWKLVSRANKYIDETTPWALNKEGKKEELSKVMS
FT                   NLAESLRLIAIMIEPVMTETAPIMFKQLGLNWDNEDAKHLAFGDFDWDVKVIEKPQPIF
FT                   PRLKMDEEVKYIKDEMAKAKPKKTTRSEQKKGDEITIDDFDKVKIQVGQILSVEPVKGS
FT                   SKLLMFKLDFGNGKETQILSGIRKFYPDASELLDKKVLAVTNLKPRKMLGHLSEGMLLS
FT                   SEKHGKIKLALVGDEHAVGAELG"
FT   CDS             224121..224888
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="LCRIS_00217"
FT                   /product="Hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00217"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49664"
FT                   /db_xref="GOA:D5H0X9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0X9"
FT                   /protein_id="CBL49664.1"
FT                   /translation="MEIIDNHTHLNDEPFRGKEQYYLERAKALDVTKVICAGQDPDFNQ
FT                   RAVDLAQKFDNVYAMVGYCPDVAKDYDQQAEDKLIEQLKQPKAVAMGEIGLDYYWDESP
FT                   RDVQRNVFARQIEVAHDLKMPVDIHTRDAFGDCYNILKNSNLEYGAVLHSFNGGVDWLN
FT                   KFLDLNVYFSYSGVVSFTKATEVHESAKAAPLDRILVETDAPYLTPKPYRGHQNETGYV
FT                   RYVAEAIAKLKDIPLEKVADATYKNTVRVYGLK"
FT   CDS             224875..225441
FT                   /transl_table=11
FT                   /gene="rnmV"
FT                   /locus_tag="LCRIS_00218"
FT                   /product="Primase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00218"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49665"
FT                   /db_xref="GOA:D5H0Y0"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y0"
FT                   /protein_id="CBL49665.1"
FT                   /translation="MGLNKKNFDAVIVVEGKDDTIRLKQFFPGIETIETNGSAVSDEVL
FT                   KQIQKLSESRQIIVFTDPDFNGERIRRIVTKAVPDAKQAFITRKEGEPHKKGSLGVEHA
FT                   SKEALEHALSDLHEVEPQKSDLTPAIYRQLGLAGGSGSRKLREQVGIKLRVGYGNSKQF
FT                   YNRLHTFGVSLAELKAAVKEVENDK"
FT   CDS             225431..226315
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="LCRIS_00219"
FT                   /product="Dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00219"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49666"
FT                   /db_xref="GOA:D5H0Y1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y1"
FT                   /protein_id="CBL49666.1"
FT                   /translation="MTNNIPIGSPVRTQAIVNRYFVKAKKNLGQNFLVDQTAILGIVEA
FT                   AGIKKDDQVIEIGPGIGSLTEQLLLAGAKVFAYEVDDSLPTILQNELPKKIDDQPLASR
FT                   FKILLKDVLKANFKEDIGDFFDFTKPIKVVANLPYYITTPIIFALAESDLHFTSLTLMM
FT                   QKEVAERLEAQPGSKDYGPLTISVQTEMKVKLALQVGRNSFMPRPKVDSSVVVLTPLKE
FT                   KPAIEDRKHFIWVVKMCFSQRRKTLNNNLKSLLPDKTERDKLITELGVDPRIRPEDLTI
FT                   EQFIKIAKFIPAK"
FT   CDS             226453..227859
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00220"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49667"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:D5GYR1"
FT                   /protein_id="CBL49667.1"
FT                   /translation="MESIITDIVKIIKSENNVIAREKALMCYFFNLIRELMKLALEEVD
FT                   AGLVEETKKQGYQIEKKNKRSVVTVFGEISYWRRRYICPGKKAKYPLDELMGYDKYKRY
FT                   SVLAVKDVLQVSAVATYRNTALAVNTLSCFNISHSQVGKLIVQAGKLIKNQQQSEERYD
FT                   GITQRKKVPVLYLEGDGVVIKGTKKRLEFHRYQVCEDIINLSQKRRKRVQAKEFVSLSR
FT                   LDALQEIKTYLANTYDLSDTLIISNADGGAGYAKKDFDEIVGYCRQHEHFLDVFHLNKK
FT                   IKDRLSFMPAMQGKLISAVEFKYDRHLTDVILDTIESNLIDELNTPENHENLKLLRSYL
FT                   HRRWADIKPFKMRHLSVIKAIGCCESNHRKYTYRVKGQGKYWSEDGAEGILRVLTCIKN
FT                   NELEYWLSSEFAGGQLDIGDQEELKGAVRTSLRKMHETHLGIHHGIIESLTAGHSYLND
FT                   FGREINQINI"
FT   CDS             227983..228240
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="LCRIS_00221"
FT                   /product="Veg protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00221"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49668"
FT                   /db_xref="GOA:D5H0Y3"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y3"
FT                   /protein_id="CBL49668.1"
FT                   /translation="MPTSIITIKHKLDSHLGDALTVVAQAGRKKVTKRRGILRETFPAV
FT                   FVVDLDQHQNNFKHVSYSYTDLLTKNIALEFDDEAEEAEA"
FT   CDS             228349..229179
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="LCRIS_00222"
FT                   /product="PUR operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00222"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49669"
FT                   /db_xref="GOA:D5H0Y4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y4"
FT                   /protein_id="CBL49669.1"
FT                   /translation="MKRSERLVDMTKYLMERPHTLIALPFFAKRYGAAKSSISEDLAIL
FT                   KHTLASNQDGILETVAGAAGGVRYIPFLGKKHAEVYLSDLSTRIEDPSRILAGGFVYLS
FT                   DILGNTQDLRKIGELVATHYAYEEIDAVMTVETKGIALAQAVARFLDVPFVTARKRSKV
FT                   TEGATVSVNYISSSLSRVSKMELPTRALKKEAKVLIVDDFMKGGGTLTGMEELVKEFDG
FT                   TIAGVCVLCEADFDKEKLIKNYLSLIKISEIDTAQKLIVAEPGNFLTETDFDRF"
FT   CDS             229226..230611
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="LCRIS_00223"
FT                   /product="Bifunctional protein glmU"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00223"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49670"
FT                   /db_xref="GOA:D5H0Y5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y5"
FT                   /protein_id="CBL49670.1"
FT                   /translation="MEKYVVVLAAGKGTRMKSKLYKVLHKVCGKTMVEHVVDAAQGVNP
FT                   AEIVTIVGTGAGDVEKVLADKSKFAFQEKQLGTGDAVMTAREELGDKDGATLVVTGDTP
FT                   LFTTDTFNELFKYHAEKGNAATVLTAKAPNPFGYGRIIRDDQGNVLRIVEQKDGKPEEL
FT                   KVKEINTGVFCFDNKKLFEALKHVNNDNAQGEYYLTDVLEILRNSGERVGAYKMPDFSE
FT                   SLGVNDRIALAQATKTMQRRINEQHMRDGVSFIDPDTAYIDADVKIGNDTVIEGNVVIK
FT                   GNTEIGSDCYITSGSRIVDSKIGNNVTVTSSTVEEAEMDDNTDIGPNSHLRPKAIIRKG
FT                   AHIGNFVEIKKAEIGENTKVGHLTYVGDATLGKDINIGCGTIFSNYDGVKKFHTNVGDH
FT                   AFIGAGSTLIAPINVADHAFIAADTTVTKDVNKYDMAIGRGRQVNKPDYWHKLPLSQDK
FT                   EWD"
FT   CDS             230740..231492
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00224"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00224"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49671"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y6"
FT                   /protein_id="CBL49671.1"
FT                   /translation="MKLSHKLVMVSAAVLMGVSPVLGLAENTVSVQAATKSTNGVHNTY
FT                   GKNSKVKVTKTMKFVDRNGKKTSKTAPKGGSYTIWNVKNIDGQVYYSIQTDLKYWIPAT
FT                   ATEGTVTYKSGNTTYTLKSDGKKVTTSTSTKKAVKKTNSNKNTKKVVKESTKKTATKTT
FT                   KKSNSEKTTKKTSSKKTSVAKAVKITTKNKAYVYDKNGKRVKNYLGTSYIGKKITVKGL
FT                   GTKTINGVKYYALQPNHYYIKASDVTVK"
FT   CDS             231623..233392
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00225"
FT                   /product="Cell separation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00225"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49672"
FT                   /db_xref="GOA:D5H0Y7"
FT                   /db_xref="InterPro:IPR009063"
FT                   /db_xref="InterPro:IPR011490"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y7"
FT                   /protein_id="CBL49672.1"
FT                   /translation="MKLSHKLVMVSAAALMSVAPLLGTAENVNTVQAAPKKTTSKKAAS
FT                   NKITLVRNAYVYDKNGKRLDKYMGSAKYTTIAKGVTVTSTGTKTINGVKYYDLGGGAYI
FT                   KAVNVDGKAASSTSSLSKGTKAKFVSNSYIYDKNGKRISKYQGKSKFVKGDSVTTYGIQ
FT                   TINGKKYYQLDKKGTAFVRTVNIDGKTTSNQESSVSNDAESTKKYDYSLKKNAYIYDNN
FT                   GKRINKYQGKSKLLKGAAIDVYGIETIKGKDYYQLDKKGTAFVKASNVTRTVKATSITM
FT                   KKNAYIYNGNGDTKKKTVKKGKTVKATEARYIGTKLYYKISDNQFVKAANVGKISGPEL
FT                   EPVNEPDGAATVDTGDNTVDPNVTKVTTINVAPLYNIKGQPDNVRAFGEGQSQQVSELR
FT                   YIATSATATPELFYKLSSGRGYLKRSDVAVSGKILTPVNTPEQAREDVTVATAANKVKL
FT                   LQDINEATSVKNSEAYKLASSDVKAAYDKAISDGTTVNNDATATIAQVNEADAAIVSAK
FT                   AKLDGKRVAVANMTNLTSDEMAAIIKVVANANNVAESSVQLTTNGSLSISVNGAAQILN
FT                   LGDYVTQAAVANN"
FT   CDS             233620..234594
FT                   /transl_table=11
FT                   /gene="prs2"
FT                   /locus_tag="LCRIS_00226"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00226"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49673"
FT                   /db_xref="GOA:D5H0Y8"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y8"
FT                   /protein_id="CBL49673.1"
FT                   /translation="MSYKDDMMIFALNSNVPLAQKIADRVGVPLSKSSVERFSDGEIQI
FT                   NIDETVRGKDVYLVQSTSKPVNDNLMELLIMIDAVRRASARTINIVMPYYGYARQDRKT
FT                   RAREPITAKLVADMLQAAGADRILSLDLHAPQIQGFFDIPVDNLMGAPLLADYFLRNGL
FT                   EKDAVVVSPDHGGVTRARKLAEFLGCPIAIVDKRRPKANVAEVMNIIGNVKGKRAIIID
FT                   DMIDTAGTITLAAQALIDAGATEVYASATHAVLSGPAIKRLNDSPIKNLVLTDSINQPA
FT                   EKKLDKMLLVSVGPLMGDAIKCIQNHEALSPLFNTRYEADKNK"
FT   CDS             234762..235682
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00227"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00227"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49674"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Y9"
FT                   /protein_id="CBL49674.1"
FT                   /translation="MTQYLSFDIGGTNLKYALIDQEGHILEKDRVKTNTENLDAFMQTM
FT                   YEVADKYQGKFAGIAVCAPGKIDTKNKIIYFGGALPFLDGLNLEETLGKKYDVPVGVEN
FT                   DGKAAALSEQWLGELHDVNTGIAITLGTAVGGGVIVDNRILHGWTFQAGELSWMITNSS
FT                   IGTRNMAAYAGFSCSAVNMIKKVNLALGNIDLDNGLTAFEAINNGDLRALAVFKRYCRN
FT                   VAIMILNIQAVINGSKVIIGGGISAQPILIEEINNQFDKILQNNPMLNNQVIKPVIVAA
FT                   KHGNDSNLYGALYALLLELNDEEIR"
FT   CDS             complement(235743..236021)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00228"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00228"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49675"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z0"
FT                   /protein_id="CBL49675.1"
FT                   /translation="MMNRHDLNTDVRTQINPEDEVKAEPKSGYTQVKDLMDTVHGYCMD
FT                   YTKMSFDFIHENKDLVKDVVKISCKTAMVACVASASVAIAKIVSGKD"
FT   CDS             complement(236053..237426)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00229"
FT                   /product="HD superfamily phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00229"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49676"
FT                   /db_xref="GOA:D5H0Z1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z1"
FT                   /protein_id="CBL49676.1"
FT                   /translation="MARFQSEKLKQEVVLRDPVHGYIHIEDKVVLDILKSKEFQRMRRI
FT                   KQLGPVSYVFPGATHTRFEHNLGVYELTRRICDIFSKKYPSITPGDGLWNDDNRLLVEC
FT                   AGLLHDIGHGPYSHTFEHLFGTNHEKIGQKIITDPNTEINHALKQVAPNFPELVASVIA
FT                   KTYPNPQVVKMISSQADADRMDYLQRDAYFTGVNYGRFDLSRILRVIRPYQNGICFTNN
FT                   GMHAVEDYIVSRYQMYQQVYFHRVGRSMEVILHHLLERAQAVYKKGNLQVTPSLTKFLE
FT                   GNWTLDDYLKLDDGVMETNFSMWTQAQDPILSDLAKRYLYRKPLASVRIDEETKNLLPK
FT                   LKSLIKQAGFNPDYYTATNSAFDEPYDAYKPTGKNANSQIEIMQDDSSMIELSQLSPLV
FT                   RALNGTFQGDERFFFPKTMLSHDEDQPQIFDPLYEQFQKYIKNGALRYLRRPKREQKK"
FT   CDS             237541..237945
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00230"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49677"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z2"
FT                   /protein_id="CBL49677.1"
FT                   /translation="MTAITIDLTSKITQDDETETFTRHAQGQLTEEGDVTRISYAEEGQ
FT                   IPVKMLLKENELLIRRGVDSNNYSLMKFIPGEKGNCRYVVEGRRMDMTSVTNLLEYQSQ
FT                   DDGSRKLRVEYDLFNGLYLIGNYAVTLIFT"
FT   CDS             237992..238549
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="LCRIS_00231"
FT                   /product="DNA-directed RNA polymerase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00231"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49678"
FT                   /db_xref="GOA:D5H0Z3"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z3"
FT                   /protein_id="CBL49678.1"
FT                   /translation="MGLDKFKDKNRNELSMIEVARAILEDNGKRMAFADIVNAVQKYLN
FT                   KSDEEIRERLPQFYTNMNTDGEFISMGENVWALRSWFPYESVDEEVNHPEDEEEDDSRK
FT                   HHKKVNAFLASATGDDDIIDYDNDDPEDDDLDATDDDTDDDYGDEDSDYDEDNDDTDDV
FT                   LPDGIEGQLSQLNDDDDDDEDN"
FT   CDS             238666..240285
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="LCRIS_00232"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00232"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49679"
FT                   /db_xref="GOA:D5H0Z4"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z4"
FT                   /protein_id="CBL49679.1"
FT                   /translation="MTKYIFVTGGVVSSLGKGITASSLGRLLKNRGLKVTMQKFDPYIN
FT                   IDPGTMNPYQHGEVYVTDDGTEADLDLGHYERIVDVRTSKYSNVTTGKIYQEVLEKERR
FT                   GDYHGATVQVIPHITDMIKKKIMRAALTTDSDVIISEIGGTVGDIESTPFMEAIRQMRR
FT                   EVGPENVMYIHCTLVPLLHAAHEMKTKPTQHSVAELRSIGIQPNMLVLRAEQPIDQEHK
FT                   DKISTFTDVPVDRIIESIDAPSLFDVPLNFQKQGMDQKVCDFLHLESPKPEADMEAWKK
FT                   LDERAKTLKHHTKITLVGKYVELEDAYISVTDALQHAGYLYNTKIDVDKVQAEDVTEDN
FT                   IAEIMKDSDGLIVPGGFGTRGLEGMITAIKYAREHDIPFLGICLGMQMASVEFARDVLN
FT                   LEDANSAEAEPNCKNNIIDIMADKRDEENIGGTLRLGLYPATLKKGTKTRAAYDDQEVI
FT                   QERHRHRFEFNNKYRQAFEDAGMVFSGVSPDNRLVEIIELPKKKFFVAAQYHPEFLSRP
FT                   QRPEGLFKSFIGAASGLPAQEF"
FT   CDS             240420..241715
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="LCRIS_00233"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00233"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49680"
FT                   /db_xref="GOA:D5H0Z5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z5"
FT                   /protein_id="CBL49680.1"
FT                   /translation="MKQMIIHGGKPLQGDVWIGGAKNSTVALIPASILSRTPVTLEGVP
FT                   RIADVVNLMDLLSEMDVHCDFGETTLRIDPTDIKMSPLPAGKIKSLRASYYFMGALLGR
FT                   FGKAVVGFPGGDDIGPRPIDQHIKGFEALGASVKNENDQIIITAPEDGLHGAKIHLKMP
FT                   SVGATMNIIMASVTAQGQTIIENAAKEPEIIDLATFLNNMGAVIRGAGTDSIRIEGVEQ
FT                   LKAQIPHTIIPDRIEAGTYVALAACIGNGIRIHNIIEEHLDSYLAKVEEMGVVIDSDED
FT                   SLYVYPAGDLKMVQVKTDVYPGFATDLQQPITPLLLTAKSGEGVVIDNIYPKRIGHIAQ
FT                   LQKMGANIKVEDNIILAHPTKQFHGAEVTAGEIRAGACLMIAGLMADGTTTIDKAGNIL
FT                   RGYDRVQEKLRQLGADVTIKDDPAVPGILDNI"
FT   CDS             241784..242305
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00234"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00234"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49681"
FT                   /db_xref="GOA:D5H0Z6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z6"
FT                   /protein_id="CBL49681.1"
FT                   /translation="MSLIFTRRAQNSDVDKIVQILQDAIAFLKERGSTQWQSGYPSRET
FT                   VKEDIKNNCAWVLTEDNEVAGYAAVVIGRDSNYAKIDGEWNNDVDSYATIHRIAISSKF
FT                   RGMHLTQFFLSNIISLTYAQEIHNFRIDTGEKNKIVQHIATSHNFIKRGIIQVDDPINP
FT                   DRLAYELNIQ"
FT   CDS             complement(242361..243785)
FT                   /transl_table=11
FT                   /gene="pepDA"
FT                   /locus_tag="LCRIS_00235"
FT                   /product="Dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00235"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49682"
FT                   /db_xref="GOA:D5H0Z7"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z7"
FT                   /protein_id="CBL49682.1"
FT                   /translation="MKQTECTTILVGKKATIDGSTMIARSEDGGRVIIPEGFKAVNPAD
FT                   QPKHYTSVISKQKIDDADLAETPLRYTSAPDVSGKNGIWGAAGINAENVAMTATETITT
FT                   NSRIQGVDPLLDPSEGGLGEEDFVTLTLPYLHSAFDGVKRVGYLVEKYGTYEMNGMAFS
FT                   DKDNIWYLETIGGHHWIARRIPDDAYVIAPNRLNIDTFDFNDSDNFACSADLKDLIEEY
FT                   HLNPDREGYNMRHIFGSSTIKDAHYNNPRAWYIHNYFDPDFGGTPADQDQPFICHANRL
FT                   ISIEDIKWAESSHYQDTPYDAYGDQGTPEQKKTFRPIGINRNFETHILQIRNDVPAEIA
FT                   GVQWLAFGPNTFNSMVPFYTNVTTTPEAWQTTPKFNLNKIFWLNKLTAQLGDTNYRVYG
FT                   ELEDAFEQKSLAQCHKIQHDTDKEAKNLSGKELQDKLIAANQKMSDTVYNNTVELLGQM
FT                   VDKGHGLMTLKYDLLD"
FT   CDS             complement(243872..244684)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00236"
FT                   /product="Raffinose operon transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00236"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49683"
FT                   /db_xref="GOA:D5H0Z8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z8"
FT                   /protein_id="CBL49683.1"
FT                   /translation="MPNLNNQNLDSYIMFYGRQKCQPDEFFQGDSLRKNDIFYYIISGT
FT                   GSFTSSRHHAVKLKAGDLFYVPRNQTCSFQADHDEPWEYFWIGLAGNGVNESIKASNLP
FT                   NKNFLRQIQKTAFYQTLDDLYQCLAKKKTLLNNLQISALTYQLFYHLVKDFPNHPPVRK
FT                   TPKNDQYQIAINYLNQNYTDPTCNIVELCHRLGVSRSFLYALFRKNTKLSPQKYLMQLR
FT                   MEAAKKELINTKHNLRQVAQKVGYGDEFTFSKAFKRYSGVSPNAFRGN"
FT   CDS             complement(244831..246117)
FT                   /transl_table=11
FT                   /gene="pbuX"
FT                   /locus_tag="LCRIS_00237"
FT                   /product="Xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00237"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49684"
FT                   /db_xref="GOA:D5H0Z9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0Z9"
FT                   /protein_id="CBL49684.1"
FT                   /translation="MAQKEVSHKKAAVLGLQHLLAMYSGAVAVPLLIGTALHFNSTHMT
FT                   YLVSIDIFMCGLATLIQLFRNKYFGIGLPVVLGCAIQAVAPLEMIGQKFSINTMYGAII
FT                   IAGIFVFLIAGWFSKIKKLFPPVVTGTLITVIGLTLIPVAFQNMGGGNAQAKDFGDAKN
FT                   LIAAFITILIIVVIEVWAKGFLRSISVLIGLIAGTIIAGCMGLVSLTPVTQASWFHLPQ
FT                   FFYFGVPEFEWSSCLTMIIIALVSLVESTGVFFAIGDLLHKDITEEDLKKGYRAEGLAQ
FT                   IFGGLFNTFPYTTFSQNVGLLQLSGIKTKRPIYWAAGLLMAMGLLPKIGALVTIIPDSV
FT                   LGGAMLVMFTMIAVQGIKMLTKVDFENNRNILIVAISIGMGLGVTVYPQIFQDLPQTIQ
FT                   LFLGNGIVVASICATLLNLLFNGRSGAHK"
FT   CDS             complement(246124..246702)
FT                   /transl_table=11
FT                   /gene="xpt"
FT                   /locus_tag="LCRIS_00238"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00238"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49685"
FT                   /db_xref="GOA:D5H100"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H100"
FT                   /protein_id="CBL49685.1"
FT                   /translation="MKELVDRIKQDGEVLPGNVLKINSFLNHQVDPQLMMHVGEEFSRL
FT                   FKDEKVDKVLTCEASGIAPGVMAAYQLHVPMIFARKKKPSTLNDAVYWADVFSYTKKVT
FT                   NKICVEEKFLHKGEHILIIDDFVAHGEAVKGMVNIAKQAGCDIVGVGAVVAKTFQGGSE
FT                   WVEKEGLRFEALAKIDSFENDQVHFEGEE"
FT   CDS             complement(246936..247109)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00239"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00239"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49686"
FT                   /db_xref="UniProtKB/TrEMBL:D5H101"
FT                   /protein_id="CBL49686.1"
FT                   /translation="MNKYATLYWLIAVLLYLGYSFITNDWERSWIIWPIAGILYGIIEK
FT                   IISLCHNDIAAE"
FT   CDS             complement(247131..247313)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00240"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49687"
FT                   /db_xref="GOA:D5H102"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:D5H102"
FT                   /protein_id="CBL49687.1"
FT                   /translation="MRLGQKIAALRKKNHLFQEALAEKMNVSRQAVSNRCVLLCQKQYH
FT                   YGQLQHFITNRLLHS"
FT   CDS             247536..249086
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="LCRIS_00241"
FT                   /product="GMP synthase (Glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00241"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49688"
FT                   /db_xref="GOA:D5H103"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5H103"
FT                   /protein_id="CBL49688.1"
FT                   /translation="MAKNLDDFDKIIVLDFGSQYNQLITRRIRDFGIYSELLPHDLSME
FT                   KIKQINPKGIIFSGGPNSVYDNGALKVDPAIFKLGIPILGICYGMQLMSHDLGGKVEQA
FT                   ENKEYGRANITVEDPDSILFNGLPSKQYVWMSHGDLVTQAPKGFEVTASSKNCPIAAIA
FT                   NPDKKFYGIQFHAEVRNSEYGLDILKHFAFEVCGAEANWTMNDFIDMKVDDIRKEVGDK
FT                   KVILGLSGGVDSSVTATLLHKAIGDQLTAIFVDHGMLRKDEGNQVMQALNKDLGVNIIR
FT                   VNAQKRFLDKLKGVTDPEKKRKIIGKEFIEVFNEEAKKLKDVDFLAQGTLYTDVIESGT
FT                   NTAQTIKSHHNVGGLPKDMHFKLIEPLRKLFKDEVRELGEKLGIPHDLVWRQPFPGPGL
FT                   GIRVLGEVTEDKLKIVRDSDAILREEIKKAGLQEKIWQYFTVLPGIRSVGVMGDGRTYD
FT                   YTIGIRAVTSIDGMTADFAQIPWDVLGHISDRIVNEVDNVNRVVYDVTSKPPSTIEWE"
FT   CDS             249584..249775
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00242"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00242"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49689"
FT                   /db_xref="UniProtKB/TrEMBL:D5H104"
FT                   /protein_id="CBL49689.1"
FT                   /translation="MKPLKDELIQSRLDEDELADFDKVKKLLDVKSNSVAIRQMIKDEM
FT                   RKPEMNGSKVILTLYQRY"
FT   CDS             249941..250495
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00243"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00243"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49690"
FT                   /db_xref="GOA:D5H105"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D5H105"
FT                   /protein_id="CBL49690.1"
FT                   /translation="MAHVVRIAYKTIYNWIEQGVLDIGVADLPDHGIRRRRAKETRGTF
FT                   SHGRSIEDRPAEVIDRHTSGHFEADTVLSGKRKGQAIATFVERKSRLIIVKRLQGRDST
FT                   SITKAILELANQLEDNLKPLTVDHGKEFANYKLIEKQARIPLYFAHAYSPHEWGSNENR
FT                   NRVLRRFIPKVNRLRKSLMMS"
FT   CDS             250783..256479
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00244"
FT                   /product="Protein with YSRIK-signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00244"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49691"
FT                   /db_xref="GOA:D5H106"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR009063"
FT                   /db_xref="InterPro:IPR011490"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:D5H106"
FT                   /protein_id="CBL49691.1"
FT                   /translation="MKRLKFLETKRTPRYSLRKFSVGVASVLLGVTIFGINFTNHSVKA
FT                   ATIESVKTNTQKATSATEKVQQNGASNGVPEKVQQNGASNGVPEKVQQSQSSPETQGSA
FT                   GTDINSSAFMNLMAASDTGTDTGAGTGTGTNTGRDRSAVATVTSGNINDQPAKENQKLA
FT                   NEHNLTSSDNYSSNIYKGTDGKYYKIVTIYGNDYVYHAADIQANGTAFGQWATSAADTK
FT                   SNINISKEDLGNGKTRWTVIFFPNKGLQKAGDTLHGLSSAKFGIALTNDYQIVGDVDMD
FT                   ITTDPNQTFVAHTFKDNSNSSTDITVSNPSPEVKFSFNPNTDVDPNTGLINSETMPAYN
FT                   NQYLQGPYYFNTAADAGRRNLWQTYFEDGVEYNNAYDGTPPYLGGNHDFHLNNFEIKNK
FT                   TGVDGAKQGDKIIYDTLGYMLNSKNANPNGVFSSHNFNQAMEFKSQGVTSQSQFSSYKI
FT                   SFTTQHTDSHEVELTTGPKKQQFSGIAANIYSYQNGYYNMFSSLYGEQRALNAADAAHP
FT                   APLNPKDIIPNWQIGEDALAKINKDYLNNAQINALSSEIHNNAADPDALAKIVDQGNAL
FT                   NDAMKKLGNSIGQYDHDGSFADHKEDTTKASDRYKYANPDKKAAYDNATEATKALINKD
FT                   TGAYADQATVETLTGAENKAWSALDGVPDAEKYKPKVPAKEPVADPSHLTETEKDKVQK
FT                   NVEDANKDNFPDGTKVTVDDSGLATITYPDTSTVSMGGLVRAETDAEKTTPKVPAKEPV
FT                   ANTSSLTDGEKAKVQKNVEDANKDENGKSTLPEGTTVTVGDDGTATINYKDGSKDTIPG
FT                   SDLVRAETDAEKTTPKVPAKEPVANTSSLTDGEKAKVQKNVEDANKDENGKSTLPEGTT
FT                   VTVGDDGTATINYKDGSKDTIPGSDLVRAETDAEKTTPKVPAKEPVANTSSLTDGEKAK
FT                   VQKNVEDANKDENGKSTLPEGTTVTVGDDGTATINYKDGSKDTIPGSDLVRAQTDAENT
FT                   AAKRPANEQGANTNSLSDGANNXRFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
FT                   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
FT                   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
FT                   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRAETDAEKTTP
FT                   KVPAKEPVANTSSLTDGEKAKVQKNVEDANKDENGKSTLPEGTTVTVGDDGTATIKYKD
FT                   GSKDTIPGSDLVRAETDAEKTTPKVPAKEPVANTSSLTDGEKAKVQKNVEDANKDENGK
FT                   STLPEGTTVTVGDDGTATVNYTDGSKDTIPGNQLVQAQKDDAKDAGNITPNVPGEKVTV
FT                   KDPSHLTEDEKKQVKNNVDNANKDKFPAGTEVTVGDDGTATVNYPDGSKDTIPGDQLVQ
FT                   GQKGDTTDAGNITPTVPGGKVTVKDPSHLTDDEKKQVKNNVDNANKDKFPAGTDVTVGD
FT                   DGTATVNYPDGSKDTIPGDQLVQGQKGDTTDAGNITPNVPGDKVTVKDPSHLTDDEKNQ
FT                   VKNNVDNANKDKFPAGTEVTVGDDGTATINYKDGSKDTIPGDQLVQGQKGDTTDAGNIT
FT                   PTVPGDKVTVKDPSHLTDDEKNQVKNNVDNANKDKFPAGTEVTVGDDGTTTVTYPDGSK
FT                   DTISGDQLVQGQKGDTTNAGNITPTIPGGKVTVKDPNHLTDDEKNQVKKNVEDANKDKF
FT                   PDGTKITVGDDGTTTVTYPDGSKDVIAGTDLIIAAKGEDVLGSKYHSHKNGSNSSQADR
FT                   VKGASTANGSIANAGNNLGVKAEIDNAIVGVKAETDNAIGNNKATSLKTLPQTGTKDTS
FT                   ILGVLGMLLASLGLFGFKKKRDKE"
FT   CDS             complement(256936..257262)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00245"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00245"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49692"
FT                   /db_xref="GOA:D5H107"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5H107"
FT                   /protein_id="CBL49692.1"
FT                   /translation="MNLREVNDKAGLGRNSIYNWKNQRPGIDALNAVADVLHTSADYLS
FT                   GKTDNPSPSPKGDETGGISIDGEVPYFYHGYTIPEDYLNIVRQLMERDIKKGLIKRHDN
FT                   SRSE"
FT   CDS             257262..257564
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00246"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00246"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49693"
FT                   /db_xref="InterPro:IPR016787"
FT                   /db_xref="UniProtKB/TrEMBL:D5H108"
FT                   /protein_id="CBL49693.1"
FT                   /translation="MPHMPEILKLVNFYYSKLHFYQTTAEKEKVYHVNPKRAQRLAHKA
FT                   TQKKAIGTKAQQALKKQFEQSKIAKKKVKKDRKREEQERRFLQKQVKRREKHRGH"
FT   CDS             complement(257688..257876)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00247"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00247"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49694"
FT                   /db_xref="UniProtKB/TrEMBL:D5H109"
FT                   /protein_id="CBL49694.1"
FT                   /translation="MVNILQKGFNHVGLREYFFDAFVRYVCVSSANLHRPSSRQKIKTP
FT                   LNVITLEELLSSVHRKK"
FT   CDS             complement(258004..258339)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00248"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00248"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49695"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H110"
FT                   /protein_id="CBL49695.1"
FT                   /translation="MPRHIYNCSEGCPVESTLQIISGKWKSVIIYHLIKKKHCRFNELQ
FT                   KLMPNCSRRMLSLQLKELKSDQIIDKTIFPTVPPKTSYQLTALGETLTPLILEMEKWGD
FT                   KYNQLHE"
FT   CDS             258489..259511
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00249"
FT                   /product="Alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00249"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49696"
FT                   /db_xref="GOA:D5H111"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H111"
FT                   /protein_id="CBL49696.1"
FT                   /translation="MKAIGFKKHLKIDDPESLIDFDMEKPTAKGHDLLVKVNAVSVNPV
FT                   DVGVRKSGHMVLKTPKVIGWDACGVVEEVGSKVSLFKQGDRVFYAGSFIRSGSDSEYQL
FT                   VDERIVGHAPKTLKDNEAAAMPLTSLTAYEALFEQMGLTWNQENNQSKTILIINGAGGV
FT                   GSVATQLAHLAGLTVIATASRPDSIKWTQDHGTDYVVNHREDLVKQVRKLGYKYVDYIL
FT                   ELKDLDGHWKEMCELIKPEGHIVSITENHRPINLRLLTKKKAHFSWEWMYTKSYYQTED
FT                   MISQHDILNKIAQMLDNGKLKCTMTKSLEPLNAINLRKAHKLVESGHMTGKVVVYDWEN
FT                   "
FT   CDS             complement(259508..261277)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00250"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49697"
FT                   /db_xref="GOA:D5H112"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D5H112"
FT                   /protein_id="CBL49697.1"
FT                   /translation="MYQNYTIGQTALTLNLDFAIPHNHLANTISWFVDSIPEDVLLGNT
FT                   AKTGRPAYHPAMMLKILLFAYSRRVFSGRKIELMLEENVPMMALAEHQQISYHTINNFR
FT                   SSKHANELVKKSFLYFTNLLEAEGLINEGAIFIDGTKIEADANRYTFVWRKAVEKFHDK
FT                   LKGQAVELYDELIAKEVVKAMAKEKVQTSQGLAELAQETEAEIEKLTEEIEQEPKAIPG
FT                   GSPRKARRRGLKKLLHKLRKDYVPRMKKYEEAKEIFAGRNSYSKTDHDATFMHMKEDHM
FT                   KNGQLKPGYNIQAATTDQYVVDFALYPNPTDFRTFEPFLKQMTTLDKFDKIVADAGYGS
FT                   EYNYSMLEEEYSDKKYYIPYTMYEKEKTRKYRNDPTKLANWFYDEKDDYYLDQNGVRFN
FT                   FKYYSQRKDRSTGQVRDFKVYEADEFQLTPELERLAKTKSGRQRQVRYNPNWQYLKEKA
FT                   KAVLQSPEGRHIYSMRKYDVEPIFGHLKNVFGMRRTHLRGKKKVETDIGIAFMMMNLSK
FT                   YWNRRWSKDQFSLFKNKNRQKKTVKQLKLRVGLIVFQYLRLSFFPDTFLYLNYSIFFKL
FT                   KACKINCELSINA"
FT   CDS             complement(261774..262346)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00251"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49698"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5H113"
FT                   /protein_id="CBL49698.1"
FT                   /translation="MTKIYSKIKHYQKQLAKKRTVNGRIKGAQSKKYLKTRIKLQASYQ
FT                   RAQNIQTDLMHKFTTELVNNYDQIAIEDLEVKGMLMSHVASKGMHRSMFGLFRKLLTYK
FT                   CEWYGKELIIANKLYPSTQRCAACGLVKKGDEKITLQGNKKHGTKHNEFVCYNPSCPNY
FT                   NKKVDRDENAMANLTLLVKHPELNRAL"
FT   CDS             complement(262343..263065)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00252"
FT                   /product="Transposase, IS605-tnpb"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00252"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49699"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5H114"
FT                   /protein_id="CBL49699.1"
FT                   /translation="MPEYYIKTKSYELFPNKQMKAVFDRNCDYRRFCWNEALALWNDEY
FT                   DIRQLMLDKEIKAELRKPKSQRKFTAEQEEMLASYPSPNWKAIRNKLVAEKEDWQFSYS
FT                   AHLLQLAVQDLGKAWQNFFNKAQKDWGKPKFKSKRAPKQGFKSDQARIVNGKLVLEKPQ
FT                   GLKANWQPIKLSEKPFDYPTGTMSFYRVRDRYYVAIPYKIPKDRFEVKKKTGKATGVDI
FT                   KVAHFNYEDVSFLIFLSL"
FT   CDS             complement(263096..263710)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00253"
FT                   /product="Resolvase, N terminal domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00253"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49700"
FT                   /db_xref="GOA:D5GZV3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZV3"
FT                   /protein_id="CBL49700.1"
FT                   /translation="MSRIMYLKEAAAYLGKAPFTLQSWDRAGKLKAHRTANNRRFYYQS
FT                   ELDQYLGLDHNEPIDKRKIVAYARVSSNGQKDDLKDQVAFLRQFLNARGIIADEYISDI
FT                   GSGLNYKRPKWLKLIKDIDANQIKEIYVTYEDRFIRFGFKFFQEFCAWHDCKIIVLNNE
FT                   DTSPDKELVEDLISVIHVFSCRLYGLRRYKNKIKNDPNLKE"
FT   CDS             complement(263980..264489)
FT                   /transl_table=11
FT                   /gene="ogt2"
FT                   /locus_tag="LCRIS_00254"
FT                   /product="Methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00254"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49701"
FT                   /db_xref="GOA:D5H116"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:D5H116"
FT                   /protein_id="CBL49701.1"
FT                   /translation="MQTVSYYNSPIGKILLASDEQGLIGLWLDTDRYYGDNLDKEYSEG
FT                   GNKYLASAKKWLDIYFQGKEPDFTPQLHLIGTDFQKRVWQALLKIPYGMTTTYKDIAVQ
FT                   AAKDKDHLPIRAAGGAIGRNHICIIIPCHRVVGVNHNLTGYGGGIDKKIQLLKLEGVDI
FT                   NQFKEP"
FT   CDS             complement(264559..265074)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00255"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00255"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49702"
FT                   /db_xref="UniProtKB/TrEMBL:D5H117"
FT                   /protein_id="CBL49702.1"
FT                   /translation="MKSANYTRKHHMYLMNHKNGDVIEVRMDKKNKTFKKIRLYRQDGL
FT                   GNYYLDPHAEFKDQKSPATKENIVEAGKKVSDHISSAENWHHKVRPIFNAEHKIVDFEP
FT                   RLHLEHHTKIQNAKRYLRHLERRHADFIFRKNSKTPLLIPWNYIKDMIYEDRNKEMVLA
FT                   HKVHKLRK"
FT   CDS             265220..265597
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00256"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00256"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49703"
FT                   /db_xref="UniProtKB/TrEMBL:D5H118"
FT                   /protein_id="CBL49703.1"
FT                   /translation="MKKLNIFYYATIWSFIIGICCATYLNLINFIINFVWHVLFDKLPV
FT                   PSQALPFFICIPFGFIIGILIKRLGSYPLTIEEVLMSVKQEGKINYHNWWKSLTLGLIS
FT                   LAAWWQYWTRGFNYCTRKWHG"
FT   CDS             265624..266184
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00257"
FT                   /product="Resolvase, N terminal domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00257"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49704"
FT                   /db_xref="GOA:D5H119"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D5H119"
FT                   /protein_id="CBL49704.1"
FT                   /translation="MLILLIGNGIIFGDTITANNRRFYYQSELDQYLGLDHNEPIDKRK
FT                   IVAYARVSSNGQKDDLKDQVAFLRQFLNARGIIADEYISDIGSGLNYKRPKWLKLIKDI
FT                   DANQIKEIYVTYEDRFIRFGFKFFQEFCAWHDCKIIVLNNEDTSPDKELVEDLISVIHV
FT                   FSCRLYGLRRYKNKIKNDPNLKE"
FT   CDS             266215..267507
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00258"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00258"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49705"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZV2"
FT                   /protein_id="CBL49705.1"
FT                   /translation="MPEYYIKTKSYELFPNKQMKAVFDRNCDYRRFCWNEALALWNDEY
FT                   DIRQLMLDKEIKAELRKPKSQRKFTAEQEEMLASYPSPNWKAIRNKLVAEKEDWQFSYS
FT                   AHLLQLAVQDLGKAWQNFFNKAQKDWGKPKFKSKRAPKQGFKSDQARIVNGKLVLEKPQ
FT                   GLKANWQPIKLSEKPFDYPTGTMSFYRVRDRYYVAIPYKIPKDRFEVKKKTGKATGVDI
FT                   NVGHFNYEDGQLLIIPKSLTKIYSKIKHYQKQLAKKRTVNGRIKGAQSKKYLKTRIKLQ
FT                   ASYQRAQNIQTDLMHKFTTELVNNYDQIAIEDLEVKGMLMSHVASKGMHRSMFGLFRKL
FT                   LTYKCEWYGKELIIANKLYPSTQRCAACGLVKKGDEKITLQGNKKHGTKHNEFVCYNPS
FT                   CPNYNKKVDRDENAMANLTLLVKHPELNRAL"
FT   CDS             267539..267823
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00259"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00259"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49706"
FT                   /db_xref="GOA:D5H121"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D5H121"
FT                   /protein_id="CBL49706.1"
FT                   /translation="MPKEIKLPCPSQALPFFICIPFGFIIGILIKRLGSYPLTIEEVLM
FT                   SVKQEGKINYHNWWKSLTLGLISLAAGGSIGPEASTTVLGSGMVILAGR"
FT   CDS             267795..268631
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00260"
FT                   /product="Chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49707"
FT                   /db_xref="GOA:D5H122"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D5H122"
FT                   /protein_id="CBL49707.1"
FT                   /translation="MAWLYWLGDRLRLIAYSSDWKWNHFWDTIVSKKQLKKLPKFSSLF
FT                   KSKLHQKVFCLIMVMIGVVGAAIVFKLFPEEGLFGIHHRHILWQWHYSMYVIIPLIVGW
FT                   SFGMFFLWSEKWSDYFAEKITISPIIKATIWGIVLALLTLITSYALYSGEFQIVPFVHQ
FT                   ALQISPLFLLVIAVIKTLSTNIGFSLGWRGGKIFPSIFASVAVGAAIAQFLPIMPVMCV
FT                   AITVSASIAVILGKPLLTAILLILLLPIELAPVILVSAYLAACLTKVSYSFRQKNN"
FT   CDS             268644..269645
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00261"
FT                   /product="Glycolate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00261"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49708"
FT                   /db_xref="GOA:D5H123"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5H123"
FT                   /protein_id="CBL49708.1"
FT                   /translation="MNEKNDAVTGASLIENQEEKVKSPWPGPKGMIPVTSGRADDANVH
FT                   NRSYLDNILVEMRLLDSVEPDLTTEIFGKKYASPLTLAAVSHLNKVLPDKTRKPMQEKA
FT                   RAAKNTNTLNWIGMESNEEYAEIVKESGDTVRIVKPYADHDKIMGELKQAEELGAVAVG
FT                   MDIDHVPGDNGKYDVVDGILLGPISFSDLEKYVHAVKLPFVAKGMLSVRDAVKARDAGA
FT                   KAIVVSHHHGRVPFGVPPLKVLPAIKQALNGSGMTIFVDGSLMTGYDAYKALALGADAV
FT                   LIGRGILSELLKDGQKATEDKIKKMNEQLAQMMLYTGVRDTKSFDPSVLHFD"
FT   CDS             269967..270302
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00262"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00262"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49709"
FT                   /db_xref="UniProtKB/TrEMBL:D5H124"
FT                   /protein_id="CBL49709.1"
FT                   /translation="MKFHYGRGCKTFFKKHKNEQKIIKQLIDQAITKELATGMTKVKIA
FT                   AMTRIEGKSIYEFRLNLKKAGSARVAFAVKDEQVLVLLITSNLQKDSFNHELETVLKGS
FT                   HYAFNSN"
FT   CDS             270283..270558
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00263"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00263"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49710"
FT                   /db_xref="UniProtKB/TrEMBL:D5H125"
FT                   /protein_id="CBL49710.1"
FT                   /translation="MRLIPIKQAETLLKKMCSNKSKYVEIKLLTAKKDRSISVKNDGKK
FT                   LILTEDGYLNFTQEYELTDPAVGRHAVLAAFKKEFPRSNRAYLIAK"
FT   CDS             270617..271852
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="LCRIS_00264"
FT                   /product="Serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00264"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49711"
FT                   /db_xref="GOA:D5H126"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:D5H126"
FT                   /protein_id="CBL49711.1"
FT                   /translation="MKYAEKSPALWDAIHHEEQRQQDTIELIASENIVSDAVREAQGSV
FT                   LTNKYAEGYPGRRYYGGCQYIDQVEQLAIDYAKKLFNAKFANVQPHSGSQANMAVYQAL
FT                   LKPGDVILGMGMDAGGHLTHGSKVNFSGKEYKSYSYGLNVETEELDFDAIREIALKVKP
FT                   KLIVAGASAYSRIIDWQKFREIADEVGAYLMVDMAHIAGLVATGQHPSPVPVADVVTTT
FT                   THKTLRGPRGGMILSNNLEIGKKINSALFPGIQGGPLEHVIAGKAQAFYEDLQPQFTDY
FT                   IKQVIKNAKAMAETFAESDNIRVVSGGTDNHLMIIDITKTGITGKDAQNLLDSVHITTN
FT                   KESIPGDQRSPFVTSGLRIGTPAITSRGFDEADAKKTAEMIIEILSDPENSATIAHVKE
FT                   EVQALTKKHPIE"
FT   CDS             271956..273548
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00265"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00265"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49712"
FT                   /db_xref="GOA:D5H127"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5H127"
FT                   /protein_id="CBL49712.1"
FT                   /translation="MEKLKRHKIGLFSAIMLALNSLIGSGWLFGSGSAAQIAGPAAILS
FT                   WILGAVIIISIALTYVELGSMFPESGGMSRYAQYSHGPLLGFVAAWANWISLVTLVPME
FT                   AVAAVQYMSSWPWSWANWTKNFIKNGSITFAGLGVVIIFMLIFTMINFWSVKIMTHFTN
FT                   LISIFKILLPTLTIIVLIASGFHGQNFGSNLHEFMPYGSRSIFEATSVSGIIMSYDAFQ
FT                   TVINMGGELKNPRKNIVRGVLISMLITAAIYIMLQVTFIGAVEPGMLAKVGWHGVNFTS
FT                   PFADIAIILGINWLVILLYLDAFVSPFGTGVAFVATASRALAAMTHTRHLPKWLGRLNQ
FT                   KYLIPRYAMIADFVFAIILVSLFRNWNLLATVITASTLIAYLTGPVTVMTLRKKRPDLD
FT                   RPFNPGYMKWLAPVAFILTSLAIYWSMWPTTIQVIIVIALGLPIYFYYEIHYQHSNLKE
FT                   QLHSSWWMIGYLIFMSLMSFVGSSGFGGQNWIKYPFDFVVIIIISLAFYYWGIKTGLKK
FT                   IDPYAEKIAQNKE"
FT   CDS             complement(273594..274421)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00266"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00266"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49713"
FT                   /db_xref="GOA:D5H128"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H128"
FT                   /protein_id="CBL49713.1"
FT                   /translation="MTTLPFKAVAVDVDGTFVNDEKQYDHQMFSEILTRLHQHGAHFII
FT                   ASGRPAGRLADDFSEFIDSIDFVADNGAVLVRNGKIIRTTSFSKKCILNFIEYLHARYP
FT                   GAAQNILISGVKHSYFLKSTPPEYKRSHHYFYPNSIEIDDFNKIPADDQYTKITMDYPS
FT                   KIRHELEHGFNSRSTEKIHVTTSGWSYMDIIPEGVNKAAGLKEFLAYLDVPRSELIAFG
FT                   DGENDLEMLKFAGLSYAMANGQDIVKKTAKFIAPTNNDNGVFKVLNKYLDEAE"
FT   CDS             274537..276156
FT                   /transl_table=11
FT                   /gene="dexB"
FT                   /locus_tag="LCRIS_00267"
FT                   /product="Alpha,alpha-phosphotrehalase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00267"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49714"
FT                   /db_xref="GOA:D5H129"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D5H129"
FT                   /protein_id="CBL49714.1"
FT                   /translation="MTPWWKKAVVYQIYPKSFQDSNGDGIGDLQGIIARLDYLENLGVD
FT                   AIWLSPVYQSPGVDNGYDISNYEAIDPQYGTMADMDELIQKAKEHHIRIVMDLVVNHTS
FT                   DQHQWFVEARKSKDNPYRDYYIWRDPVDGHEPNSLKSAFSGSAWKFDEQTGQYYLHFFA
FT                   EQQPDLNWKNPELRQKIYDMMNFWLDKGIGGFRMDVIELIGKDPDKMIRENGPMLHPYL
FT                   QEMNKNTFGDHDVMTVGETWNATPKIAEEYSDPARHELSMVFQFENQALDQQEGKEKWD
FT                   LKPLDLGELKKVLVKWQTELDFNHAWNSLFWENHDIPRVISRWGNDKKYRVQCAKMFAT
FT                   VLHLMHGTPYIFNGEEIGMTNCPVKNIDEVEDIESVNMYHERLAEGYDKDKLIHAINVK
FT                   GRDNARRPMQWNDEKNAGFTKSKPWLTVNPNYKEINVKKALADPNSIFYTYQELITLRH
FT                   ENEIVVNGDFKLVHDTGDEVLAYYRILGTEKWLVVANLSGEEQQFTSTDRIKENLLSNY
FT                   AVRNDLHDITLKPYEAFAVAIR"
FT   CDS             276266..276511
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="LCRIS_00268"
FT                   /product="50S ribosomal protein L31 type B"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00268"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49715"
FT                   /db_xref="GOA:D5H130"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="UniProtKB/TrEMBL:D5H130"
FT                   /protein_id="CBL49715.1"
FT                   /translation="MKQGIHPEFQEVVFMDSATGAKFLAGSTLKPSETIDYEGETYPLV
FT                   RVEVSSDSHPFYTGKQKFAQADGRIEKFNKKYGLKK"
FT   CDS             276637..278004
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="LCRIS_00269"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alani
FT                   ne ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00269"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49716"
FT                   /db_xref="GOA:D5H131"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:D5H131"
FT                   /protein_id="CBL49716.1"
FT                   /translation="MKMQMAEIAKALNTTCEGDNQTVITSVAFDSRKITDGGLFVPLEG
FT                   ERDGHEFIASAINNGASATLWKKGHPNKPEDIAVIEVDDPLAAMQELARYYLRKVNPTV
FT                   VGITGSNGKTTTKDMIAAVLSKRFNVHKTQANFNNEIGVPMTILEMKPNTEILVLEMGM
FT                   DRPGQLHHLSELTHPDVAVITMIGEAHIEFFGSRDKIADAKMEITDFLREDGEFIFNGD
FT                   EPLLQERAEKLDQAKATFGFRDEDTVHATGFKSYMHHATFTVNDSEQKFSIPMIGKHNV
FT                   SNAMAAISVGRHFGESDEEIASSLSNFTPTANRMEWEKGDAGESIMSDIYNSNPTAVRA
FT                   VLTSFGQVEVKDNGRRIAVLGDMLELGKNSPELHAGLEDTLDPQIINEVYLYGSEMKNL
FT                   YDALQDKYEPEHLHYYTQEQTDRMIDDLKNDIKSDDIVVLKGSHGMHLENVLARLR"
FT   CDS             278018..279502
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="LCRIS_00270"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49717"
FT                   /db_xref="GOA:D5H132"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H132"
FT                   /protein_id="CBL49717.1"
FT                   /translation="MKFSELGLNDALLKAIKRSGFEEATPIQEQTIPLALQGKDVIGQA
FT                   QTGTGKTAAFGLPILQMIDKKEKAIQAVIIEPTRELAIQTQEELFRLGRDEHAHVQVVY
FT                   GGADIGRQIRSLKHHVPSILVGTPGRLLDHLKRKTINLDQVKAVVLDEADEMLDMGFIQ
FT                   DIESILKYAKNRQQTLLFSATMPKPILRIGEKFMDHPKIVRIKAKELTADLIEQYFVRA
FT                   KESEKFDIMCRLIDVQGPDLALVFGRTKRRVDELTRGLQARGYNAAGIHGDLSQARRMS
FT                   VLKRFREGKLDILVATDVAARGLDISGVTHVYNYDIPQDPDSYVHRIGRTGRAGQNGIS
FT                   VTFVTPNEIGYMRTIEQLTKKKMSPLRPPTDDQALHGQLKQAKIEIEDLMNGDLGKYTQ
FT                   GASELLDNYSALDLVAAFLKNLAKDEVKVKITPEKPLPYKGDGRRRRGKGHGRSNNNHG
FT                   RDNHRRRNNNSYRQNGNRGKRGRGNGHEFVIKNKKD"
FT   CDS             279585..279941
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="LCRIS_00271"
FT                   /product="Holo-[acyl-carrier-protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49718"
FT                   /db_xref="GOA:D5H133"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D5H133"
FT                   /protein_id="CBL49718.1"
FT                   /translation="MIKGVGIDSIEVERVKKIVDKGDAFAKKVLTPKEFDQYQKMVGKR
FT                   KVEYLGGRFSLKESFSKAMRTGLGKYIGFQDVETLWDDLGHPVMTSTKFDGNIFPSITH
FT                   DNHEIITFVVLEEK"
FT   CDS             279946..281076
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="LCRIS_00272"
FT                   /product="Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00272"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49719"
FT                   /db_xref="GOA:D5H134"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H134"
FT                   /protein_id="CBL49719.1"
FT                   /translation="MVPGYHRPAVVKVNLGAIRRNIKNEMKHLATGQKMLAVVKANAYG
FT                   HGAVEVAKIAIEEGAAGLCVAILDEALQLRHADIVKPILVLGVVSPEYAPIAAANNVSL
FT                   TIPNLEWLKEAEKYLEKEQLQLKVHIGVDSGMGRIGFNEDEDFIAANKFLQNNDNFYVE
FT                   GMFAHFASADSADDTYFKHQVEKFAHMRSLLTVKPKWIHVDNTAASIFNKDVPSDCVRF
FT                   GIGIYGLNPSSNPDSPDLKSSISLEPALSFESELTHVKTIHEGDGVGYGSTFVADQDTI
FT                   IGTVPVGYADGFIRKFQGFKVKVGDEYCPIVGRICMDQFMVKMPKKMPLGTKVVIISND
FT                   PTAPNNIKAAADYVDTIHYEVACLLNDRLPRVYYEK"
FT   CDS             complement(281141..281848)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00273"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00273"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49720"
FT                   /db_xref="GOA:D5H135"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR017036"
FT                   /db_xref="UniProtKB/TrEMBL:D5H135"
FT                   /protein_id="CBL49720.1"
FT                   /translation="MLIKSLVIKKDYLTTVNEKATLAEALKVLEDSGYRCVPIVDDTGT
FT                   IFRGNIYKMHIYRHKSQGGDMNLPVTYLLKNATKTIKVNSPFFKVFFNIKDLPYIAVLD
FT                   EDNHFYGILTHSRMLDMLSDAWDVKNGSYVLTVLSDNTRGNLIKMSKIVSKHTNMSSVM
FT                   TLDAAAGELEGNFVRRTLFTLPAGVSDITMRTIVDKLQRKGFVVSEIEDLQAGMTIMSD
FT                   ENPGVFIEHPVKD"
FT   CDS             complement(282019..282990)
FT                   /transl_table=11
FT                   /gene="ldh1"
FT                   /locus_tag="LCRIS_00274"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00274"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49721"
FT                   /db_xref="GOA:D5H136"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/TrEMBL:D5H136"
FT                   /protein_id="CBL49721.1"
FT                   /translation="MPRDERPRKVILVGDGAVGSTFAFSMVQQGIAEELGIIDIAKEHV
FT                   EGDAIDLADATPWTSPKNIYAADYPDCKDADLVVITAGAPQKPGETRLDLVNKNLKILS
FT                   SIVEPVVESGFEGIFLVVANPVDILTHATWKMSGFPKDRVIGSGTSLDTGRLQKVIGEM
FT                   EHVDPRSVNAYMLGEHGDTEFPAWSYNNVGGVKVSDWVKAHGMDESKLEDIHKEVANMA
FT                   YDIINKKGATFYGIGTASAMIAKAILNDEHRVLPLSVPMDGQYGLHDIHIGTPAVVGRK
FT                   GLEQVIEMPLSDKEQELMTASADQLKKVMDKAFKETGVKVRQ"
FT   CDS             283127..283684
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="LCRIS_00275"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00275"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49722"
FT                   /db_xref="GOA:D5H137"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/TrEMBL:D5H137"
FT                   /protein_id="CBL49722.1"
FT                   /translation="MKIIAGLGNPGQKYDKTKHNTGFMTMDHYLNEKGLSLDKDKFEGH
FT                   WTKQKINGEDVILLEPQTFMNESGRSVSQVANFFKVDPADVLIIQDDMDMPIGKIRIRA
FT                   NGKSGGHNGIKSIIRDLGTEKFNRLKIGIRHPKNATVVSWVLTPFNDEQQKLMDDAFAT
FT                   SVDIIDDFISGHGSQYLMNKYN"
FT   CDS             283686..287180
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="LCRIS_00276"
FT                   /product="Transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00276"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49723"
FT                   /db_xref="GOA:D5H138"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H138"
FT                   /protein_id="CBL49723.1"
FT                   /translation="MRLTEILDKDQDLNNFISKTKQVKNSLITGTNAGAFSLLLKQITT
FT                   KLAAPLILIEENESKAQNLYGELSAIMADETVQIFPVDATIATQTAVSSPDELSSRIQA
FT                   LNFLLSGKAGIVVTTPQGLQYKLTNPTDFAQAKRSFEPGQEYELKELNEWLLASGYQRD
FT                   SLVARPGEFAIRGDILDVYPLDRENPVRIEFFGDEIDTIKEFDLASQRSQKELDKVEVA
FT                   AAQDRVFTKDAIAAAAKKIEQDMANAPAPAKAVKDHFAAVLDELNDGGLPKNYAFLIDY
FT                   LLEISSSLLEYLPKNGQILFDDLPLINQAVETVDKQNAAFINDELKTGAMLPGQSLRSD
FT                   YTKILSKDKHHRIYFSLFQRSMGRLRLGQMLNWSTREPEQFFSQMPLIKSELESYQKAG
FT                   QTVILQADNEKRAQQIDQTMVDFGLNLPIVGADEIVEQRTQIVVDGFVSGFSLPTVKLV
FT                   YLTERELFNKRPQRKKRIKTLENAQRLRNYTELKPGDYVVHVNHGIGRFEGIKTLENNG
FT                   TKRDYITITYQHGDQLFVPADQLSLVQKYVGSEGKTPHINKLGGSEWAKTKRKVQSKVE
FT                   DIADDLIELYAKRESEKGFAFSPDDDLQKQFEDAFPYPETPDQLRSVKEIKQDMESSKP
FT                   MDRLLVGDVGFGKTEVALRAAFKAIQDNKQVAFLVPTTILAQQHYETIQDRFKDFPVNT
FT                   AMLSRFQTPVESKEIIEGLKNGKVDLVVGTHRILSQDVKFKNLGLLIVDEEQRFGVKHK
FT                   EKLKQLKANIDVLTLTATPIPRTLHMSMVGVRDLSVMETPPQNRYPIQTYVMEQIPSVV
FT                   RDACLREMQRDGQVFYLHNRISDIDETVEKLQELMPQARIAAAHGRMSQNQLEDILYRF
FT                   LNREFDILVTTTIIETGIDMPNVNTMIIEDADHYGLSQLYQLRGRIGRSARLAYAYFLY
FT                   KPNKVLTEVGEKRLDAIRDFTELGSGFKIAMRDLSIRGAGNMLGAQQHGFIDSVGYDLY
FT                   SQMLADAIKQRKGKTTVKKSNAEIDLGLEAYIPDSYIGDQEEKIEFYKKIKAVSSQEEL
FT                   GKIEDELIDRFGDYPTAVENLLAVAGLKVDADMAQVLNVVKTDDKIKVEFTNAASRELE
FT                   GPNIFKALEHVSLKARISMNQEKRMVVLLLLPDKMKNRVLFNELATFLQAASDIVQR"
FT   CDS             287196..287468
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00277"
FT                   /product="RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00277"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49724"
FT                   /db_xref="GOA:D5H139"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:D5H139"
FT                   /protein_id="CBL49724.1"
FT                   /translation="MRIDKFLKVSRLVKRRTVAKEMADQGRIKVNGRVVKSSYDVKIDD
FT                   IIEVGYGAKTIKAKVLNIRETTKKAEASELYELAKCIIFCGKLNK"
FT   CDS             287566..288972
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00278"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00278"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49725"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:D5H140"
FT                   /protein_id="CBL49725.1"
FT                   /translation="MESIITDIVKIIKSENNVIAREKALMCYFFNLIRELMKLALEEVD
FT                   AGLVEETKKQGYQIEKKNKRSVVTVFGEISYWRRRYICPGKKAKYPLDELMGYDKYKRY
FT                   SVLAVKDVLQVSAVATYRNTALAVNTLSCFNISHSQVGKLIVQAGKLIKNQKQSEERYD
FT                   GITQRKKVPVLYLEGDGVVIKGTKKRLEFHRYQVCEDIINLSQKRRKRVQAKEFVSLSR
FT                   LDALQEIKTYLANTYDLSDTLIISNADGGAGYAKKDFDEIVGYCRQHEHFLDVFHLNKK
FT                   IKDRLSFMPAMQGKLISAVEFKYDRHLTDVILDTIESNLIDELNTPENHENLKLLRSYL
FT                   HRRWADIKPFKMRHLSVIKAIGCCESNHRKYTYRVKGQGKYWSEDGAEGILRVLTCIKN
FT                   NELEYWLSSEFAGGQLDIGDQEELKGAVRTSLRKMHETHLGIHHGIIESLTAGHSYLND
FT                   FGREINQINI"
FT   CDS             289112..289489
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00279"
FT                   /product="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00279"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49726"
FT                   /db_xref="GOA:D5H141"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H141"
FT                   /protein_id="CBL49726.1"
FT                   /translation="MNHGPRIYNSLSPEEQRARLRRKQAKLEKETHRKRLNVIMAVFAI
FT                   IFVALGVQIAIKISQTGRLNNQVQAEKQTLTKVKNKRNDLETEKQDLKDPNYVAKLIRY
FT                   KFYYSKSNEKIYNVHERNDDN"
FT   CDS             289489..289851
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00280"
FT                   /product="Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49727"
FT                   /db_xref="GOA:D5H142"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D5H142"
FT                   /protein_id="CBL49727.1"
FT                   /translation="MEKYQAGNRVTGVINNITDLGIFVTLPNRHSGLVHHSDFGNNWLR
FT                   ERRRYHVGDEVRVVVVHIHKGRFNLSITRVNDPELVDHDNQFSKTKPADFDQVLNQTTR
FT                   DAKEEIEKLKQVLTEN"
FT   CDS             289890..291143
FT                   /transl_table=11
FT                   /gene="mesJ"
FT                   /locus_tag="LCRIS_00281"
FT                   /product="Cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00281"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49728"
FT                   /db_xref="GOA:D5H143"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5H143"
FT                   /protein_id="CBL49728.1"
FT                   /translation="MKINDFFEQHQIDLKDKRLLVAASAGPDSMALLDMLVNLQKQLSF
FT                   TVFAAHFDHQLRADSSYEVEVLQNYCAQKKICLFNGKWDKHDQPQTGIEAAAREARYHF
FT                   LTNVAHSERMNYLLTAHHGDDLLENILLKFIRSGNPEEMNSLQDIGSMHGVVLLRPLLA
FT                   YSKQELLEYDQEREIDYVIDSTNTEDETVRNRLRHHVVPLLKEENPNLISNALRFSEKM
FT                   SQLTDLADEQLNSMRTVEPFLGAWRIKTDNLNDLSTEEKNIFWQKIIWQKYHRRVNENL
FT                   GNFEVIDYQGYSYLVENKPQKIVQPFSIELNQQFEFNGAYYLLTTDRQADLKKIGSFWL
FT                   ERDAHFTAGSLVPASKLLLKNGQRVKAKKKFAEKAIPFALRSCCISIYAENEPVFVEKC
FT                   YQKQDFITDGKHYFLYIY"
FT   CDS             291238..293406
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="LCRIS_00282"
FT                   /product="Cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00282"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49729"
FT                   /db_xref="GOA:D5H144"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H144"
FT                   /protein_id="CBL49729.1"
FT                   /translation="MKNNRNRLLSNGLFYIVVFLLLLWGINWALGGSNNSGSSENISYS
FT                   QFVKDLRQGKVKNFSVQPANGVYTVSGSYKTAQTTKNQSNNSFDFFSNNSSRKVSRFST
FT                   TMLQNDSTVSNVQNLAQKSNARMTTQGESQSGNWISTIVMLVPTVLFIVMLWMMMNQGG
FT                   AGRGGGGGIMNFGRSHVKPEDPSKNKVRFSDVAGEEEEKQELVEVVEFLKDPSKYTKLG
FT                   ARIPSGVLLEGPPGTGKTLLARAVAGEANVPFYSISGSDFVEMFVGVGASRVRDLFNNA
FT                   KKNAPSIIFIDEIDAIGRRRGNGTGGGNDEREQTLNQLLVEMDGFEGDEGVIVIAATNR
FT                   SDVLDPALLRPGRFDRKVLVGRPDVRGREAILKVHAKNKPLAPDVDLKEVARQTPGFVG
FT                   ADLANVLNEAALVAARRNGTEITASDIDEAEDRVIAGPAKKDRLISEKERRRVAFHEAG
FT                   HSICGLVLSDSRTVRKVTIVPRGRAGGYNIMLPKDDQFILTKKQLFEQIVGLMGGRAGE
FT                   EATIGDKSTGASNDFEQATQIAHSMVVNYGMTESLGMVELEKEGESNPYGFKPYSEATS
FT                   AKIDEAVKKILDEAHAKALEIVKDNKEKHRIIAEALLKYETLNEKQIMALYKTGKMPEK
FT                   DEDEYPSESKASTYEEAKAAAEKREVEKAEKKDSDQALADQEKDTLETPSEKNHEVEEN
FT                   NPENPEKDQSENETSTQDTPADDEHKDN"
FT   CDS             293459..294349
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="LCRIS_00283"
FT                   /product="33 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00283"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49730"
FT                   /db_xref="GOA:D5H145"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D5H145"
FT                   /protein_id="CBL49730.1"
FT                   /translation="MSDYLVKSIDKTKNLRLLTITAKGVVSEAQKRHDLWSASAAVLGR
FT                   TLVGSLLLAGAELTDKEELTVRLLGNGPVGPTIVTATSDLKVKGYVKNPHIALPPKKNG
FT                   HIDVKKAVGQGWFEVTKDLGLKEPYTGQVPIVSGEIAEDFAYYLTKSEQIPSAVGLSVF
FT                   VNPNNSIGEAGGFMLQALPGASDALIDETIKRIDALPALSTSFLDGMTPEDLARKILGT
FT                   DCKILEKDDVAFNCDCSKEKYAGILETLKSDQLEAMINEDHGAELTCNFCGNKYHYSED
FT                   ELKDILAKKNKDKDY"
FT   CDS             294427..295452
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="LCRIS_00284"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00284"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49731"
FT                   /db_xref="GOA:D5H146"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:D5H146"
FT                   /protein_id="CBL49731.1"
FT                   /translation="MNNSWKIRDITIPNRVVVAPMAGVSNSAFRVVCKEFGAGLVVCEM
FT                   ISDHGIIYGNKKTLSMMDVDPREHPMSIQIFGGSEETLLQAAQYIDQHTDADIIDINMG
FT                   CPVPKVTKTDAGSKWLLDSNKIYQMVHAVVQNVKKPVSVKMRTGWDKKHIFAVENALAA
FT                   QEAGASMIAMHGRTRKQMYQGEADWEVLHDVAQVLDVPFVANGDIRTPELAKKALDEIG
FT                   CTAVMVGRAALGNPWILKDMVHYLETGEKLQPQTVREKVETAKHQLHALVKIHGEKRAV
FT                   PEFRQQAAYYLKGIPRSARTRAKINEVWTRQEVYDLLDNFVDEYEKREEARAARRAVMN
FT                   K"
FT   CDS             295468..297015
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="LCRIS_00285"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00285"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49732"
FT                   /db_xref="GOA:D5H147"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D5H147"
FT                   /protein_id="CBL49732.1"
FT                   /translation="MAKNEMNDQLIVRRQKMEELRENGIEPFGRRKFDRQDLASTLEEK
FT                   YGNEDKEELNADMPKTKIAGRMLAKRGKGKVGFADLYDRTGKIQIYVRKDIVGEDNYKI
FT                   FKKSDIGDFLGIEGEVMKTDTGELTIRALHVTFLSKALRPLPDKYHGLKDVEAIYRQRY
FT                   LDLITNHDSYMRFVHRTQIIQAIRDYLNGQNFLEVETPVLHNIPGGAEARPFITHHNAL
FT                   DINLYMRIALELPLKRLIVGDMERVYEIGRVFRNEGLDTHHNPEFTELESYAAYWDYHD
FT                   VMDEAEGIIRAAAKVVSDDGKITYQGTDIDLGKPFRRVHMVDLIKEKTGVDFWKPMTLE
FT                   EATKIAEDHDIHVEKFWKVGHIINAFFEKYCEETIVDPTFVYGHPVEISPLAKKNADDP
FT                   RFTDRFEIYIMGEEYGNAFSELNDPDDQRERFEAQMEEREAGNDEADMIDEDYLRAMEY
FT                   GMPPTGGLGIGIDRLVMLLTDAPAIRDVLLFPTMRPERVESVEAEVKADMAKKNKKD"
FT   CDS             297354..297914
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00286"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00286"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49733"
FT                   /db_xref="UniProtKB/TrEMBL:D5H148"
FT                   /protein_id="CBL49733.1"
FT                   /translation="MKKNKFKQKIKQISVVSLVGLALSPLLSSTSVVLADEVDHQNDSN
FT                   YTTISVGDLLSQFRNTSTSSNLPVNKENELTNLKEQFQLSDEDANFLKQQYLKNHPNDP
FT                   LASSKWKTAAAKAAAKVAVPILKKFAKKAGVKLGDRAIENVIAIITGVEDNVQGRLYKA
FT                   LRNMGFSKYWAGVASRAITFVLF"
FT   CDS             298495..298965
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00287"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00287"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49734"
FT                   /db_xref="UniProtKB/TrEMBL:D5H149"
FT                   /protein_id="CBL49734.1"
FT                   /translation="MRWTYLIWACALIVGIAIGLIVRKNRRSRFSQKQLEIKRRSFEYA
FT                   FIAVFIFEAFLMALHSFNVEIPFYWLTLGPLFIAVLVAEIYDLIHRVYLPINPRIKGSG
FT                   WAWTFIVIGILLIIPSVLKIFDHSFNSNMLVNLLLAIVIIGYGIGILQARKS"
FT   tRNA            299102..299176
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="LCRIS_02042"
FT                   /product="transfer RNA-Gly"
FT   CDS             299388..301247
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00288"
FT                   /product="5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00288"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49735"
FT                   /db_xref="GOA:D5H150"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5H150"
FT                   /protein_id="CBL49735.1"
FT                   /translation="MTQSKRFLAVALASVALLGLGLKENEVVNAASVKVVTNHDPYAKP
FT                   QQTKDWANAKKYKNYLPVQFLGINDFHGGLERTYTANIDGHSYKNAGGAARLASYLNDA
FT                   QGYFKKANPKGKTFRVEAGDMVGASPANSALLNDEPTMHVLRQMNFSVGTLGNHEFDHG
FT                   LAEFHRILIGTKPNMNEASKYGYTSILKDYPHQNSKIQVVIANVVNRSNGKIPFGFKPY
FT                   TIKTVKQGKKSVKVGFIGILTTTMPSLTTYNNYHPYRYLDEAKTIAKYEKILRNKGVKA
FT                   IVVLAHTGANSADNQTTGASVDILKKLYKIDPHNSVDLYIAAHSHQYANATVGHTKLMQ
FT                   AIYSGAAFDNAIGYLNPKTHDFAKNSLVGHVYPVQSASAEPTIKDNAKVAAIVKDADKR
FT                   TDALANEKIGQASLAETILSGRGHSLYSEESPAGNLAVDAQLYETNKLVKEKHAKYTVN
FT                   FAMTNTGGVRSDLVVGKDKSITLGAARAVQPWYNDLYVISMTGQQIYNVLNQQNYNGET
FT                   RYLLISGMKLKYTETNSGANRYHVSEVIDNATGKPLDSNKRYNIVVNSFLHDGGDNFTE
FT                   FRKAKLVDNQIGKDTDFLVQYIKDMSKDGNSLVAPTADRKQKQ"
FT   tRNA            301350..301424
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="LCRIS_02043"
FT                   /product="transfer RNA-Gly"
FT   tRNA            301536..301610
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="LCRIS_02044"
FT                   /product="transfer RNA-Gly"
FT   tRNA            301648..301721
FT                   /gene="tRNA-Pro"
FT                   /locus_tag="LCRIS_02045"
FT                   /product="transfer RNA-Pro"
FT   CDS             301796..302251
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00289"
FT                   /product="GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00289"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49736"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5H151"
FT                   /protein_id="CBL49736.1"
FT                   /translation="MTATTEEKYKLLVEQARALIEGEDDWIANTANLSALLFNSLNDVN
FT                   FAGVYRYENDELILGPFQGMPACVHIQMGKGVCGTAAQAKTTQIVKDVHEFAGHIACDS
FT                   ASNSEIVVPIFNQGKLWGVFDFDSTKLANFDEIDKKYLTEIAKAIFA"
FT   CDS             302356..304836
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="LCRIS_00290"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49737"
FT                   /db_xref="GOA:D5H152"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:D5H152"
FT                   /protein_id="CBL49737.1"
FT                   /translation="MENSYSKSVNQVLKIAREQAQNFHHRLIGTEHVLLALVIETDGEA
FT                   GKILRSWGLTPTAVREEIERYTGYGSAPKTSYMEMSPRLSLALDYARRRANDDGVKEIN
FT                   TNHVLLGITASEQVLSAMILKNLNVDIPRLQQDVEDSLSQDQDFGDSANWLGDDNTTTG
FT                   QKKRKSTTPNLDKVAVNLNQRVRNGEIDPVIGRDQEIKRVIQILSRRTKNNPVLVGEPG
FT                   VGKTAVAEAIATEIVNKKVPQDMLKKRVMALNLGSLVAGTKYRGEFEDRMKKILNEVTK
FT                   DGNVILFVDEMHTLIGAGGAEGAIDASNILKPSLARGDIQMIGATTFNEYQKYIEKDQA
FT                   LARRFQQVRLSEPSRDDTLTIMRGLKSKYEKFHHVTISDESLKDAVDLSTRYISDRFLP
FT                   DKAIDLVDEAGAAVKIRNNVGNDAKLEKINEQIKEIIAQKNEAAASQNFVKAAQLQDQQ
FT                   NNLQMQREAMVEKLEDKVSAKAVVEPEDIAKVVSEWTGVPVTQMKRNESRQLANLEKIL
FT                   HQRVIGQDKAVSAVARAIRRSRSGIKDERRPIGSFLFLGPTGVGKTELAKSVAAAMFGS
FT                   EDNLVRLDMSEYMDQIASSKLIGSAPGYVGYEEGGQLSEKVRRHPYSVILLDEVEKAHP
FT                   DVFNLLLQVLDEGFLTDSKGRKVDFRNTIIIMTSNLGSRSLFDNKAVGFNADNVDPAKA
FT                   RSAKVEQAIKQFFRPEFLNRIDETIIFDELDKKQLRNIVTLLTHKLVVRLQKKGIELKL
FT                   SRAALDQIAQDGYDPENGARPLRRAIQNDIEDKIAEMLIVGEIKSGDTLKIGSQHGHLK
FT                   FEVVNPKKETVKVK"
FT   CDS             305058..308696
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LCRIS_00291"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49738"
FT                   /db_xref="GOA:D5H153"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="UniProtKB/TrEMBL:D5H153"
FT                   /protein_id="CBL49738.1"
FT                   /translation="MLNGHVVNYGKHRTRRSFSRIKEVLKLPNLTDVQTESYKWFLDKG
FT                   IKEVFDDIMPISDFSGKLSLEYVGYKLQKPKYTVDEARNHDATYAAPMHVTLKLTNQET
FT                   GEIKTQDVFFGDLPLMTESGSFIVNGAERVIVSQLVRSPGVYYTGDYDKNGRQIFGTTV
FT                   IPNRGAWLEYETDAKNVSFVRVDRTRKLPLTVLIRAMGIGSDSDIIDMFGQSDTLQFTL
FT                   DKDVHKNPADSRVAEALKDIYERLRPGEPKTTDSSRSLLYARFFDPRRYDLAPVGRYKI
FT                   NKKLSLKNRLYGQTLAETLADPDTGEIVAKKGTVVTHEVMDKLAPYLDRDDFKMVTYQP
FT                   SKEGVLPDPITVQEIKVYSKVDPEREVKLMSNGHIADNVKHLTPADVLASINYFFALQD
FT                   EIGTTDDIDHLGNRRIRRVGELLQNQFRIGLARMERVVRERMSIQDPSTVTPQQLINIR
FT                   PIVASIKEFFGSSQLSQFMDQHNPLGELTHKRRMSALGPGGLTRDRAGYEVRDVHYTHY
FT                   GRLCPIETPEGPNIGLINSLASYAIINKYGFIETPYRRVSWKDHKVTDKIDYLTADEED
FT                   NYIIAGANTPLNDDGSFKEKLILARQKEDNVEVSPDKIDYMDVIPKQVVSVASACIPFL
FT                   ENDDSNRALMGANQQRQAAPLINPHGSLVGTGMEYRAAHDSGAALIAKAAGVVEYVDAN
FT                   EIRIRREDGTLDKYTLEKYRRSNNSKSYNQTPNVKLGDHVDKSDVIANGPTMDHGELAL
FT                   GQNPLIAFMTWNMYNYEDAIMLSERLVKDDVYTSISIEDYESEARDTKLGPEEITRELP
FT                   NIGEDALKDLDADGIVRVGAEVHDGDILVGKVTPKGVTELSAEERLLHAIFGEKAREVR
FT                   DTSLRVPHGGGGIVQDVKVYTREAGDELSPGVNTMVRVYIAQKRKIQVGDKMSGRHGNK
FT                   GTVAAVVPEEDMPYLPDGTPVDICLNPMGVPSRMNIGQLLELHLGAAARQLGIHVATPV
FT                   FDGADENDVWDTVRQAGVDKDGKTVVYDGRTGEPFHNRVSVGVMHYLKLTHMVDDKIHA
FT                   RSIGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDVVGRVKA
FT                   YEAIVKGEKIPKPGVPESFRVLVKELQSLGLDIRVLDMNHNEIELRDMDEDSSEHLNID
FT                   TLSRMAEEQEKKKLAEETGKSEDKDSKENADKPVAPADESDDKVSK"
FT   CDS             308712..312371
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="LCRIS_00292"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00292"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49739"
FT                   /db_xref="GOA:D5H154"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="UniProtKB/TrEMBL:D5H154"
FT                   /protein_id="CBL49739.1"
FT                   /translation="MIDVNKFESMQIGLASPNKIRSWSYGEVKKPETINYRTLKPEKDG
FT                   LFDERIFGPTKDWSCACGKYKGVRYRGIVCDRCGVEVTSSKVRRERMGHIELAAPVTHI
FT                   WYFKGIPSRMGLVLDISPRLLEEVIYFAAYIVIDPGDTDLEPKQLLTEAEYREQKAKYG
FT                   NRFEAKMGAEAVRDLLKKVDLDKEVKDLKKELQTATGQKRTRAIRRLDILDAFKNSGNK
FT                   PEWMVMDAVPVIPPDLRPMVQLEGGRFATSDLNDLYRRVINRNNRLKRLLDLNAPNIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVVGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIDVSPKLKFYQCGVPRPMALELFKPFVMHELVKRGIASNIKNAKRKIDREDDDIWD
FT                   VLEDVIKERPVLLNRAPTLHRLSIQAFEPILVPGKSIRLHPLACEAYNADFDGDQMAIH
FT                   VPLSDEAVAESRLLMLAAHHILAPKDGKPIVTPSQDIVLGNYWLTQAERGREGEGMIFS
FT                   SPAEAAVAYENGDIHYHTIIGMSADAMPKKPWPKGHEHGIFITTYGKIVFNQLFPDDYF
FT                   YINEPTEENLNNPLDAKYFLGEGEEIDKKIDEVGDDLIASPFKGSFLSDSIATIYKYYK
FT                   VQRTSEYLDDLKKLGYTSSTTSGITIGMTDVPEIQDKDEKVAKARKQVDVVSKQFRRGL
FT                   ITEQERHDRVISIWNACKDKIQNEIAQIHAPRNPISIMADSGARGNISNFTQLAGMRGL
FT                   MATPNGGLFEIPVTSNFKEGLSVLELFMSTHGARKGMTDTALKTAQSGYLTRRLVDVAQ
FT                   DVIIRDDDCGTDRGITVSAIMEGDEMIEPLFDRLVGRFTAETVKDPETGETIVGRDVMM
FT                   DENMAHKICDAGVTHVKIRSILTCDTPHGVCRKCYGMNLATGEEVEVGEAVGTVAAQSI
FT                   GEPGTQLTLRTFHNGGVAGAEDITQGLPRVQELFEARNPKGRATISEVDGVIDSIQENP
FT                   AEHTREITVKGKIDTRSYSVPYTASVAVSEGDYVHRGDKLTLGSVDPKELIQVTDTLTT
FT                   EKYILAEVQKAYRMQGVDIADKHVEVLTRQMLQKVRVLDPGETDILPGEVMDIGQFRDR
FT                   NKEVIISGGIPATAQSVILGITKAALETNSFLSAASFQETTRVLTDASIRGKNDPLLGL
FT                   KENVIIGKIIPAGTGMPVYRSMEPEADVKKPDSVYSIADIEKQMKEKDKAKQD"
FT   CDS             complement(312434..313117)
FT                   /transl_table=11
FT                   /gene="comC"
FT                   /locus_tag="LCRIS_00293"
FT                   /product="Type IV prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00293"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49740"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:D5H155"
FT                   /protein_id="CBL49740.1"
FT                   /translation="MKYLFIFTNFIIGSCLASHAAVVYEHWNDKNFIYSRSQCNNCHLE
FT                   LSILDEIPLLSYLFLQGKCRYCYQQIPVELFLFELIGGFAFCLLDFSKTQDIITAILLF
FT                   SLLVVAISDYQKQEFDLLLLIPAISVAILFNQFAAFTLIDWISFTLLLGIFSYSIMQRK
FT                   MGLGDLLIYLIIACYFTPSFANLVFLFASILVIAIFLIEKTPINHRYPFIPYIFLGLVL
FT                   TQLIF"
FT   CDS             313299..313706
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="LCRIS_00294"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00294"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49741"
FT                   /db_xref="GOA:D5H156"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5H156"
FT                   /protein_id="CBL49741.1"
FT                   /translation="MPTINQLVRKGRHSKVTKSKSPALNYSYNSMKKESVFNPAPQMRG
FT                   VATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGEGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDGRKQSRSKYGTKKD"
FT   CDS             313722..314192
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="LCRIS_00295"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00295"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49742"
FT                   /db_xref="GOA:D5H157"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="UniProtKB/TrEMBL:D5H157"
FT                   /protein_id="CBL49742.1"
FT                   /translation="MPRKGHVTKRDVLADPVYNSKLVTKLINHLMVDGKRAKASSILYD
FT                   AFNIVQDKTGKEPLDVFEEAMNNVMPVLEVRARRIGGSNYQIPVEVRPERRTTLGLRWL
FT                   VSYARLRNEHTMDERLANEIIDASNNTGSAVKKREDVHRMAEANRAFAHYRF"
FT   CDS             314226..316319
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="LCRIS_00296"
FT                   /product="Elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00296"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49743"
FT                   /db_xref="GOA:D5H158"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H158"
FT                   /protein_id="CBL49743.1"
FT                   /translation="MANKREFPLAKTRNIGIMAHIDAGKTTTTERILYYTGKIHKIGET
FT                   HEGDSQMDWMDEEKERGITITSAATTAQWKDHRINIIDTPGHVDFTIEVERSLRVLDGA
FT                   VTVLDAQAGVEPQTENVWRQAETYGVPRIVFVNKMDKIGADFDKSVKSLHERLNANAHA
FT                   VQMPIGSADTFEGVIDLINMVADIYDEDKLGSKWDTVPVPDEYKEEAEARRNDLIEAVA
FT                   DVDDGIMEKFLGGEEISNDELKAAIRKATLDLKFFPVYAGSAFKNKGVQMMLDGVIDYL
FT                   PSPLDVKPYVAHNPKTGDEVELMADDKKPFAALAFKIATDPFVGRLTFIRVYTGSLESG
FT                   SYVLNASKNSRERVGRLLQMHANSRTEIPEVFSGDIAGAIGLKNTTTGDSLTDPDHPLI
FT                   LESLKVPDPVIQVSVEPKSKADRDKMDVALQKLTEEDPTFRAETNPETGQTLISGMGEL
FT                   HLDIMVERMRREFNVDAKIGEPQVAYRETFTKEAKAQGKFVRQSGGKGQYGDVWIDFTP
FT                   NEEGKGYEFEDAIVGGVVPREFIPSVDQGLQEAMKNGVLAGYPLIDVKAKLYDGSYHEV
FT                   DSSEAAFKVAASLALKNAASKAGAVILEPIMKVQVTTPEEYLGDVMGSITARRGTMEGM
FT                   EDRAGAKIINSFVPLSEMFGYATTLRSSTQGRGTFTMVFDHYSPTPKSIQADIIKKRGG
FT                   DAE"
FT   CDS             316635..316943
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="LCRIS_00297"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00297"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49744"
FT                   /db_xref="GOA:D5H159"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/TrEMBL:D5H159"
FT                   /protein_id="CBL49744.1"
FT                   /translation="MASQTIRIRLKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTE
FT                   RTLFTVLRSPHKNKDSREQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL"
FT   CDS             316967..317605
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="LCRIS_00298"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00298"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49745"
FT                   /db_xref="GOA:D5H160"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D5H160"
FT                   /protein_id="CBL49745.1"
FT                   /translation="MTKGILGRKVGMTQIFTKDGVLVPVTVVEATPNVVMQVKTVESDG
FT                   YEAVQLGYQDKREVLSNKPEKGHADKAKTSPKRFIREIRGVELKDYEVGSEVTVDTFKE
FT                   GDVVNVTGTSRGHGYQGNIKRWGQSRGPETHGSRYHRIPGSMGSIINRVPKGKRLPGHM
FT                   GVKKVTIENLVIEKVVADKNVLMIKGNVPGAKNSLIVVKTASKAVKADK"
FT   CDS             317620..318237
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="LCRIS_00299"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00299"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49746"
FT                   /db_xref="GOA:D5H161"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D5H161"
FT                   /protein_id="CBL49746.1"
FT                   /translation="MANLKVMDQNGKDSGEVTLNDKVFGIEPNESVVFEAIIRQRAGKR
FT                   QGTSKVKNRSAVRGGGKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYTMPRK
FT                   QRRLAIKSVLSQKLIDNDLIVLDKLTMSAPKTKELVSMLNGLNADGKVLIVSDDNNVQL
FT                   SARNLTKVKVVPVNGLNVEDAVNYGKLILDQDAVKKIEEVLA"
FT   CDS             318237..318542
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="LCRIS_00300"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49747"
FT                   /db_xref="GOA:D5H162"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D5H162"
FT                   /protein_id="CBL49747.1"
FT                   /translation="MDARDIILRPVITEKSTNLMDDKKYTFDVLLTATKTQVRNAVEEI
FT                   FDVKVKNVNIMNVRGKDKRVGRYTGKTARRRKAIVTLTNDSNDIKIFQDDNTEDNK"
FT   CDS             318558..319394
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="LCRIS_00301"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00301"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49748"
FT                   /db_xref="GOA:D5H163"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D5H163"
FT                   /protein_id="CBL49748.1"
FT                   /translation="MAIKIYKPTTNGRRHMTSSDFAEITKTKPEKTLLESQSHTAGRNS
FT                   YGHITVRHRGGGHKQKYRIIDFKRNKDNAKAVVKAIEYDPNRTANIALLHYTDGIKAYI
FT                   LAPKGLKVGDVVESGDSVDIKPGNALELKNIPTGTSIHNIELKPGKGGQLVRSAGASAQ
FT                   VLGADGDYTLVRLQSGEVRKILSSCRATIGTVGNEQHSLIQLGKAGRKRWLGKRPQSRG
FT                   SVMNPNDHPHGGGEGKAPVGRPQPMTPWGKKARGIKTRDTKKASEKLIIRHRKGSK"
FT   CDS             319413..319697
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="LCRIS_00302"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00302"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49749"
FT                   /db_xref="GOA:D5H164"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D5H164"
FT                   /protein_id="CBL49749.1"
FT                   /translation="MSRSIKKGPFADASLLKKVDAQADADKKQVIKTWSRRSTIFPSFV
FT                   GLTIAVYDGRKHVPVYVTEDMVGHKLGEFVPTRTFHGHKSTDDKATTQA"
FT   CDS             319717..320070
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="LCRIS_00303"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00303"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49750"
FT                   /db_xref="GOA:D5H165"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="UniProtKB/TrEMBL:D5H165"
FT                   /protein_id="CBL49750.1"
FT                   /translation="MAEQISSAKAEARTVRIAPRKARLVVDLIRGKSVAEALAILEFTP
FT                   RAASPIVEKVLRSAIANAEHNYDLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKR
FT                   TSHVVVVVSEKND"
FT   CDS             320084..320758
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="LCRIS_00304"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00304"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49751"
FT                   /db_xref="GOA:D5H166"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/TrEMBL:D5H166"
FT                   /protein_id="CBL49751.1"
FT                   /translation="MGQKINPNGFRLGVIRDWESKWYADKGYKETLNEDLQIRKFISEK
FT                   LKDASVSTVEIERAANRINISIHTAKPGMVIGKGGSEVEALRKQLNALTGKQVHINIVE
FT                   IKKPDLDAKLVADSIARQLEARIAFRRAMRQATQRAMRAGAKGIKVQTSGRLNGADMAR
FT                   REWHTEGRVPLQTLRADIDYAWVNAFTTYGEIGVQVWINRGEILPTRKDKPASKPAKGG
FT                   NR"
FT   CDS             320758..321198
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="LCRIS_00305"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00305"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49752"
FT                   /db_xref="GOA:D5H167"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/TrEMBL:D5H167"
FT                   /protein_id="CBL49752.1"
FT                   /translation="MPLVPKRVKHRREFRGKMRGAAKGGKYIAFGEYGLEALESHWITN
FT                   RQIEAARVAMTRYMKRGGKVWIRIFPQKSYTAKGVGVRMGSGKGAPAGWVAVVKREKIM
FT                   FEIGGVDEATAREALRLASTKLPIKTKFVTRSSEVGGESNEG"
FT   CDS             321188..321385
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="LCRIS_00306"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00306"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49753"
FT                   /db_xref="GOA:D5H168"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/TrEMBL:D5H168"
FT                   /protein_id="CBL49753.1"
FT                   /translation="MKAKDIRALTTDEMLEKEKQYKEELFNLRFQQATGQLENTARLSK
FT                   VRKNIARIKTILSEKALENN"
FT   CDS             321404..321670
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="LCRIS_00307"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00307"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49754"
FT                   /db_xref="GOA:D5H169"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D5H169"
FT                   /protein_id="CBL49754.1"
FT                   /translation="MSETNERNRRHVYQGRVVSDKMDKTIVVVVDTYKNHPVYNKRIRY
FT                   SKKYYAQDENNEAKVGDTVRIMETRPLSRKKRFRLVKIVKKSV"
FT   CDS             321702..322070
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="LCRIS_00308"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00308"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49755"
FT                   /db_xref="GOA:D5H170"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:D5H170"
FT                   /protein_id="CBL49755.1"
FT                   /translation="MIQNESRLKVADNSGARELLVIRVLGGSKRKTGNIGDIVVCTVKQ
FT                   ATPGGVVKKGDVVKAVIVRTKSGARREDGSYIKFDENAGVIINADKSPRGTRIFGPVAR
FT                   ELRENDFMKIVSLAPEVL"
FT   CDS             322090..322326
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="LCRIS_00309"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00309"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49756"
FT                   /db_xref="GOA:D5H171"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:D5H171"
FT                   /protein_id="CBL49756.1"
FT                   /translation="MFVKTGDKVKVIAGKDKGKEGTVLSVNVKKNRVVVKGVNKIKKHQ
FT                   KPSQSNANGGVVESEGSIHASNVKVISSKKEDK"
FT   CDS             322341..322883
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="LCRIS_00310"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49757"
FT                   /db_xref="GOA:D5H172"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D5H172"
FT                   /protein_id="CBL49757.1"
FT                   /translation="MASYLAKEYNEKVAPALEEKFNYKSSMQVPKIDKIVLNMGVGDAV
FT                   SNAKNLDEAVEELTLISGQKPLITKAKKSIANFRLREGMSIGAKVTLRGDRMYDFLYKL
FT                   INVSLPRVRDFRGVSTRSFDGRGNYTLGIKEQLIFPEIDFDKVNRTRGLDIVIVTTANT
FT                   DEEARELLTQFGMPFAR"
FT   CDS             322896..323081
FT                   /transl_table=11
FT                   /gene="rpsZ"
FT                   /locus_tag="LCRIS_00311"
FT                   /product="30S ribosomal protein S14 type Z"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49758"
FT                   /db_xref="GOA:D5H173"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D5H173"
FT                   /protein_id="CBL49758.1"
FT                   /translation="MAKTSQKIKNRRPAKFSSREYTRCERCGRPHSVYRKFGLCRICLK
FT                   ELAHKGQIPGLKKASW"
FT   CDS             323106..323504
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="LCRIS_00312"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00312"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49759"
FT                   /db_xref="GOA:D5H174"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:D5H174"
FT                   /protein_id="CBL49759.1"
FT                   /translation="MVMTDPIADYLTRIRNANMAKHDSVEIPASNIKKSISEILKREGF
FT                   IRDYEVADDNKQGVIKVFLKYGPNGERVISGLKRISKPGLRNYVGAEDLPKVLNGLGIA
FT                   IVSTSAGVITDKEARQKNVGGEVIAYIW"
FT   CDS             323529..324059
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="LCRIS_00313"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00313"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49760"
FT                   /db_xref="GOA:D5H175"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H175"
FT                   /protein_id="CBL49760.1"
FT                   /translation="MSRIGLKTIEVPDSVTVTKEGDNITVKGPKGELTRYFDPKIKFEQ
FT                   KDGEINFSRSSESDKALHGTERANLASMIEGVVDGYKKTLKLIGVGYRAQAQGNKITLN
FT                   VGYSHPVVLTAPEGVSVKATSATDVEVEGVSKQDVGQFAAEIRAVRPPEPYKGKGIRYV
FT                   DEYVRRKEGKTGK"
FT   CDS             324086..324442
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="LCRIS_00314"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00314"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49761"
FT                   /db_xref="GOA:D5H176"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D5H176"
FT                   /protein_id="CBL49761.1"
FT                   /translation="MISKPDKNKLRLKRHRRIRGKISGTAERPRLSIFRSNKNIYAQLI
FT                   DDVAGVTLASASTLDENVSDATKVEQAAAVGKAIAEAAKAKNISTVVFDRSGYLYHGRV
FT                   QALADAARENGLDF"
FT   CDS             324460..324966
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="LCRIS_00315"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00315"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49762"
FT                   /db_xref="GOA:D5H177"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5H177"
FT                   /protein_id="CBL49762.1"
FT                   /translation="MANRNDSRNNRRNKDDIEDQLVAVNRITKVVKGGRRMRFAALVVV
FT                   GDKKGRVGFGTGKAQEVPEAIRKAVEDGKKKMINVPKVGTTIPHEVIGHYGSGNILLKP
FT                   AEAGSGVAAGGAVRIVMDMAGISDVTSKSLGSNTPINVVRATIDGLKKLRTSEEVAKLR
FT                   QPERA"
FT   CDS             324984..325169
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="LCRIS_00316"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00316"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49763"
FT                   /db_xref="GOA:D5H178"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H178"
FT                   /protein_id="CBL49763.1"
FT                   /translation="MTDLKITLIRSVAHRLPQQRKIVKALGLGRVDSTVVLPDNAATRG
FT                   ALLKIAHLISVEEINK"
FT   CDS             325193..325633
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="LCRIS_00317"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00317"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49764"
FT                   /db_xref="GOA:D5H179"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/TrEMBL:D5H179"
FT                   /protein_id="CBL49764.1"
FT                   /translation="MKLHELHSAEGSRRNRKRVGRGTSSGYGKTSGRGQKGQLARQGGH
FT                   TRLGFEGGQMPLFRTMPKRGFKNINRKEYAIVNLDDLNKFEDGSEVTVESLKDNGLVKK
FT                   ELSGVKLLGKGELKVKLTVKVNKVSASAKQAVEAAGGTVEVI"
FT   CDS             325633..326928
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="LCRIS_00318"
FT                   /product="Preprotein translocase secY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00318"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49765"
FT                   /db_xref="GOA:D5H180"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:D5H180"
FT                   /protein_id="CBL49765.1"
FT                   /translation="MFSTLKNAFKDKEIRNKLYFTLFILLLYRIGANITVPGVNAKAIT
FT                   QVAQTGLVPMLDTVSGGGLDNYSIFSLGVSPYITAQIVIQLLQMDIVPTLVEWGKQGEV
FT                   GRRKTNQVTRYLALVVAFIQSIGITLGFNALTQMGLVKNQTPQTYIEIAIVMTAGTMLL
FT                   TWLGDEITDKGLGNGISVIIFAGIIARLPSGLWQIYKEEIINNSASDRWQGILFFIAVI
FT                   VAILIVTQFVTWVEQADRRIPIQYTRRATMSGSESFLPLKVNVSGVIPVIFASSFIVTP
FT                   ATILMAFQRTQGDQQWFKVMNQIFSLQTTPGVIIYTLLIILFTFFYAFVQVNPEKLAEN
FT                   LQKQGAYIPSVWPGKDTQDYISKMLMKLSTVGSLFLGLVALLPQLATNFWNLPSSIGLG
FT                   GTSLLIVIGVVLELSRQINGLLMKREYVGFIR"
FT   CDS             326939..327595
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="LCRIS_00319"
FT                   /product="Adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00319"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49766"
FT                   /db_xref="GOA:D5H181"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H181"
FT                   /protein_id="CBL49766.1"
FT                   /translation="MINLILLGLPGAGKGTASERIVDKYHLTHISTGDMFREAMANKTK
FT                   VGLEAKSYIDKGNLVPDEVTAKLVEERLSQPDIKEGFILDGFPRTTVQAELLDGITKRL
FT                   EKPLTNVIALEVDEDTLIKRLSARYMCKNCGATYNKLSKQPKVEGICDRCGGHEFYQRE
FT                   DDKPEVVKNRLEVNEKMNAPLKDFYQKKGLLTVINGEQTPEKVFEDIDAVLSNNQ"
FT   CDS             327671..327892
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="LCRIS_00320"
FT                   /product="Translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49767"
FT                   /db_xref="GOA:D5H182"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D5H182"
FT                   /protein_id="CBL49767.1"
FT                   /translation="MAKDDVIEVEGKVVDTLPNAMFKVELENGATILAHVSGKIRMHYI
FT                   RILPGDRVTVELSPYDLTKGRITYRFIK"
FT   CDS             328046..328396
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="LCRIS_00321"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00321"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49768"
FT                   /db_xref="GOA:D5H183"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D5H183"
FT                   /protein_id="CBL49768.1"
FT                   /translation="MARIAGVDLPRDKRIVIALTYIYGIGEATAKKICADAGVSEDIRS
FT                   KDLTPEDQEKLRAEVDKYRVEGDLRREVSMNIKRLVDIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGTKRNR"
FT   CDS             328421..328810
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="LCRIS_00322"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00322"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49769"
FT                   /db_xref="GOA:D5H184"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="UniProtKB/TrEMBL:D5H184"
FT                   /protein_id="CBL49769.1"
FT                   /translation="MPAKKTARKRRVKKHVESGVAHIHSTFNNTLVMITDVQGNAVAWS
FT                   SAGALGFKGSRKSTPFAAQMAAEAAAKSAMDQGMKHVEVSVKGPGAGRESAIRSLQATG
FT                   LEITAIRDVTPVPHNGSRPPKRRRV"
FT   CDS             328856..329794
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="LCRIS_00323"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00323"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49770"
FT                   /db_xref="GOA:D5H185"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="UniProtKB/TrEMBL:D5H185"
FT                   /protein_id="CBL49770.1"
FT                   /translation="MIEFEKPNITVVEQEDSYGKFVVEPLERGFGTTLGNSLRRVLLTS
FT                   IPGTGLVYVQIDGVLHEFSTVPGVREDVTKIILNLKKLELKSLSDEQKVIELDIEGPAT
FT                   VTADDLKVDADVQVLNPDQYICTIAEGGHLHMELAVKNGRGYVAASDNKSDDMPIGVIP
FT                   VDSLFSPIKKVNYQVESTRVGKRDDFDKLTFEIWTDGSIKPNDALSFAAKILVEHFKVF
FT                   ESADANAKFSEVMVEKEDDKKEKKLEMTIEELDLSVRSYNCLKRAGINTLQELTDKTES
FT                   DMMRVRNLGRKSLEEVKNKLTDLGLSLRQED"
FT   CDS             329822..330205
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="LCRIS_00324"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00324"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49771"
FT                   /db_xref="GOA:D5H186"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/TrEMBL:D5H186"
FT                   /protein_id="CBL49771.1"
FT                   /translation="MAYRKLGRDSAHRKAMLREMTTQLIMNERIVTTETRAKEVRKTAE
FT                   KMITLGKRGDLAARRKAAAFVRDEVADVHEEKDAVVVKSALQKLFSDVAPRYKDRNGGY
FT                   TRILKLAVPRKGDAAPMVILELV"
FT   CDS             330389..331240
FT                   /transl_table=11
FT                   /gene="cbiO2"
FT                   /locus_tag="LCRIS_00325"
FT                   /product="Cobalt import ATP-binding protein cbiO 1"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00325"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49772"
FT                   /db_xref="GOA:D5H187"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H187"
FT                   /protein_id="CBL49772.1"
FT                   /translation="MPVDSAVEFKDVSFTYPDTKKAILDQISFKIKRGSWTSLIGHNGS
FT                   GKSTISKLINGLLLPDSANNSRITVLGMTLNQKTVWDVREKVGIVFQNPDNQFVGATVG
FT                   DDVAFGLENRAVPREQMVKIVRKVLADVGMLDYIDAEPANLSGGQKQRVAIAGILAVEP
FT                   KIIILDESTSMLDPKGREQVLKIIKHLKKEKNLTVISITHDIDEANMADDVIVLNDGKI
FT                   LAQGTPTEIFSKTEMLQEIGLDIPFVQKLINKLNEVGISVPKNIKTKDELKQYLCQLNL
FT                   KK"
FT   CDS             331216..332061
FT                   /transl_table=11
FT                   /gene="cbiO3"
FT                   /locus_tag="LCRIS_00326"
FT                   /product="Cobalt import ATP-binding protein cbiO 2"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00326"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49773"
FT                   /db_xref="GOA:D5H188"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H188"
FT                   /protein_id="CBL49773.1"
FT                   /translation="MSIKFEKVNYIYSPGTSMEKKGLDNVSFELTENSFVALVGHTGSG
FT                   KSTLMQHFNALLKPSSGTIDIAGYHITAQTGNKNLKKLRKRVSLVFQFPEAQLFENTVL
FT                   EDIEFGPKNFGATDDEAKSKALKWLKRVGLDESLANKSPFELSGGQMRRVAIAGVMADE
FT                   PEILCLDEPAAGLDPKSRKEMMKLFVDYQKAGHTVILVTHNMDDVAEYADDVLVMEHGK
FT                   LIRHDAPKAIFTNKNWLEKHYLSEPTASLFASDFTNFNFKDKPLTLDQLVNEIKKNLRG
FT                   "
FT   CDS             332065..332862
FT                   /transl_table=11
FT                   /gene="cbiQ2"
FT                   /locus_tag="LCRIS_00327"
FT                   /product="Cobalt ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00327"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49774"
FT                   /db_xref="GOA:D5H189"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:D5H189"
FT                   /protein_id="CBL49774.1"
FT                   /translation="MSKIIVGRYIPGDSLIYKMDPRSKLLVTILFILAIFLANNSITYA
FT                   IVTIFCFLAVVATGLSAKVFWDGVKPLIGLIFFTSLLQLFFMTGGHIYWHWWIFSLSSY
FT                   GLINAIYIFIRFTLIILISTVMTVTTMPLEIADAMEWLLKPLKLFKVPVDKIALVISIA
FT                   LRFVPTLFDETFKIMNAQRSRGADFNDGGLIQRAKAITPILVPLFIQSLETAIDLSTAM
FT                   ESRGYRSSEGRTKYRVLSWSKYDLIALFYFVLLVGLLLIFRTH"
FT   CDS             332867..333655
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="LCRIS_00328"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00328"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49775"
FT                   /db_xref="GOA:D5H190"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D5H190"
FT                   /protein_id="CBL49775.1"
FT                   /translation="MTTRYKMTMAYDGHLFHGFQLQPDQRTVQGTIEDALKKMTKGQRV
FT                   IVQGSGRTDAGVHAVGQVIHFDYPGKTIPANRMILAMNSMMPTDIIFDDCQIVDENFHA
FT                   RYSIKGKWYRYRVSLDHFVNPFKRFYTGHFPYPLDIEKMQVAAQDLLGKHDFTSFAASG
FT                   GQIENKVRTIYYVNITKDEKENEVIFDFIGSGFLYNMVRIMVAALLEIGNDRRPIHDLQ
FT                   RVIAAKDRQEVRQTAHASGLYLYHVFYDEIPQKYRLDQHL"
FT   CDS             333760..334203
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="LCRIS_00329"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00329"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49776"
FT                   /db_xref="GOA:D5H191"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="UniProtKB/TrEMBL:D5H191"
FT                   /protein_id="CBL49776.1"
FT                   /translation="MRTTPLAKSSEIERKWYIIDATDVTLGRLSAAVATILRGKNKPQY
FT                   TPNVDTGDNVIVINASKIRLTGKKASDKFYYHHSSWRGGLKAVSYGELLANNPVKMVEI
FT                   SVKGMLPKNTLGHHEFMKMHVYAGEDHKHEAQKPEKLDINKLI"
FT   CDS             334215..334610
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="LCRIS_00330"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49777"
FT                   /db_xref="GOA:D5H192"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D5H192"
FT                   /protein_id="CBL49777.1"
FT                   /translation="MAQQAAYTGTGRRKNSVARVRLVPGNGKITVNDKDVDQYIPFPNL
FT                   VKDLKQPLTLTETEGQYDIHVNVNGGGFSGQAGAIRLGIARALLEVDPDFRGPLKKAGF
FT                   LTRDPRMKERKKPGLKKARKASQFSKR"
FT   CDS             334862..335170
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00331"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00331"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49778"
FT                   /db_xref="UniProtKB/TrEMBL:D5H193"
FT                   /protein_id="CBL49778.1"
FT                   /translation="MKNKNKVKLLTTATLLTTFLINTGIQSSNQIENNTAQAATNKKKT
FT                   KPSWQKPNGKSGKGGPNTQSYDYKGTLKASLNVKSGTTKVGKKTITNNKTDQNVALV"
FT   CDS             335183..336340
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00332"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00332"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49779"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:D5H194"
FT                   /protein_id="CBL49779.1"
FT                   /translation="MSLDGTKLKKTGNSKNDDSANFYGLDSILLADGKNAVATVKNATL
FT                   ISKATGANGIFATNKGTVNVSNTKIKTTGKANSRGLDATYGGKINANKVKISTKGDHSA
FT                   AVATDRGGGTVTVKNSKVTTKGTGSPLAYSTGTINFNNVTGTASGSQIAGMEGYNKISL
FT                   VNSDLMSTNNKISGSDPIKNGVIIYQSTSGDAKTSSSKSADFQAKDSTLKTAITSGAMF
FT                   YVTNTTGKITLENTKLNFNNSKVDLLNVAGNNSNGWGTKGKNGGHVTLTAKNQTLKGNI
FT                   VVDSISSANVKLTDDSTYTGKTSIVANKYATSSSKSKTPLTISVGSNSKWIVTGNSTVT
FT                   NLNLADGGEIVDSQGNKVTIIANGKTVQKGTSSYAVTVKGSFTTN"
FT   CDS             336562..337011
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00333"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00333"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49780"
FT                   /db_xref="GOA:D5H195"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5H195"
FT                   /protein_id="CBL49780.1"
FT                   /translation="MQIRKYQESDFSTLCEIHDPARKQELAAANLTAAFIPFKIASQKE
FT                   GLFDDYQVYVAQKDKTVVGFVAFNDEELGWLYVKPEYQHQGIGGQLIDFAIKNAGNPFY
FT                   LEVLQGNPAQKLYLAKGFKTIQHESGKMPGNESFHVEVDLMKYEK"
FT   CDS             complement(337040..337624)
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="LCRIS_00334"
FT                   /product="DJ-1 family protease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00334"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49781"
FT                   /db_xref="GOA:D5H196"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5H196"
FT                   /protein_id="CBL49781.1"
FT                   /translation="MTKVAVVFADGCEEVEGLSVVDVLRRLNVECDMVGLISKKVDGDH
FT                   HIEITCDKVVDDSLLDYDLVAFPGGMTGSANLRDNEKLRDLMIKRHEAGKWDAAMCAAP
FT                   RALARYGVLADADFTCYPGIEEECLKDAPSAHFSEKITVTDKEHKILTSRGPATAWAFA
FT                   YSIAEALGVDTSALKKGMLYNYLADNIQDSL"
FT   CDS             complement(337661..338320)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00335"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00335"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49782"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H197"
FT                   /protein_id="CBL49782.1"
FT                   /translation="MATFETLIFIPEGSLLNEKLAEKTALRQTLKHYGLDWGPAERLRY
FT                   TSLEKEFKNLSSDDQIDLALSTFLKEDLSKTRTVFDDAMKDQTRLVKGAIDFIDEVSGK
FT                   LHLILLAKEKRTQIEPRLAPTELLSSFDNAYFADDFTDKLPSKNIFFKILKDNPDIDPD
FT                   TVLVIGTNLDEEIQGAENANLKSLWLAPKKDKIPISPHPTLHLSKLADLSFYLDLM"
FT   CDS             338394..339152
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00336"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00336"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49783"
FT                   /db_xref="GOA:D5H198"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D5H198"
FT                   /protein_id="CBL49783.1"
FT                   /translation="MTIWTVIFLLLGGVAGGLLSSVASMASLASYPVLLAVGIPPVFAN
FT                   VTNDAALIWTSIGSTVSSTKELKGHWKQVWFYTIFTVVGSILGCILLLSFPPKIFEKAV
FT                   PFFIAFSGLMIIVSGKHHSLNTKAQPTWLKIIYFLALLVMGMYTGYFGAAGGVIVLVLL
FT                   TYITNDRFIVINAIKNVICGFANLVALIIFMFTSHIYWLQAIPLAIGMFIGGYIGPAIL
FT                   RRVPEKPVRIFIASLAFIQAGYFFYTAYLQ"
FT   CDS             339196..339876
FT                   /transl_table=11
FT                   /gene="gpm1"
FT                   /locus_tag="LCRIS_00337"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00337"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49784"
FT                   /db_xref="GOA:D5H199"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D5H199"
FT                   /protein_id="CBL49784.1"
FT                   /translation="MATEVYLVRHGETMFNQLNKVQGWCDSPLTVKGINDLKRTAKALS
FT                   QVHFDNMYSSDLKRAIDTVHLMKDANVVSDIGKIKKLPEFREVFFGTFEGDDINQTWEQ
FT                   VALAAGIGHEDDVTKIINQVGLRKFRAATKKADPRHLAENQDELDERMVRAIDVLRDLT
FT                   KDEQRVLLVSHGDFIKTLSIKYWNKSNGKNDIVFPNNGSVTRGILHDDGSFEIVDYNVD
FT                   AEEL"
FT   CDS             339937..340836
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00338"
FT                   /product="Cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00338"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49785"
FT                   /db_xref="GOA:D5H1A0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A0"
FT                   /protein_id="CBL49785.1"
FT                   /translation="MNKDHTTKRYVFVTLLNVVITVAEFIGGIFSGSLALLSDAVHNLS
FT                   DVGAIILSFVAHLISRKSRNQFKTFGYERAETLAAFTNGVILIVISVVLFVEAIQRFWK
FT                   PEHIHGGIMLIVSIIGLAANIISMLAMHSDSKANLNVRSTFIHMLSDALSSVAVVIGAI
FT                   FIYFWNVTWLDPVLTILVSIFVLHEAYEITMKAANVLMESNPDIDLNEVNKIVLSFPIV
FT                   QNIHHVHVWRYSDDFIMMDAHINVAPGLRADELEQLYQDIGQELQKELGINHITLQAEC
FT                   ERGRKDKMIVPGHGINED"
FT   CDS             340845..341027
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00339"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00339"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49786"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A1"
FT                   /protein_id="CBL49786.1"
FT                   /translation="MFNVNIFTAIIVLIMGIYDMSYAFNRRKQPTNKGGIRAFMALGII
FT                   FTIAGIVMIVRVLMK"
FT   CDS             341039..341719
FT                   /transl_table=11
FT                   /gene="gpmA2"
FT                   /locus_tag="LCRIS_00340"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49787"
FT                   /db_xref="GOA:D5H1A2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A2"
FT                   /protein_id="CBL49787.1"
FT                   /translation="MAKLVLVRHGESVANAANVYTGWNDVPLTKKGEEQAEKAGELIKT
FT                   ISDFAPTHIHTSVLSRAIVTANIVADVCNLLWLPMTKTWRLNERHYGALRGLNKDISRK
FT                   VFGVEQVLLWRRSFDSVPPKQGSPMIDRRYKHFDQHLMPRAESLHQTQKRLMPYYYDHI
FT                   ASRLMNGEDQLIVAHGSSLRALIKKLEQINDHDIVKLEVPNAEPIVYTMDEHLKIINKQ
FT                   ILRK"
FT   CDS             341830..342765
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00341"
FT                   /product="Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00341"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49788"
FT                   /db_xref="GOA:D5H1A3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A3"
FT                   /protein_id="CBL49788.1"
FT                   /translation="MRKLFLLRGAPGSGKSSFIARHHLNPYAISRDQIRLLLADLTVYY
FT                   QEDADVLHQVIPRHVTVRTEQMVDHLVEHKMEYGETVIVDGTHIVPSAIEHFKPWVDKY
FT                   HYECFVVDLMEHTTLESLLKRNQTRMHYDWVKPEVVKQMYRSYEAHPEVPYWAYKVVPN
FT                   QMDHALSQRETNLDRYAHVIAVPDMVDEEDFPHVHISNFYFSFNDKFTEKYGTYRNVVS
FT                   IAKTEDEAVKQFKLPYFVFKFHHKHFLISAYPIRNEMLDPIRKVKGVWTYSTGLYNVAD
FT                   FVKEFPENKKQHVHQFNLSKLDPTRLLHIW"
FT   CDS             complement(342829..343077)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00342"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00342"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49789"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A4"
FT                   /protein_id="CBL49789.1"
FT                   /translation="MKHARKVGEYDAKIDAKVDENEYVYVEDEEGVIKDLEKEFKDLDD
FT                   RLSKLTDVDGYDIKRYREEHHSLEKAKEVLAKAGKLK"
FT   CDS             complement(343074..343235)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00343"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00343"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49790"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A5"
FT                   /protein_id="CBL49790.1"
FT                   /translation="MTDYSKRQLKALDRISKKIEDAESHLARIEDSVPDRRHRTVHNMK
FT                   RLRILNLF"
FT   CDS             complement(343375..344724)
FT                   /transl_table=11
FT                   /gene="pepC3"
FT                   /locus_tag="LCRIS_00344"
FT                   /product="Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00344"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49791"
FT                   /db_xref="GOA:D5H1A6"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A6"
FT                   /protein_id="CBL49791.1"
FT                   /translation="MVKEINNDTINKFEQDLANHPVFDVASHAAQENGIYKASQNLQTK
FT                   IDLDPTFSIEIDTGNPADQKQSGRCWMFSALNTMRHPLQKKFKLKDFELSQNYTNFWDK
FT                   FEKSNWFFENVIATADKDLGDRKVSFLFATPQQDGGQWDMLCGIIEKYGIVPKSVYPET
FT                   ANATNSSALNDTLNTLLRKDGLELRKLVQDGKSEDEVQARKEEMLNDVFRILATSLGIP
FT                   PKKFNFEYRDDDKNYHIDRDITPKEFFDKYVGMDLANHISTINAPTNDKPFHKVFSVEY
FT                   LGNVEGGRQVRHLNLKVDEMKDLIIKQLKSGEVVWFGSNVVKDSERRAGLLDTNLYRRD
FT                   QLFDADFTMSKADMLDSGESMMDHAMVITGVDIVDGKPTKWKIENSWGEKPGFKGYFVM
FT                   SDSWFNSFVYQAVINKKFLPEDLKKAYDEGKDNPIQLLPWDPMGALAFKY"
FT   CDS             complement(344792..345091)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00345"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00345"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49792"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A7"
FT                   /protein_id="CBL49792.1"
FT                   /translation="MNKQDTHQIFTIKNEEDILLSSVTLDKIARKDSNVWIMNHFFINP
FT                   QFNSQDLLEKQMQKVWQLAQETNLPIWPLDPMIIDYFTQHPQFHKIWYHRPFNR"
FT   CDS             345223..345774
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="LCRIS_00346"
FT                   /product="Deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00346"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49793"
FT                   /db_xref="GOA:D5H1A8"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A8"
FT                   /protein_id="CBL49793.1"
FT                   /translation="MKTRGFEVVKKYQDQEINLPRRQTLASAGYDIEAAEDITIPSIWR
FT                   LNFVRIFRLIRNGHQLYERDYEMADQILKPLLVPTGLKAYMPEDEVLILANRSSNTFKR
FT                   NLALPNGIGVIDADYYNNPNNEGEIFVQMINYGVRPLHIKKGDRIAQGIFIKYLKTDDD
FT                   DPISRKRVSGFGSTNEKKGD"
FT   CDS             345774..347150
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="LCRIS_00347"
FT                   /product="DNA repair protein radA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00347"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49794"
FT                   /db_xref="GOA:D5H1A9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1A9"
FT                   /protein_id="CBL49794.1"
FT                   /translation="MARVKTQYKCRSCGYISASYLGRCPNCGAWNQFEKETEEVQKRST
FT                   KATASRLIQKTGLNEPVKLDKIKAEKEERIVTKSEELNRVLGGGIVPGSLVLIGGDPGI
FT                   GKSTLMLQIMSDLSEKYKVLYVSGEESANQIKLRADRLGVGQSNMLLYPETDMHDIREQ
FT                   INDVKPDFVVIDSIQTMNEPSLDSMTGSASQVREVTSELMKIAKMDAITVFVIGHVTKE
FT                   GAIAGPKILEHMVDTVLYFEGDEHHSYRILHSVKNRFGAANEIGMFEMVNEGLREVTNP
FT                   SSIFLDQRLPNSTGSAVVVSLEGTRPLLAEIQALVTPTAFGYAKRTTSGISFNKASLLL
FT                   AVLEKRGNLMLQNQDVYLTATGGIKLNEPAIDLAIAMAVASSYTDKEISPTDCFVGEVG
FT                   LTGEVRRVDKIDARVKEAAKVGFKRIFIPRHNMYSGLKDHGIEVIPVSSIPQALKLVFG
FT                   "
FT   CDS             347228..348727
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="LCRIS_00348"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00348"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49795"
FT                   /db_xref="GOA:D5H1B0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B0"
FT                   /protein_id="CBL49795.1"
FT                   /translation="MAKEKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTMVLRIE
FT                   DTDQKRNVKGGSKSQMENLHWLGIDWDEGPDKGGDYGPYRQSERKEIYQKYIDQLIDEG
FT                   KAYYSYKTEEELEAQREEQRAAGVAPHYTYEYEGMTADEIKQAQDEAKAKGLKPVVRIH
FT                   IPEMETYSWDDIVKGHLEFESDTIGGDFVIQKRDGMPTYNFAVVIDDHLMKITHVLRGD
FT                   DHVSNTPKQLVVYEALGWEPPKFGHMTLIINSETGKKLSKRDESVLQFIEQYRDLGYLP
FT                   EAMFNFITLLGWSPKGENEIFNKREFIKQFDPARLSKSPAAFDQKKLEWINNQYIKKAD
FT                   RDTLLDLALNNLQEAGLVDEHPTPEKMEWVRQLVNIYSVQMSYTKQIVDMAKIFFEEAK
FT                   DLSDEEIEEIKNDDGRGVIEEFKKQLDLIPRFTSVQIMNAIQATRKATGIKGRKLFMPI
FT                   RIATTRSMVGPGIGEAMELLGKERVLEHIDLTLKQMSANNL"
FT   CDS             348818..350251
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="LCRIS_00349"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00349"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49796"
FT                   /db_xref="GOA:D5H1B1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B1"
FT                   /protein_id="CBL49796.1"
FT                   /translation="MLAVRVYNTLTRKKEEFKPLVPGHISMYVCGPTVYNYIHIGNARS
FT                   AIAFDTIRRYFEYKGYDVKYVSNFTDVDDKMINEARAEKTTVPKLAEKFINAFLADTTA
FT                   LNIEPATLHPRATHEINDIITFVKSLIDNGYAYEVDGDVYYRAKKFKHYGQLSDQNIEQ
FT                   LEEGASEHINDTEQSRKEDPIDFALWKAQKEPDEIAWDSPWGKGRPGWHIECSVMSTKY
FT                   LGDTIDIHGGGQDLEFPHHENEIAQSEAKTGKKFVNYWLHNGFVTVGKDQEKMSKSLHN
FT                   FVTVHDILREVDPQVLRFFMASVQYRRQINYSAENLAQAATILDRFKNTLTNINYRLAD
FT                   DTASEESAELAQAIMATNEKFEQAMDDDFNVQNALTAIYDLLPVVNANANAARADKQEL
FT                   QKFKEKLASWLLVFGVDTNKLCVKNAGSNDDEIDALVKKRDEARANKDWATSDQIRDQL
FT                   KEMGITIQDTPQGTRWTRD"
FT   CDS             350244..350687
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00350"
FT                   /product="Ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49797"
FT                   /db_xref="GOA:D5H1B2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B2"
FT                   /protein_id="CBL49797.1"
FT                   /translation="MTKIKKLTEEDVNPDTLNGQTLAYLGDAVYEVIIRRHLVKGGIVK
FT                   PQVLQREATHYVSAKAQAALVTKMQDEEMLTDDELAAFRRGRNAKSHTKAKNTSLKTYQ
FT                   LSTGFEAMIGYLYLLGKNDRVADLSKWCIDTVEEDGLKNYDFK"
FT   CDS             350674..351429
FT                   /transl_table=11
FT                   /gene="yjfH"
FT                   /locus_tag="LCRIS_00351"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00351"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49798"
FT                   /db_xref="GOA:D5H1B3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B3"
FT                   /protein_id="CBL49798.1"
FT                   /translation="MTSNKDFVFGRHAGLDYLKTQSADKINKVFLQHGVQEEFANQVYS
FT                   LAKKKRLVVQDVPKNKLDRLVAGGNHQGLVLAISSFEYADLNQLLDKYDAEGKEPFLLM
FT                   LDSIEDPHNLGSILRSADATGVDGIVIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLV
FT                   QTTKELKKRGYWVFGTDMAGTDYREWNAQGKTVLVIGNEGKGIAPLLKKQMDQTITLPM
FT                   VGHVQSLNASVATGVLLYQAYNSRNPLVK"
FT   CDS             351563..352108
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00352"
FT                   /product="DNA-directed RNA polymerase sigma factor, sigma
FT                   H"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00352"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49799"
FT                   /db_xref="GOA:D5H1B4"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B4"
FT                   /protein_id="CBL49799.1"
FT                   /translation="MINEEKLIKKVRAGDDQALEKLFHLYEPLVNSIVKQFYLHHYDRK
FT                   DWDQEAMIVCYEAALVFSPQKGKFSSLYKTKLFNHARTLVRYNMARRRQIYSQSISLEK
FT                   ADIQGSVNEPCRSELSIPVDETYNNFVNSLSHVELIALLTIIGEISTEYAIDHLNIEAM
FT                   KLVRARARTLQKMRKVLF"
FT   CDS             352172..352390
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00353"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49800"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B5"
FT                   /protein_id="CBL49800.1"
FT                   /translation="MADEIIKTALLDRHMKEAFDWSDSDMPVRDALWDYFMEKNGRDTM
FT                   KTEEDMLPFLKDSDDKIEAFVNENLKK"
FT   CDS             352507..354015
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="LCRIS_00354"
FT                   /product="Gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00354"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49801"
FT                   /db_xref="GOA:D5H1B6"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B6"
FT                   /protein_id="CBL49801.1"
FT                   /translation="MKYIIGIDIGTTATKGVLYGEDGSEVAKLAISYPLIQEEAGQAEE
FT                   DPQLIFDAVQKMIYQLSQKASGKILAISWSSQMHSLIGLGENNKLLTNSITWADNRSSD
FT                   VVQRAKKSGWARMIYQQTGMPPHPMAPVYKLLWLKEEQPTLFAQVKKWISIKEYIIWRL
FT                   TGKILTDTTMAAGSGMMNLKTLTWDEKILAQIGLDQAQLPTIADQQSTVGKIIPEYRAK
FT                   LGLNDETQIVLGASDGYLSTIGVGVLDEKDFALNVGTSGAVRVIAPKAIVDQKNRFFCY
FT                   PVDAKHYLLGGPVNNGGIVFDWARKTIFGPDETAEDVLNVAQTAPAGSNGLLFHPYLGG
FT                   ERAPIWNAQARGSFVGLTRNHTKPQMARSVLEGIVFNLLGASQGLLDQVGQPQALRVTG
FT                   GFVQSDFVRQLIADIFNLPVIVIKNEQCGTLAAMFLAKTALEDKPDLEKIKKRTAESQV
FT                   YFPNPQNVAIYQELILVYRKIEHELEASYEDLAQFQDKHPQKFE"
FT   CDS             complement(354062..355807)
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="LCRIS_00355"
FT                   /product="1-Deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00355"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49802"
FT                   /db_xref="GOA:D5H1B7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B7"
FT                   /protein_id="CBL49802.1"
FT                   /translation="MNKHPEYLLNKISGPADLKKLSLPEMEKLASEIRTLILEKDAAEG
FT                   GHLGPDLGIVEATIAYHYVFNAPKDKIVWDVSHQTYPHKMLTGRALAWLDPDHYEDVTP
FT                   YSNPDESPYDYYAVGHTSTSIALATGMAKARDLMGKHENIMALIGDGSMTGGLAYEGLN
FT                   NAAIEKHNLVVVVNDNQMSIDDNVGGLVTALKKLRDSNGETKENPFTAMGFDYRYVADG
FT                   NDIQSMIDAFKAVKNVDHPILLHINTLKGKGYQPAIDNEEAHHWVMPFDLKTDKTTVAM
FT                   PEGPTASSIALDVLEDHINNGEKIMAINAAIPGVFGLDRIKNKYPENYHDVGIAEQESV
FT                   AFAAGMAKEGATPILFENSTFLQRAFDQLSHDVAANDLPVVMMVAGGGISGTSKTHLGV
FT                   FDQVMISNLPNWIYLAPTNLAEEKAMMEWAIKQKKHPVAIKMPTKGVPEGKEITAVDYS
FT                   EIKYDIKPGKDVAVLALGDMYDMLGKKVAEKTGASLVNPVSANILDTAALDKLAQENKV
FT                   IVTIEDNILDGGFGEKVASYLGDKDIKVLNYGQKRVYTDQVPLKEILKDNRMTVDQIVE
FT                   DIENA"
FT   CDS             355993..356142
FT                   /transl_table=11
FT                   /gene="rpmG1"
FT                   /locus_tag="LCRIS_00356"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00356"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49803"
FT                   /db_xref="GOA:D5H1B8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B8"
FT                   /protein_id="CBL49803.1"
FT                   /translation="MAVKKAALACSVCGSRNYSITASKNRTQRLELQKFCKHCGKKTLH
FT                   KETR"
FT   CDS             356152..356322
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="LCRIS_00357"
FT                   /product="Preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00357"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49804"
FT                   /db_xref="GOA:D5H1B9"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1B9"
FT                   /protein_id="CBL49804.1"
FT                   /translation="MIKFFKSVGHEMKLVKWPSAKQNRRDTATVITSSILFAAYLGALD
FT                   WLFTWLTQRLM"
FT   CDS             356431..356988
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="LCRIS_00358"
FT                   /product="Transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00358"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49805"
FT                   /db_xref="GOA:D5H1C0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C0"
FT                   /protein_id="CBL49805.1"
FT                   /translation="MVETAQKKWYVLHTYSGYEDKVKSDLLSRAQSMGMQDYIFRVMVP
FT                   EEEKVETVRGKKQEIEEKIFPGYVLVEMVMTDESWFIVRNTPNVTGFVGSHGGGSKPSP
FT                   LLDEEVTRLLKNQGQPAKKPVANFDIGESVTITEGAFNGMVGKITDIQPDKYKLYVSVD
FT                   MFGRATTAELDYDQVKKLDENE"
FT   CDS             357119..357544
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="LCRIS_00359"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00359"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49806"
FT                   /db_xref="GOA:D5H1C1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C1"
FT                   /protein_id="CBL49806.1"
FT                   /translation="MAKKVINVVKLQIPAGAATPAPPVGPALGQAGINIVGFTKDFNAR
FT                   TADQKGMIIPVVITVYEDRSFEFITKTPPAPVLLKQAAKIQKASGEPNTKKVGKVTKDQ
FT                   VKEIAETKMKDLNAADIEAAMRMVEGTARSMGIEVED"
FT   CDS             357621..358313
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="LCRIS_00360"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49807"
FT                   /db_xref="GOA:D5H1C2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C2"
FT                   /protein_id="CBL49807.1"
FT                   /translation="MPKHGKKYLDAAKKVDSNKLYSVAEAMKLVKETSYANFDATVDVA
FT                   YNLSVDPKQADQQIRGSIVLPNGTGKTQTVVVFAEGPQADQAKAAGADFVGSDDLVEKI
FT                   QGGWLDFDVVVATPMMMAKVGRLGRILGPKGLMPNPKTGTVTMDIEKAVKNVKAGQVEY
FT                   RVDRQAAIHTPIGKVSFTEDQLVENFDALRDVILRARPASAKGQYIKSVAVSATFGPGI
FT                   KLDPLNLD"
FT   CDS             358433..359299
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="LCRIS_00361"
FT                   /product="Phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00361"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49808"
FT                   /db_xref="GOA:D5H1C3"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C3"
FT                   /protein_id="CBL49808.1"
FT                   /translation="MKKHSIGKLVIMLVLMLAFVTGCANNGSKITIVGSSAMQLLAEQA
FT                   GNDYRLSHQDSNIVVQGGGSGTGLSQVQAGAVQIGTSDVFAETQKGIDAKKLRDYKVAV
FT                   VGIVPIVNKGVGVKNVSQKQLKQIFTGKLTNWKQLGGKNEAITVINRSKGSGTRSAFED
FT                   IILQGTKPVKSQEQDSNGAVKKIVNSTPGTISYLSFPYAHDTNIQKLSINGVKPTNKNI
FT                   TTNKWKIWCYEHMYTKGKPNKQTKAFINYMLGEKVQKDLVPKIGYLSINEMKVTRNSKN
FT                   QVTQIGK"
FT   CDS             359303..360298
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="LCRIS_00362"
FT                   /product="Phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00362"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49809"
FT                   /db_xref="GOA:D5H1C4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C4"
FT                   /protein_id="CBL49809.1"
FT                   /translation="MDKKDKLKEVVDQAIASQHVPHVKLKKMGPTSVDIDKLTKPSKET
FT                   HQEYWGKGLTYLAIVLIIVLVVSIIGFVGYHGLATFVSDHVNVFHFLTSTDWDPGEGKN
FT                   HVGAAVMIVTSFLVTLLAALVATPFAIAIALYMTEYSSKKGANFLQSVTELLVGIPSVV
FT                   YGFLGLTIIVPVIRKLFGGTGFGILAATLVLFVMVLPTITSLTVDSLKAVPSHFRKASM
FT                   ALGSTHWQTIYHVVLRVATPRILTAVIFGMARAFGEALAVQMVIGNAVLMPYNLVSPSA
FT                   TLTSQLTSQMGNTVMGTLPNNALWSLALLLLIMSLVFNFLVKLIGKKGQK"
FT   CDS             360300..361187
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="LCRIS_00363"
FT                   /product="Phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00363"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49810"
FT                   /db_xref="GOA:D5H1C5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C5"
FT                   /protein_id="CBL49810.1"
FT                   /translation="MDAKKKDKLATAIIYILVGIVVLILAGILGDILITGIPHLSWHFL
FT                   SSEASSYQAGGGVRDQLFNSIYLLILTTIISLPIALGAAIYLAEYAKDNWVTNLIRTTI
FT                   QILSSLPSIVVGLFGYLLFVVQFGFGFSIISGALALTFFNLPILTSNIEEAIKGVPQDQ
FT                   REAGLALGLSNWKTIRGIVLPAALPGILTGIILSAGRIFGEAAALIYTAGQSGSTVNYA
FT                   DWNPFSPTSPLNVMRPAETLAVHIWKVNTEGIIPDATIVSAATSALLVIVVIVFNLGAR
FT                   YLGNKLYRKLTAAK"
FT   CDS             361196..361990
FT                   /transl_table=11
FT                   /gene="pstB1"
FT                   /locus_tag="LCRIS_00364"
FT                   /product="Phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00364"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49811"
FT                   /db_xref="GOA:D5H1C6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C6"
FT                   /protein_id="CBL49811.1"
FT                   /translation="MQDLKPSYIKTFANDDLELSTEDLSVLYGGKVQKLFDASLQFKKN
FT                   TITALIGASGSGKSTFLRSLNRMNDRVATVNGKIWFHGLDVNKPNINVYELRKNIGMVF
FT                   QRPNPFPKSIRENIVYALKADGHKDRAELDRVVEESLRAAALWDEVKDKLDKSALALSG
FT                   GQQQRLCIARALAVKPEILLLDEPASALDPVSTSKLEDTLKQLRSKYTMIMVTHNMQQA
FT                   SRISDYTAFFHLGHAIEYNSTAEIFTNPKGKITENYIQGSFG"
FT   CDS             361992..362747
FT                   /transl_table=11
FT                   /gene="pstB2"
FT                   /locus_tag="LCRIS_00365"
FT                   /product="Phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00365"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49812"
FT                   /db_xref="GOA:D5H1C7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C7"
FT                   /protein_id="CBL49812.1"
FT                   /translation="MTTIISAKDVHLSYGNYEALHGISLDFKKKELTALIGPSGCGKST
FT                   FLRCLNRMNDDIENIKITGEIKFEGQDIYNSKMDLVSLRKEVGMVFQQPTPFPFSVYDN
FT                   VAYGLKIAGVKDKELIDQRVEESLKQAAIWKETKDNLTRNAQAFSGGQQQRICIARALA
FT                   VRPKVVLLDEPTSALDPISSSEIEETLMELKHQYTFIMVTHNLQQAGRISDQTAFLMNG
FT                   DLIEAGPTEEMFIAPKKQITSDYLNGRFG"
FT   CDS             362765..363442
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="LCRIS_00366"
FT                   /product="Phosphate transport system regulatory protein
FT                   PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00366"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49813"
FT                   /db_xref="GOA:D5H1C8"
FT                   /db_xref="InterPro:IPR008170"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C8"
FT                   /protein_id="CBL49813.1"
FT                   /translation="MHEIFLDELKKLNTQFMEMGVLVNDDIDHATRAFVDHDKKTAQSM
FT                   VDDEEKIPTESIDIQKQALKLMALQQPVATDFRVVISILKATTDLERIGENAMSIALET
FT                   IRVKGNPRIPEVEEIISNMTHNVRHMLIQVLTAYVQDDEKMAREVASRDSMIDHDYVRA
FT                   RQLIVDGIEDDPSRAMASSSYFVVTRLLERIGDHIVNLASWVVYKTTGELEELSNSTES
FT                   ETI"
FT   CDS             complement(363503..363658)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00367"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00367"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49814"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1C9"
FT                   /protein_id="CBL49814.1"
FT                   /translation="MAIRRSIESDFSLLSYYNAENNRARSPVGFQQRLEIAILAYNMAY
FT                   CLERFN"
FT   CDS             complement(363648..364136)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00368"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00368"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49815"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D0"
FT                   /protein_id="CBL49815.1"
FT                   /translation="MNYLKLKRFSHHLQVSFNRLNVICRSLYKLYAPDGLKHRKNVDQT
FT                   KLPDSSILAMLIWQTEIGIESQRRFCKFFVGLSHSRFNRQARMLLPLIRCIRQAWNQEV
FT                   KTAGEFLIIDSFPVPVCQPVRNYRVKIFRGVADIGYKATKKVYYYGFKVHAIVSDDGN"
FT   CDS             364218..364496
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00369"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00369"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49816"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D1"
FT                   /protein_id="CBL49816.1"
FT                   /translation="MNISKTVLALYQTIIGEKQKRLIKTADAYLDINYGDKVYQIIDQV
FT                   KERNIPILSFGDTADQNNTYSNYTVFGNDQVDEMVDKINEIINNQNK"
FT   CDS             364700..365212
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="LCRIS_00370"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49817"
FT                   /db_xref="GOA:D5H1D2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D2"
FT                   /protein_id="CBL49817.1"
FT                   /translation="MSKAAIAEKEKFVDAFAEELKAAKAILVINYLGLTVEEVTNMRKE
FT                   LRDNDVKMKVIKNTYLRRAAAKAGIEGLDDTFVGPTAVIYTDNADDVTEPARIVSKYED
FT                   DFDVIEIKGGMLEGKLTSKDEIKELAAIPGREGLLSMLVSVLQAPVRDFAYAVKAVAES
FT                   KDEDSAE"
FT   CDS             365265..365627
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LCRIS_00371"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00371"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49818"
FT                   /db_xref="GOA:D5H1D3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D3"
FT                   /protein_id="CBL49818.1"
FT                   /translation="MALDTDKIIEELKGATILELNDLVKAIEDEFDVTAAAPVAAAGAA
FT                   DAGAAKSEFDVELTEAGQEKVKVIKAVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEAN
FT                   DIKAKLEEVGATVTLK"
FT   CDS             365704..366546
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00372"
FT                   /product="K channel"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00372"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49819"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D4"
FT                   /protein_id="CBL49819.1"
FT                   /translation="MMKDIERRLTPYQWVMAILAIISIFLIILDFAAVINIDEPTSKWF
FT                   WINSAIVVYFAIDYFRGLHAAEDKKLYFKTHIYDLLSIIPMGLLFISLNIFNLSGLVSD
FT                   LRLLRLIRLAGLMGKLRNIFHTNGLLYVIFFTITFLLVGAEAFAITEHVTLDTAFWWVI
FT                   STASTVGYDAIFGKTIPPHSIVGKFVTLVMMLLGIGIVGMLTSSITSYLMRRTNGANTL
FT                   KTHDNIQLIFKKLDNLEKQNKDLADQNKKMQAQINELKDVQNTTELHKIKEWFEKKKG"
FT   CDS             366552..367172
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00373"
FT                   /product="Methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00373"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49820"
FT                   /db_xref="GOA:D5H1D5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D5"
FT                   /protein_id="CBL49820.1"
FT                   /translation="MSEEKNQMYFATDPTAKHDQHVVDYHVDNIDLKFTTDAGVFSKMR
FT                   VDYGSGVLIKAMKDVVFPKDNILDVGTGYGPIGLFAAKFWPDQTVDMVDVNERGLSLAK
FT                   QNAQVNHIDNVNIYSSDCYEHVDNDKKFGLILTNPPIRAGKKVVNEILLGANEHLVNGG
FT                   ILLVVIQKKQGEPSARKLMTNTYGNCEILTRDKGYYILKSTKK"
FT   CDS             367300..367482
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00374"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00374"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49821"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D6"
FT                   /protein_id="CBL49821.1"
FT                   /translation="MKKAWKYIVAVLIVIVGVFMLGMISGDNETAAPAGIAALYLILSG
FT                   IFFYHNFRNRNIEPL"
FT   CDS             367557..368057
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00375"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00375"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49822"
FT                   /db_xref="GOA:D5H1D7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D7"
FT                   /protein_id="CBL49822.1"
FT                   /translation="MLSGEDKRKYMQLAIDQAKEAEKQGEVPIGAVVVDPDGRVVGTGY
FT                   NRRELDEDATQHAEMIAIKEACSKLGMWRLIDCSLFVTLEPCPMCAGAIINSRIKDVYF
FT                   GALDPKAGACGSVVDLFSVEKFNHHPHAIRGLYRDQCAQMLKDFFRAIREKQKAAKLAQ
FT                   KEV"
FT   CDS             368263..370068
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="LCRIS_00376"
FT                   /product="DNA polymerase III, gamma/tau subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00376"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49823"
FT                   /db_xref="GOA:D5H1D8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D8"
FT                   /protein_id="CBL49823.1"
FT                   /translation="MAYQALYRKWRPRTFDSVIGQEAITDTLKNAIKRGKVSHAFLFAG
FT                   PRGTGKTSCAKIFAKALNCTNLQDGEPCNECANCIAADQGSMPDIMEIDAASNNGVDEI
FT                   REIRDKVKYAPTEGKYKVYIIDEVHMLSMGAFNALLKTLEEPPEHVVFILATTELQKVP
FT                   ATIISRTQRYNFKRISKEDLEKRMKYILDQENIKYEDKALAVIAQVADGGMRDALSILD
FT                   QLLSYEKESVNYDDALQITGFADRENIEKILLALLNQDAGQALQLTQDELAKGASSKNI
FT                   LDEIIDLTTKSLLIVKTDENKQETFLTKDFIEKIKSVSTDSYYRLINLANNALNDLRYT
FT                   NQQQIPLEVFLVEASSPAPVQTSAAPAKTTPAQPAQGNTDLQAELAALKKQVVDLTQKL
FT                   SEVSNKPSLSTNQVFHLDTAVPKVAPKPAVKPKEKQTKKPVRKVKKTTAENRKQVYHVL
FT                   ENATRNDLETIKNVWPDLQSVLAVSEKALLDVLEPVAASPEQVVMKCKYTLWFENASAD
FT                   NDLLGRLTDYIEKFAKHSYGIVLVPDNDWLAVRKEFVESHKDELLAKKKQQIEIQEEKS
FT                   DEPEVDPEVINKAKDLFGDAVNIKD"
FT   CDS             370075..370665
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00377"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00377"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49824"
FT                   /db_xref="InterPro:IPR014869"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1D9"
FT                   /protein_id="CBL49824.1"
FT                   /translation="MSNDYNIKVLNKETTLQILLEDHNSLIRFGDGELDLIRGASIPYQ
FT                   DYQPELAGSLKELLLEGSNRRLLVGLSDVFEKLDRYNDYCRNFYQNSFFPNNHDLLREV
FT                   ELQYNVYVSTFFSRPYIDLVDKSHAKDCFAKMKQLWQDHDLLIVEGKYSRSGEGMTCFL
FT                   MLDQLVDSFVRQLMHIVAKKLLKMKLLKMQLIG"
FT   CDS             370674..370904
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00378"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00378"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49825"
FT                   /db_xref="InterPro:IPR014869"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E0"
FT                   /protein_id="CBL49825.1"
FT                   /translation="MLGPTAKVIVADLIAQINNQMIDIGHIDSEYEWMKMGVTNKVKIP
FT                   HKHTAEFNFDDKQVKLEKDDNFDKQIISIIE"
FT   CDS             370920..371255
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00379"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00379"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49826"
FT                   /db_xref="GOA:D5H1E1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E1"
FT                   /protein_id="CBL49826.1"
FT                   /translation="MSRRPNFGGMGMGGMNMQQMMKQAKKLQAQMAEEQENITAQEFTG
FT                   KSADDLVVATFTGDRKLKDIKIDKEAIDPDDPDMLQDLVIDAVNKGLAKIDEATQASLG
FT                   KYTKGLM"
FT   CDS             371256..371855
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="LCRIS_00380"
FT                   /product="Recombination protein recR"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49827"
FT                   /db_xref="GOA:D5H1E2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E2"
FT                   /protein_id="CBL49827.1"
FT                   /translation="MQYPLPIAHLIDAYMKLPGIGEKTATRLAFYTMDMPDQDVDDFAK
FT                   SLVQVKKDIHQCPICGNITEKDVCDICSNPNRDQTTIMVVEQPKDLMAFEEMGEYDGLY
FT                   HVLHGVLSPMDGIGPEEINIKSLITRLQKNDAVKEVILALNSTPEGESTAMYISKLIKP
FT                   AGIKVTRLAAGLSVGSDIEYANSITLKRAVQGRTAL"
FT   CDS             371855..372094
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00381"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00381"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49828"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E3"
FT                   /protein_id="CBL49828.1"
FT                   /translation="MANKKQAKIKAMGDQKLVAEIEKLQNQIALEQDLDQTTLDLSEDN
FT                   YVQNRILKAKYTFLYNEARHRGTRFSGITNAITQ"
FT   CDS             372197..372835
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="LCRIS_00382"
FT                   /product="Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00382"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49829"
FT                   /db_xref="GOA:D5H1E4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E4"
FT                   /protein_id="CBL49829.1"
FT                   /translation="MRGYFVSFEGPDGAGKSTVLKEVLNQIGSELKTQYLVTREPGGSK
FT                   IAEKIRDIILDPANDKMDNKTEALLYAASRSQHVEEIIRPALKEGKVVFSDRYVDSSLA
FT                   YQGAGRDLGIQEVKQINDFATDKLDPDLTFFLDLDPEVGLKRIEKLRPGQEDRLEQENL
FT                   AFHKKVYAGFLKVKETYPERFVTVDATQPIDQVVAQVIATLKQRMPELF"
FT   CDS             372848..373168
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00383"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49830"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E5"
FT                   /protein_id="CBL49830.1"
FT                   /translation="MKLVIAIVQKEDSNDLQRAFVQNDFRATKLATSGGFLSQGNTTFL
FT                   VGCDDDKVDDVLKIIKEQSRAREEIATPHMVSTGYEITQPLKVTVGGATCFVVPVDEFK
FT                   RF"
FT   CDS             373168..374025
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="LCRIS_00384"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00384"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E6"
FT                   /protein_id="CBL49831.1"
FT                   /translation="MIDLSNVGKKQTQFLKRAYDQKKLAHSYLFVDSDEARALNTAYWL
FT                   ACLFNCTGENKPDGSCQNCRQILSGNHPDVLLVAPDGKQTLGIDQIRPLKEELAKSPVE
FT                   STRRFFFINEAQKLTLAAANGLLNLLEEPVAPVVTILITNNSDQILPTVRSRTQIINFD
FT                   NGERASGRTAVLLENGFSKAEIEELGNLDKWNQAIKYFYQEMLEHNSLALVSAHKLAAD
FT                   AKLVSEQGYILLQLKLLAEQDLRNPAKRIMAATMLKNLIEIDKMRLSNVNLQNALDYLA
FT                   LKWK"
FT   CDS             374035..374385
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00385"
FT                   /product="Initiation-control protein yabA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00385"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49832"
FT                   /db_xref="GOA:D5H1E7"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E7"
FT                   /protein_id="CBL49832.1"
FT                   /translation="MDPYSKLKKIEETTENMTKTIASLENDILETLKENTELKVENQLL
FT                   HEKLDKLTANQPAPETKTQSGLESLKKIYDSGYHICNMYYGSHRDPSADCMFCLDILDN
FT                   FGEKKGKKKDGR"
FT   CDS             374385..375236
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00386"
FT                   /product="Tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00386"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49833"
FT                   /db_xref="GOA:D5H1E8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E8"
FT                   /protein_id="CBL49833.1"
FT                   /translation="MKRQSSYAKDEGKLYLVPTPIGNLEDITIRAKKVLTDADYVAAED
FT                   TRTSGILLEKIGVHNKMISFHKYNSKERAPELIKLMKEGAVIAEISDAGMPVISDPGYV
FT                   LVQECIKHDIPVVPLPGPNAFSTALIASGFNQPFTYYGFLPRKSSEQKTYFAQMRDNRA
FT                   TSIFYEAPHRLAKTLKTLASVLPKDRQIVAARELTKIHEEFIRGSVEEVTNYFSENAPR
FT                   GEFVILVSPNTEAPQQLSWTELIDLVNDLVEKGESKKDAIKQVAKQHHVSKNELYDQYH
FT                   QD"
FT   CDS             375239..375973
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00387"
FT                   /product="Acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00387"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49834"
FT                   /db_xref="GOA:D5H1E9"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1E9"
FT                   /protein_id="CBL49834.1"
FT                   /translation="MKYTEEYQIEFKDCDENRRLKLPALVELMMQVSEHQLSQGGAGTD
FT                   DLVKRGLGWVVTQYHFEISDLPKPGDQVILSTDASGYNRFFEYRDFGVSTADGKPLVTV
FT                   KSQWVMLDLKKRHMVPADTKMMEDWGALLLKKMPRFPRLRARNNYEHIRPYRARYDDLD
FT                   TNHHVTNSHYFSWFVDMLDRNFLKEHIVTAIDIKFDKEVHYGESINSCMDLVQDDIVTT
FT                   YHAIEAEDGTVKAVCELSWRKI"
FT   CDS             376029..376547
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00388"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00388"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49835"
FT                   /db_xref="GOA:D5H1F0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F0"
FT                   /protein_id="CBL49835.1"
FT                   /translation="MNTKKILRTDLQQLVFLGIVVAMKIILSQFSFGPVMVKVGLGFIG
FT                   SVLLGYLFGPLWGTIGGGISDLISSALFGNQGGFFIGFTLTAMAGPFIYALFLYNKPVK
FT                   IWRIIASTILVTVIVNIGMNTLWLHIMYGMNFNAALIQRLPKETIVPWIQMVISYFVLQ
FT                   AVSRVKIKK"
FT   CDS             376577..377311
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00389"
FT                   /product="Glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00389"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49836"
FT                   /db_xref="GOA:D5H1F1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F1"
FT                   /protein_id="CBL49836.1"
FT                   /translation="MKILSVSTATNHLSVALNDGQQIIVEKNERDERNHSEHLDPLIDE
FT                   ILKDNDLSLKDIDRFAVAIGPGSYTGLRIGITTVKMFASILDKEVVGISTLQALAKGVQ
FT                   EDALVITGLDARNDNYFAAGYLSGAVPENVIPDGHYNIDVLIKAIQDYAAKHEVKKIVF
FT                   VGSGLEKQDEKFKALNIPYIYGTEEENVIHAGLIGQLAENAVPVDPDKLLPRYLRRTQA
FT                   EVDWHKKTGKPFEPDSHYVEEV"
FT   CDS             377295..377867
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="LCRIS_00390"
FT                   /product="Ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49837"
FT                   /db_xref="GOA:D5H1F2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F2"
FT                   /protein_id="CBL49837.1"
FT                   /translation="MLKKFNQFFHQQLNRIDMSFTPFIANVNGKRLQIMQATDDNIPDL
FT                   LVLEEQVYSGRTPWNKFSFERELEKRHNCLYLVVYYESMLVAFIGARFTPEETHITNIA
FT                   VAPAFQNMHIGRYLMQLIIDRARENDSDCVSLEVRVDNEIAQKLYRSLGFEGTFIRKNY
FT                   YHDTHTDAMNMVLWLKPHQIKRKKFTF"
FT   CDS             377864..378913
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="LCRIS_00391"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00391"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49838"
FT                   /db_xref="GOA:D5H1F3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F3"
FT                   /protein_id="CBL49838.1"
FT                   /translation="MSEKKDVRILAYESSCDETSTAVIKNGREIESLIVATQIKSHQRF
FT                   GGVVPEVASRHHIEVVSQITKEALAEANCTWKDIDAIAVTYGPGLVGALLIGVSAAKAA
FT                   SMATGIPLIGVDHIMGHIMAAQLKDEIEYPALALQVSGGHTEIVLLKDPVHFEIIGDTR
FT                   DDAAGEAYDKIGRVLGVNYPAGKTIDAWAHEGKDTFNFPRAMMEDDDYDFSFSGLKSAF
FT                   INTCHHADQIHEKLNKYDLAASFQAAVIDVLAHKTIRAIKQYKPKTFIMGGGVAANHGL
FT                   RDRMSAEIAKLPKADQPKVILPDIKLCGDNAAMIGAAAYNLYNNGQFADLTLNADPSLE
FT                   LPYAKSMLE"
FT   CDS             complement(379153..380379)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00392"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00392"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49839"
FT                   /db_xref="GOA:D5H1F4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F4"
FT                   /protein_id="CBL49839.1"
FT                   /translation="MQVTFGIDVSKSTSTVCELIGESKNELTITNNRPGFIQLLHELTA
FT                   FSKHPQIIFEATGVYSRTLQSFLEDYGYDYVILNPLKAKKEMDMGLRHNKTDKTDAYHL
FT                   ALIQRLYHHPINQLQSQTYKQLNALSRFYDQLTADLVMAKNRLHQALQSTFPEIENLFS
FT                   SAKGKNYWQIVVRYPHCDLVRREDKKQLINWLMSLKGIAFKHALRTADKLIELAYQAYP
FT                   VVSCSSIEVEQVQYYAHRLLNLSDQRENLIARMVKLAKSLPNHDLENIESIPGFAQTTA
FT                   VRVLAELGDLRRFSNPNKINAFIGIDPGRYQSGEMDSNLSITKHGNAVARKLLYRAIGQ
FT                   IDNAAKTNPCHIADYYESKKLSSQTKGFKKIAIASIHKLIRTIYALIINDQPYDYNVAT
FT                   HNQKDFSRN"
FT   CDS             380645..380926
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00393"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00393"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49840"
FT                   /db_xref="GOA:D5H1F5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F5"
FT                   /protein_id="CBL49840.1"
FT                   /translation="MSKFNKEQKIEIYHKWKDENISISQLAKAYRMNLANLDYMLRLID
FT                   MHGIEILTTKNQSYSKEIQQLKEENLRLRIVNEYVKKLSALDQEDQKK"
FT   CDS             380932..381168
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00394"
FT                   /product="transposase (IS150)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00394"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49841"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F6"
FT                   /protein_id="CBL49841.1"
FT                   /translation="MITDLRQEFKVSLNYVLAAIAEHPELPIIARSSYYKIIRRQPVKP
FT                   KRSKLIARIHEIFNHHQGRYGYRRVALQLIREG"
FT   CDS             381192..381809
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00395"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00395"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49842"
FT                   /db_xref="GOA:D5H1F7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F7"
FT                   /protein_id="CBL49842.1"
FT                   /translation="MHKLGLKGIRRNKRKYSSYKGTIGKIAPNLIHRDFFAALPNTKRY
FT                   TDITEFHLNNEKLYLSPILDGCGGDIVSYTISKHPDMDLVMTMLDKAFAKETALNNSIF
FT                   HTDQGCQYQSPRYQRALKLHGITQSMSRKGNCMDDGLMENFFGLLKTEMFYDQEYKYHN
FT                   LQELTQAIEEYIEYYNNERIKSRLKGLTPKEYRSQASINPIF"
FT   CDS             complement(381857..383779)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00396"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00396"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49843"
FT                   /db_xref="GOA:D5H1F8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F8"
FT                   /protein_id="CBL49843.1"
FT                   /translation="MIIAQGHDLEQQFGANTLFKNVTFSIDSNARIGLVGPNGVGKTTL
FT                   LKIMTGEQEPTHGEFTVNKGIDVGYIAQENALDENKTIWDEMETVFAPLIREGKSLVQL
FT                   QEKIADHPEDQELLKQYDQKQFNFEQKGGYTYQSDIKSILNGFKFPEGTWQKKIGSLSG
FT                   GEKTRLAFVKLLLRKPALLLLDEPTNYLDLDTLDWLEGFLKNYSGAILVVSHDQYFLDH
FT                   LATQIFELEFGKLTAFKGNYSAYVMQREQRDKDQEAAYEKQQAEIKKDEEFIQKNLVRA
FT                   TTTKRAQSRRKKLEKIERITPPKHKNKVRIHFSSDHPSGKEVLIFNDLTIGYPDKTMVK
FT                   DISFQINKGDRVAIIGPNGIGKSTLLKTIMKQLTPKSGSIKYGASLEIGYYDQELQGLD
FT                   PSKTVLDTVWDRHKTMPERDVRSILASFLFTAKDIDKTVGQLSGGQKARLTLTVLSLEH
FT                   DNFLLMDEPTNHLDIEAKEVLEKALKDFDGTLLFVSHDRYFINQLANKIVLVRDGHAKV
FT                   YDGNYSYYLDEKAKQAAMAENSAAEPEVEPSKQISQQKLSYQEQKQRDSQKRKLQRAID
FT                   NAEKQIEQLEEREQEIQTEMANPEIASSFDKLGPLQEQLSDVQQKLDEANSAWEKAIEE
FT                   MDNFE"
FT   CDS             383954..384589
FT                   /transl_table=11
FT                   /gene="rex"
FT                   /locus_tag="LCRIS_00397"
FT                   /product="Redox-sensing transcriptional repressor rex"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00397"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49844"
FT                   /db_xref="GOA:D5H1F9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1F9"
FT                   /protein_id="CBL49844.1"
FT                   /translation="MEKIKIPKATAKRLPLYYRYLIILNEEGKDKVSSTELSEAVQVDS
FT                   ASIRRDFSYFGALGKRGYGYDVKNLLSFFKKILNQDTLTNVALIGVGNLGRALLNYNFK
FT                   RSNNIRISCAFDINKEITGRILSGVPVYDMDDLKQQLSDQQITIAILTVPSTAAQKTTD
FT                   EMVDAGVKGIMNFTPIRLSAPADVRVQNVDLATELQTLIYFLDSDKEN"
FT   CDS             complement(384627..385613)
FT                   /transl_table=11
FT                   /gene="scrR"
FT                   /locus_tag="LCRIS_00398"
FT                   /product="Sucrose operon repressor ScrR"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00398"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49845"
FT                   /db_xref="GOA:D5H1G0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G0"
FT                   /protein_id="CBL49845.1"
FT                   /translation="MAAKLSDVAKKAGCSVTTVSRVINNHGYLSQKTKDKVFAAMRELN
FT                   YRPNSIARSLQGKKMKLVGLIFPEITNPFFAELVQDIETTLFQQNYKVILCNAGQNKEK
FT                   EREYLRMLQANQVDGIIAGAHNLGINEYQQLGLPIVSFDRKLSDNVPIVSCDNYQGIKL
FT                   AVHDLVQAGCHKIYFLGNEHRKGNPTDERLAAYLDEAKECHFSAHIRSVAFSDSSNIKN
FT                   MKIHDMLVNDHPDGVVCTDDLTAVLVLQEAKKLGIKVPKELKVIGFDGTKQIQTYHSEL
FT                   STIAQPIHDIATLLVKLLLTRISNPDEKLRQKNYILPVKLIKSETTA"
FT   CDS             complement(385629..387086)
FT                   /transl_table=11
FT                   /gene="scrB"
FT                   /locus_tag="LCRIS_00399"
FT                   /product="Sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00399"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49846"
FT                   /db_xref="GOA:D5H1G1"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G1"
FT                   /protein_id="CBL49846.1"
FT                   /translation="MEWTREKRYLPYQDWDADTLMHLQAQAANSPYQMRYHLHPISGLI
FT                   NDPNGFSYFDGAYHLFYQSYPFGAVHGLKSWWHFKSTDMVHWENLGLGIEPDTMADSHG
FT                   AYSGSAREIDGKLFIMYTGNHRDENWVRTPYQIGAWMDKNNKVSDKTILFKNPDHITEH
FT                   FRDPQIIKENDTYYAILGTQDKKEKHGHIDVWKSQDLKNWEELGFLDFTNEDMGYMIEC
FT                   PNIVRVDGKVVVIFCPQGLDKKVAAYDDIYPNMYVIADDIDWENHKLINPGKLHNLDHG
FT                   FDVYATQAFNAPDGNAYEVSWVGLPDTTYPTDDENWANCLSQVKELHLKSDKLIQTPVK
FT                   AISSIRKNEASISNQVVSDQAGQQFELELTIKANQSGTLHLAANNDLSNSLQLNFDTKN
FT                   GKLVLDRAHAGQKVAVDYGESRAITLSPNHDLKLDIFVDHSLIEVFVNDGEKVLTGRYF
FT                   ADQTNKKIAFAQDIDYTGKLWQMQTIL"
FT   CDS             387296..389245
FT                   /transl_table=11
FT                   /gene="scrA1"
FT                   /locus_tag="LCRIS_00400"
FT                   /product="PTS system, sucrose-specific IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49847"
FT                   /db_xref="GOA:D5H1G2"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G2"
FT                   /protein_id="CBL49847.1"
FT                   /translation="MDHRKVAERVIKDVGRDNIIAGAHCATRLRLVLKDDSKVDQKALD
FT                   NDPDVKGTFKTNGQYQVIIGPGDVNDVYDEFIKITGLKELSTDDLKKVAAEGKKKNPVM
FT                   DFIKLLSDIFVPIIPALVAGGLLMALNNFLTSPGLFGPKSVVQMVPNVAGISSMIQVMS
FT                   AAPFIFMPILVGMSAAKRFGANQFLGATIGMIMTTPGLLGANHFWDIFGLHVAQTNYQY
FT                   QVIPVLVAVWVLSILEKYFHKHLPSAVDFTFTPLLSIMITGFLTFTIIGPVFKGVSDGI
FT                   TNAIVWLYDTTGAFGMGVFGLTYSAIVTTGLHQSFPAVETQLLAAFAKNPASSGDFIFV
FT                   TACMANVAQGAATFAVYFLTKNKKMKGLASSSGVSALLGITEPALFGVNLKYKFPFFCA
FT                   LIGSGVAAAFAGLMHVTAAALGSAGFLGFLSIYPKTIPMWVVSVLISFAVAFILTYVYG
FT                   KGHLKEEVAEQDVPVNDATDYAEETQKAEKLGKEQMALKDEVIASPVDGTPESLTKVND
FT                   QVFSAKLMGDGAAVIPSDGTIYSPVTGTVTIAYETKHAYGIKSDDGAEVLIHIGLDTVN
FT                   LKGEHFESFVKQGQRVNKGDKLGTVDLDAVKKAGYDTTVMVVITNTANYANVSRITDAG
FT                   DKHGDKLIAVTAHN"
FT   CDS             389401..390369
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00401"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00401"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49848"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G3"
FT                   /protein_id="CBL49848.1"
FT                   /translation="MKLKSGVIGVLVTGLTVFSINLISSKIKAAITVPNPKTDYVVKTT
FT                   SNVYKSNGKRTSFKTRGQIQTGNVPVIESQLYEGKFINVQGTKTINGTAYYKIGPNAYI
FT                   KQNNVLNYAQEKAKLEAYQAQDDVNDDSDQSTELSSDDVNFDIAWYDNINEDPSPAMFD
FT                   DSGYHNRVIKNARKLLGYFTYGTGAYRTNFCSWRHPNKNGSTDCSGFVWIVMKRAGYRV
FT                   GNAPFFTLPMERDAKSTHGYLKKISAKNIRPGDIVIVNTGNGVGQNGHAAIVDGKYDGW
FT                   DTQIIEEGGNLGVDDVHRSSLGSSLSDKLAKGRITYARPVK"
FT   CDS             390415..390930
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00402"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00402"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49849"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G4"
FT                   /protein_id="CBL49849.1"
FT                   /translation="MKKNSTLKHVWIMTAVYWVVGILSIFWGKLDHTFASQLKEINNIY
FT                   VLVLIIILSLPLLLSLLLSVKVKMPRLICNPLVAVIYLLVVIAAGVAYNLQNIIGYFFP
FT                   IILFIIMALVAVFYALVKTFSSRKSGKYFFIDGKDKKECHDFWDAYKKYYVMGLTYGII
FT                   DGLITVIS"
FT   CDS             391112..391396
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="LCRIS_00403"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00403"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49850"
FT                   /db_xref="GOA:D5H1G5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G5"
FT                   /protein_id="CBL49850.1"
FT                   /translation="MLQPIGDRVIVKVKKEEEETVGGIVLASNAKKKPTEGEVVAVGEG
FT                   AYASNGEKIPMAVKKGDVVLYDKYSGTDVEYEGEKYLVLHEKDILAIAK"
FT   CDS             391450..393075
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="LCRIS_00404"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00404"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49851"
FT                   /db_xref="GOA:D5H1G6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G6"
FT                   /protein_id="CBL49851.1"
FT                   /translation="MAKDIKFSENARRSLLKGVNKLADTVKTTIGPKGRNVVLEQSYGN
FT                   PDITNDGVTIAKSIELKDHYENMGAKLVAEAAQKTNDIAGDGTTTATVLTQAITNEGMK
FT                   NVTAGANPVGIRRGIEKATEAAVNELHKISHKVESRDQIANVAAVSSSSKEVGNLIADA
FT                   MEKVGHDGVITIEDSRGINTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDNPYILITD
FT                   KKISNIQDILPLLQEIVQQGKSLLIIADDVTGEALPTLVLNKIRGTFNVVAVKAPGFGD
FT                   RRKAQLQDIAALTGGTVITDDLGLELKDTKIDQLGQARRVTVTKDSTTIVDGAGSKDAI
FT                   QEREDSIRKQIEESTSDFDKKKLQERLAKLTGGVAVIHVGAATETELKERRYRIEDALN
FT                   STRAAVDEGYVAGGGTALVDVEKAINDLKADTADENTGIQIVLRALSAPVRQIAENAGK
FT                   NGEVVLNHLLKQENEIGYNAATDTWENMVDAGIIDPTKVTRTALQNAASIAALLLTTEA
FT                   VVAEIPEEKPANPAPQAGAPGMGM"
FT   CDS             393334..395910
FT                   /transl_table=11
FT                   /gene="mutS1"
FT                   /locus_tag="LCRIS_00405"
FT                   /product="DNA mismatch repair protein mutS"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00405"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49852"
FT                   /db_xref="GOA:D5H1G7"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G7"
FT                   /protein_id="CBL49852.1"
FT                   /translation="MMEQYYEIKKQYPDAFLFYRVGDFYELFEDDAVKGAQILELTLTH
FT                   RSNRTKNPIPMAGVPHMAVDTYVNTLVEKGYKVALCEQLEDPKKAKGMVKRGIIQLVTP
FT                   GTMMNEGPNDAKDSNYLTSVITTKSGFGLTYSDLSTGEIYATHLKSFDAVSNELLSLRT
FT                   REVVYNGPLTEQNKDFMHKANITVSRPTPIEGEHAEISYVEQNLTNGAEKEATRQLVGY
FT                   LLSTQKRSLAHLQIAKSYEVNQYLQMSHTVQNNLELVASAKTGKKMGSLFWVLDKTHTA
FT                   MGGRLLKQWLARPLLNMDEINHREEMVQALLDGYFTRENAVDALKGVYDLERLTGRIAF
FT                   GNVNARELLQLSRSLQAVPVILDALEQSDSDILVDFAKKIDPLKGVAEMITSTIVKDPP
FT                   VLTTEGGLIQGGVDPQLDRYRDAMNNGKKWLAEMEADERQKTGIDNLKVGYNKVFGYYI
FT                   QVSNGNKSKVPLDRYTRKQTLTNAERYITPELKEHENLILEAQTRSTDLEYDLFVKLRE
FT                   DVKKYIPALQKLGGQLAALDVYCGFATVAEQNNYCRPTFHADNQDINVTNGRHPVVEKV
FT                   MTAGSYIPNDVKMDEGTNIYLITGPNMSGKSTYMRQMALIAIMAQVGSFVPADSADLPI
FT                   FDQIFTRIGAADDLISGQSTFMVEMSEANEALQYATKRSLVLFDEIGRGTATYDGMALA
FT                   GAIVKYLHDKVGAKALFATHYHELTVMDETLDHLKNIHVGATEENGKLIFLHKILPGPA
FT                   DQSYGIHVAQLAGLPRNVLREATKLLKRLEAQGSELAPVSQQLDLFAEPVENSVEETET
FT                   QNDKPAITDAQQDILDDISNLYLADKTPLQVMQMVADWQKDLKDDD"
FT   CDS             395910..397835
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="LCRIS_00406"
FT                   /product="DNA mismatch repair protein mutL"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00406"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49853"
FT                   /db_xref="GOA:D5H1G8"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G8"
FT                   /protein_id="CBL49853.1"
FT                   /translation="MSKIHELSETLTNQIAAGEVIERPASVVKELVENSLDAGATRIRV
FT                   DFVDAGLKQIVVQDNGTGIARDQVDLAFTRHATSKIANEHDLFKVSTLGFRGEALASIS
FT                   AVSHVEILTATENAIGIRANYSGGNKKGQEDAAARKGTKITVKDLFFNTPARLKYLRSP
FT                   RTEIMKIVDIINRLALGYPHVSFTLSNTGKILLRTPGNNNLKQTVANVYGRHIAEKMEK
FT                   FEAKDSDFKITGLMSKPELTRSTRNFISILLNGRYIKNFQLNTAILDGYGSKLAARHYP
FT                   IIVLAIKVDPLLVDVNVHPTKQEVRLSKEKELGRLITSAISNTLVEKVEQISAFANLEN
FT                   KRDTLVDQLSFNLNQDVVNTARKKEPEIREQEKPKFLTIESDDSEDNIQNEAVKQDSEK
FT                   KYVDLNQPREDDQYIVTKTWKQNVALQQALTPFPTTRTNQEVISSGDETLANNLPRLVY
FT                   VGQTDTYLFAQHNGDLFLIDQVAARRRLKFEQIFHMITAKKVVQQGLLTPIILEFGNLD
FT                   FMQIKDQVEQIKQVGIYLEDFGQNSFIVRSYPTWIHDNVEDSIRKILDGYLNVDKGKAK
FT                   NLFSRIAAMQAKREITGKIKLSAAEAEQILLDLRKCTDPYHDADGRIILVRMSQNELRK
FT                   MFKKDE"
FT   CDS             397835..398422
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="LCRIS_00407"
FT                   /product="Holliday junction ATP-dependent DNA helicase
FT                   ruvA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00407"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49854"
FT                   /db_xref="GOA:D5H1G9"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1G9"
FT                   /protein_id="CBL49854.1"
FT                   /translation="MYEYFEGVITVVTPSYVVVDVGGVGYKVYSPTPFAYTQGQKAKVF
FT                   IEQVVRDTGITLYGFQSQDDKGLFLKLLSVSGIGPKSAMAIMAAEDSNSLAEAIEQGEV
FT                   KYLTRFPGVGKKTASQIVLDLKGKLGDYVARLDRPDNGEDVPPALNDALLALIALGYTQ
FT                   KEVDRITPKLEKVAANTADQYIKKGLALLLKK"
FT   CDS             398462..399481
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="LCRIS_00408"
FT                   /product="Holliday junction ATP-dependent DNA helicase
FT                   ruvB"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00408"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49855"
FT                   /db_xref="GOA:D5H1H0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H0"
FT                   /protein_id="CBL49855.1"
FT                   /translation="MKLVAEDQVTSGDIENPEEQQMELSLRPQTLDQYLGQKRVKKEMS
FT                   IYIKAARQRDEALDHVLLYGPPGLGKTTLAFVIANELGVHLKSTSGPAIEKSGDLVALL
FT                   SDLDPGDVLFIDEIHRLAKPVEEVLYSAMEDYYIDIVIGEGQTTHAVHVPLPPFTLIGA
FT                   TTLAGQLSAPLRDRFGIVEHMQYYTIDELEQIVLRSSDVFHTSIAPEAAHELARRSRGT
FT                   PRVANRLLKRVRDFAEVKGEKTISLETTEGALKQLQVDDEGLDQTDRRLLRTMIEGYNG
FT                   GPVGIRTLAANVGEDMETIESLYEPYLLQHGFILLTPRGRMVTDKAYLQLGLPIPGDK"
FT   CDS             399541..399933
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="LCRIS_00409"
FT                   /product="Protein translocase subunit yajC"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00409"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49856"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H1"
FT                   /protein_id="CBL49856.1"
FT                   /translation="MNILFLANAGAAASSNWMMIGLFIILIAFTYFGMIRPQKKQQQQR
FT                   MQMMDKLKKGDEVILVDGLHGKVDKINSDKTIVVDADGIYLTFERMAVRRVIPVAAPAT
FT                   PAAETKAEAPAEKPEEKADETKKEDK"
FT   CDS             400037..401488
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="LCRIS_00410"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49857"
FT                   /db_xref="GOA:D5H1H2"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H2"
FT                   /protein_id="CBL49857.1"
FT                   /translation="MKNIPVVMIIFGGSGDLAHRKLYPALFNLYEQGLIHDNFAVIGTA
FT                   RRPWSHEYLREQVSDAIHETHDTVDENELKAFASHFYYQSHDVTNVEHYEILKNLAQEL
FT                   DDRYSAQGNRLFYMAMAPRFFGTIATHINDQDLTGSGFNRIVVEKPFGHDLASAEELNK
FT                   QITASFDENDIFRIDHYLGKEMVQNIMPMRFTNPMVQNIWCSKYIKNIQVTLAERLGVE
FT                   ARGGYYDTSGALRDMVQNHIFQIITLLAMAEPKDLSSASVHQAKQDLLKSLIIPTPDDV
FT                   KKYFVRGQYLGSDTTFAYKQEPNVDPESTTETFVAGKVKFNEGPIAGVPIYFRTGKEFK
FT                   EKKNRIDIVLKHINNPYGQAHSNNITIVIDPTSEIYFTINGKRIDQPGIRRENLTYEFS
FT                   KAEMAKVPDGYERLLHDVFVNDSTNFTHWSELKRYWEFIDAVEDAWQKENEAGNPAIAQ
FT                   YLPYRMGPKEANTIFESPTEHWIYE"
FT   CDS             401364..402599
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="LCRIS_00411"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00411"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49858"
FT                   /db_xref="GOA:D5H1H3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H3"
FT                   /protein_id="CBL49858.1"
FT                   /translation="MLGRRKMKQAIQPLHNICHTEWGQRKLIQSLSHQLNIGFMNKENL
FT                   LPQNDIHRRIIHLDMDAFYASVEMQEHPEWKNKALIVGQDPRQNGGHGVVATCNYVARK
FT                   YGVHSAMAAIQAVRLVPKELIVFTRPRFDKYRAVSAKIHSFMHDVTDQVESVALDEAYL
FT                   DVTHPKIEQESAVQIALDLQKRIRQEVGLNSSFGVSYNKFLAKMGSEYAKPFGRTVILP
FT                   SEVQNFLAMQKIEKFPGIGPKTQEELHQIGVYTGADLQKVEVLTLIKKFKKMGYILAQH
FT                   ARGIDLRPVVTDSEANRKSIGMERTYEPAIYTEDEALTNIRNYCNHLEAALKKRNFKAG
FT                   TVVIKVRNNNFDTVTKRKKLKTPSDSHLDFYDVARDLFEATSSFLDDGIRLLGVTVTDF
FT                   EKKKYQSISLFD"
FT   CDS             402663..403619
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00412"
FT                   /product="Phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00412"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49859"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H4"
FT                   /protein_id="CBL49859.1"
FT                   /translation="MSSFDDIYEKILQYPTIILHRHTSPDPDAIGSQAGLARALMEKFP
FT                   DKRILCAGENDEGDLAWINHMDQVKATDYEGALVITTDTANTPRISNKLYDKGDFLIKI
FT                   DHHPDVDPYADMSYVDPDAPAACQIIVDFLNEEGFKITKEVAYPLYAGIVGDTGRFMYP
FT                   ETSEHTFKVAAQLASTGINITEIARNIADVTFDEAKLQALAMDKMEIDPVGAAYTILMQ
FT                   SDLKKLGLIDDQANVAVSTPGRIKDVLAWNVFVEKPDGTFRVHYRSKGPVINELAAKHD
FT                   GGGHALASGANAKDMDEVKQVFAEVVEVTKKFKEDHE"
FT   CDS             403612..404973
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00413"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00413"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49860"
FT                   /db_xref="GOA:D5H1H5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H5"
FT                   /protein_id="CBL49860.1"
FT                   /translation="MNNIFIDSRIKPAIQAGLKKIHFEKPTKVQEKVIPAMLSDLSVVV
FT                   QAATGSGKTHAYLVPIFNEIEEDKRYVQAIVTLPSRELADQLYKVARQLRDAAGMHFSI
FT                   AHLAGGTDRERQLEKYQNNTPQLVIATPGRLLDFVQKKVFAVDQVKTFVIDEADMTLDM
FT                   GFLNDIDQVAAKLPKDVQIAAFSATIPVKLSNFLRKYMAHPDEIVIDNPSVIAPTIKND
FT                   LLDIGSKDRKNVLYKLLTMGQPYLALVFANTKQKVDELTNYLQDQGLKVAKIHGGVTER
FT                   ERKRTLRQVEQGQYQYVVASDLAARGLDIDGVSLVVNYEIPRDIEFVIHRIGRTGRNGL
FT                   SGHAITLIREEEMNRIEELEKMGVHFDFVEIKNGELVPRKHYRSRENRQSKNRKLDTKL
FT                   VGYVKKEKRKRKPGYKKKIKRAIQEDNRQKRKLEQRHEVRKAKRLRKRKREQGL"
FT   CDS             405216..407855
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="LCRIS_00414"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00414"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49861"
FT                   /db_xref="GOA:D5H1H6"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H6"
FT                   /protein_id="CBL49861.1"
FT                   /translation="MKKLNSSEFRQMFLDFFKDHGHMIMPSASLIPQDDPTLLWINSGV
FT                   ATMKKYFDGSVVPKNHRITSSQKSIRTNDIENVGKTARHQTFFEMLGNFSVGDYFRDEA
FT                   IPWAWEFLTSPDWLGLPKEKLYCTVYPKDEDSFNVWVKAGMPADHIVKLEDNFWDIGEG
FT                   PCGPDTEIFYDRGQENNDVAEDDPENFPGGENARYLEIWNIVFSQYNHLPNGKYVDQPH
FT                   KNIDTGMGLERVLSILQDAPTNFETDLFLPIIHATEEMTDDKKYGVNKEDTTAFKIIAD
FT                   HVRAVSFAIADGALPSNSGRGYVLRRLIRRADLNGQRLGIKGAFLYKLVPVVGKIMESH
FT                   YPEVMDQRGFIENVIQNEEERFQSTLDTGLTLLDDLIDKAKNSKDKTISGKDAFKMFDT
FT                   YGFPYELTFESAQDAGLKVDKKGFDAEMAAQKERARKARGDLQSMGRQDVTLMNIKDKS
FT                   VFERDTYEEPHAKLVDIVVDDKLVDKADGEHATLVFDKTPFYAERGGQVADHGKIYNQN
FT                   GELVAEVTDVQHAPNDQNLHFVDLILPVEKGQEYVLKLDKERREGLRHSHSATHLLHAA
FT                   LRQVLGEHTHQAGSLVDPDYLRFDFTAMEPMTKRELKTVEELVNQKIWEAIQVKTTITT
FT                   PEEGEKMGALALFDSKYGDKVRVVQMGDFSSEFCGGTHVDNTNQIGIFKITSESAVGAG
FT                   MRRIEAVTSKKAYEYLANRSDLLDDIQEEVKATKPDNIVDKIDSLESDLHDAQKQVETL
FT                   NKKINAAKAGQIFNDVKQAGDLTVIAATADVNGMNDLRELADNWKSGNKSDVLVLAAEN
FT                   AGKANMIIALGQKALDKGLKAGNLIKIAAPIFGGGGGGRPNMAQAGGKNPAGLNDAIKA
FT                   VIDEISKN"
FT   CDS             407916..408173
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00415"
FT                   /product="UPF0297 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00415"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49862"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H7"
FT                   /protein_id="CBL49862.1"
FT                   /translation="MSSLDKTMHFDFNQNKGKNVYDTLQDVYNALEEKGYNPINQIVGY
FT                   LLSGDPAYIPRHNDARNLILKHERDEIIEELVKSYLGKNK"
FT   CDS             408173..408601
FT                   /transl_table=11
FT                   /gene="ruvX"
FT                   /locus_tag="LCRIS_00416"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00416"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49863"
FT                   /db_xref="GOA:D5H1H8"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H8"
FT                   /protein_id="CBL49863.1"
FT                   /translation="MRLLGLDVGSKTVGVAISDELGITAQKLETIQIDESRYNFGMRPL
FT                   KKLVRQYEVDGFVLGLPKNMDGTSGSSVARSKAYGKRLEEKFGLPVHYSDERLTTIESR
FT                   RVLVEDAGIHDRKKRKQVIDQMAAVLILQNYLDLHRKD"
FT   CDS             408603..408914
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00417"
FT                   /product="UPF0473 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00417"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49864"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1H9"
FT                   /protein_id="CBL49864.1"
FT                   /translation="MAAQVNGDDQDRQITLIDDQGNEELYEILFTFHSDDYDKSYVLLY
FT                   PAAVGDDEDIEVQAFSYDADDAGDVTSSDLHEIESDDEWDMVQGVLNTFLDDDRLSGK"
FT   CDS             408972..411329
FT                   /transl_table=11
FT                   /gene="mutS2"
FT                   /locus_tag="LCRIS_00418"
FT                   /product="DNA mismatch repair protein MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00418"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49865"
FT                   /db_xref="GOA:D5H1I0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I0"
FT                   /protein_id="CBL49865.1"
FT                   /translation="MNKKILEILEFGEITKRLSKLAITGPAKKEAEELLPSGDFEQVQN
FT                   ELKQTLALTNLLRIKGQLPLTDFQDVRPSTKRLSVKANLNAKELGNLLLVLSLAHEIND
FT                   FLAEIDPNKLDLTAIDEILDQLDVPDLLFRELKKSVDYDGEVLDTASHELARLRHDIRS
FT                   NEEEIKNKMDAYTKGNSSKYLSEQIVTIRDDRYVIPVKQEYRAKFGGVVHDQSASGQTL
FT                   FIEPEAVLNLNNRQQNLIAQEKQEIRNILKHLSNLAREEITSLNNIAAALTELDFLQAK
FT                   AKLAKEMKASEPRLTQDHSLNLLKARHPLIDPEKVVPNDIRLGGEFDTMLITGPNTGGK
FT                   TITLKTAGLLQLMAQSGLFIPAEEGSKVGVFKQVYADIGDEQSIEQSLSTFSSHINDII
FT                   AIMKNVDSETLVLIDEIGAGTDPEEGASLAISILDFLRKKDAKIMVTTHYPELKLYGYN
FT                   RPRTTNASMEFDLKTLSPTYHLQIGIPGHSNAFAIARKLGMREDVVKNAQNLMSDEDSD
FT                   INKMITKLNTQTKAATVARNRLQTSLDRSQKLEQKLQQALDWYNQRVQKQLDFAQERAN
FT                   EVVAKRRKKADEIIAQLEKQKNMGVKENKIIEAKGELNSLERQANNLAHNKVLQREKRR
FT                   HHVSVGDRVKVLSYGQTGTITKKLSEHEYEVQMGIIKVKVSDRDIERIEKGESTKPRQT
FT                   VRATSAVRRSNAHSELDLRGQRYDEAMTNLDRYIDSVLLAGLDTVTIIHGIGTGAIRKG
FT                   VWQYLRSSNHVKNFNYAPANEGGNGATIVQLK"
FT   CDS             411412..411723
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="LCRIS_00419"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00419"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49866"
FT                   /db_xref="GOA:D5H1I1"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I1"
FT                   /protein_id="CBL49866.1"
FT                   /translation="MVEAINDQNFEEETKNGVALVDFWATWCGPCKMQSPVIDQLSEER
FT                   QDVNFYKMDVDQNQDTAKNLGIMAIPTLIVKKDGNIVDRITGYTPKEKLNQILDQYTD"
FT   CDS             complement(411777..412151)
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="LCRIS_00420"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49867"
FT                   /db_xref="GOA:D5H1I2"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I2"
FT                   /protein_id="CBL49867.1"
FT                   /translation="MIKEFKAFISRGNVMDMAVGVIIGAAFTAIVQSLVKNLINPLLGI
FT                   FAGKIDFSNLVFKVGDATFKYGSFINSVINFLIISFVVFLMIKALNRVMPKKEKEAGPT
FT                   EADYLEEIRDLLKKQVNQNK"
FT   CDS             complement(412240..412662)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00421"
FT                   /product="Hydrocarbon binding protein, V4R domain"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00421"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49868"
FT                   /db_xref="InterPro:IPR019642"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I3"
FT                   /protein_id="CBL49868.1"
FT                   /translation="MNKFMTENTENTNEHVYFINQLYRDFLLPTILGDDDASILYWAGK
FT                   RIARKYDLSDYDDLVEFFNMAEFGKLEKIKERRSFTTYELSGQTVTDRLNSASKEFSLE
FT                   GGMIAEAFQKSTGRTTECEINILDKEKKVQFIARFG"
FT   CDS             412739..413545
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="LCRIS_00422"
FT                   /product="Glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00422"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49869"
FT                   /db_xref="GOA:D5H1I4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I4"
FT                   /protein_id="CBL49869.1"
FT                   /translation="MDNRPIGLLDSGLGGLSVAKKVIEKLPNESTVFIGDNAHMPYGDR
FT                   TKEEIIELVRKSVQFLLDKNVKLIIFACNTATAMAMSTIQAEIDPQIIGVIQSGSLAAS
FT                   RTTKNKKVAVVSTKATAESHAYAKEIRFRDPEIQVTELAAPKLAPLVEAQKDHETNLKV
FT                   VKESLTPLQGKDFDTLIMGCTHYPLIQKEFKEAINDKNVTILDPADQVAQYTFNVMRRD
FT                   GLFSDGNEKVSHEYYTTGDPTSFDRLARTFMDDATLTSKHVDTENE"
FT   CDS             413545..414165
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="LCRIS_00423"
FT                   /product="Nucleoside-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00423"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49870"
FT                   /db_xref="GOA:D5H1I5"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I5"
FT                   /protein_id="CBL49870.1"
FT                   /translation="MVKEILFATGNQGKAKELKEAFKQAGVDIEIKTNADLDNPPHPIE
FT                   SGHTFEANAKIKAHELANFSKLPTIADDSGLIVDALNGEPGVRSARYAGEAHNDAKNNA
FT                   KLLANLGGVPDEKRTAKFWTTIVVSMPGEFDKDLVVSGTCSGRILAAPCGEDGFGYDPL
FT                   FYIPEKEKTFAQMTTDEKNEISHRGRAVQKLLKELPSWLEQFD"
FT   CDS             414260..415228
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00424"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00424"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49871"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I6"
FT                   /protein_id="CBL49871.1"
FT                   /translation="MGITNPPPKITVKISCLKNLMFMLRILSMIAKNNIYGPKYRKLRV
FT                   LHHINLVNAARNVTNKSTLAEWEKGKDNLSWCKVIQLLFNIHIQPIEFLENSVRSQLYE
FT                   SINNIAVAYRDNNKKQLKKILKENLEKYQEKSQNQNKDILFQVAIASNFYEDLSGDRVC
FT                   PLVVKNKVILYFSDVVSNENFWCYEDIFYFNLITQILDARHLYGFSLKLLEYVRNNRIN
FT                   SKIWYELVLNTLLNAEFSLIKKDLNKAESLLNDLNTLEVIDCYAQESIRKKFMESLILY
FT                   LKNDSNTEVYSLFRCLDFLDLTNMKLDFETAFLQIKEIYKK"
FT   CDS             415379..416035
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00425"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00425"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49872"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I7"
FT                   /protein_id="CBL49872.1"
FT                   /translation="MKIMLLSKKITVVSSMAMALVVTGLALTAKPVSASSYNETELSQN
FT                   SMEPSTKAEYHLFTEAEAKEISNLITVKNGKYLVDSDKAGQASLNQVKLAKQFVDQVNE
FT                   TRNNIRLYGVNLAHAHHKYFTYRNFTWGTRYYFSTNAAVAQMQSDLTNKSLIIGGAGAA
FT                   ASVIGGAIPGLIGTFGAGYFEKMSSDLGAYNAAHSNKQIYMDLNWAGIYSFHIWH"
FT   CDS             complement(416438..417274)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00426"
FT                   /product="Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00426"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49873"
FT                   /db_xref="GOA:D5H1I8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I8"
FT                   /protein_id="CBL49873.1"
FT                   /translation="MKIPTHINIQKIEIDWSKISQNLLSIIWQLAITSLIFYLLSHFGH
FT                   KIINNYLAKHNTVKNKRTRTITALINSVFQYTLIFFYLFGILSILGVPVGTLLASAGIF
FT                   SLALGMGAQGFVSDLVNGFFILSEDQFDVGDLVQIGTNVGTVVQLGLRTTRLKGSDGSI
FT                   IFIPNRNITIVQNLAHGGVALDINLDLDTKNDIDEVNKLIKECNRKIQPEKKTIVSGPT
FT                   IVGVIEQTGKKFVYSIHFQVKPGKQSAVRNLYLTQYIQILRENNIVFASTERPANK"
FT   CDS             417383..417808
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00427"
FT                   /product="Methyl-accepting chemotaxis-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00427"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49874"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1I9"
FT                   /protein_id="CBL49874.1"
FT                   /translation="MTISYGALAGLIAAIAFLILVLFTIPMLIRTAKLLKETSATIQTT
FT                   NESMKKISEDMDGLMDQTSDLLDKTNDLMTDVNGKMKTLDPVVKAAADLGESVSELNDS
FT                   SKKIAKRFSSNHLSRTGLISSIAATAFARRKRRRGEN"
FT   CDS             417826..418194
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00428"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00428"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49875"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J0"
FT                   /protein_id="CBL49875.1"
FT                   /translation="MKKFASFLLGAVAGCAAGFLAGSLLVSDEQVDDVKNKIKDNDKLQ
FT                   DLKKKYDNGTEIVKNQLASFPKNVEDDSELKDFDDIVIDDSNKDDDDSENAEESVNDLN
FT                   NAEKDDTDAASTSEKPQA"
FT   CDS             complement(418254..419360)
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="LCRIS_00429"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00429"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49876"
FT                   /db_xref="GOA:D5H1J1"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J1"
FT                   /protein_id="CBL49876.1"
FT                   /translation="MNLDKLQQWLQDSNNDLAYISNPITISYFTGYSMEPHERIFALIV
FT                   LKDAEPFIFCPALNVEEAKASAWDGDVIGYLDSENPWSIIADNVKKRTHDTRNWAIEKD
FT                   DLSVAHYQLLRGEFPNASFTNDVSPFIEKLRLYKTPEEIKKLQGAGAEADFAFKIGFDA
FT                   IRTGVTERSIAGQIDYQLKIQKGVMHESFETIVQAGKNAANPHLGPTMNTVQPNELVLF
FT                   DLGTMHDGYASDSSRTVAYGEPTAKQREIYEVDREAQQAAIEAAKPGITAEELDSVARD
FT                   IITKAGYGEYFIHRLGHGIGKNVHEYPSIVQGNDLVLEEGMCFSIEPGIYIPGFAGVRI
FT                   EDCGVVTKDGFETFTHTDKDLKVLPLKD"
FT   CDS             419511..420512
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="LCRIS_00430"
FT                   /product="Catabolite control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49877"
FT                   /db_xref="GOA:D5H1J2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J2"
FT                   /protein_id="CBL49877.1"
FT                   /translation="MHKQEVTIYDVAREAKVSMATVSRVVNGNSNVRKETRDRVLEVIK
FT                   RLHYQPNAVAQGLASKRTTTVGLIVPDLTNLYFAELSKGIDDIALLYKYNIIITSIENR
FT                   LMKEDQVIQSLLNKQVDGVIYMSNRLSDEAADAFKRTDTPVVLAGTKDNRDDFASVTID
FT                   YKKADTEALNLMYHDGKKHLGIVVGDQDAVVNSENRIPAYEEFMEENDLGTPRIYTDIK
FT                   DYSDGYNLYPQLVKDGVDGVIVTRDISSVGILNSAMDAGKKVPEDLEIVTASATQLASV
FT                   VRPALTTIKQPLYDMGAVAMRMLTKLMNNEEVDDTHIVLPYELVKKQSTLNQ"
FT   CDS             complement(420554..421924)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00431"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00431"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49878"
FT                   /db_xref="GOA:D5H1J3"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J3"
FT                   /protein_id="CBL49878.1"
FT                   /translation="MKFKSRLVWVLFFSLVFFINSGFTVVGHRGDPIKYPEETIQADDS
FT                   AFNSGADYVELDLQLSKDGVPVIAHDDDLFRVTHTHAIVSQNNFTALKQLQYDNGEHVM
FT                   SLSELFKHYQNKPNTKFVLETKIDHGLNPSYELEDKIAQIVKKYHMQKRIMIHSFSAAS
FT                   LFHFRKIMPEAYLILIVGSLKRINFSNLPQVNAINASSDIVQEHPFLIHWLHKLHKQLF
FT                   VWAEMDESPALWHWLINRNVDGVVTNYPATGFKYKLAKSGTKKYAINRTGIYFGKTKAA
FT                   TMMNPYVRIKEKKYVQPGQKVNVTYGVRVDDRLFYQIAEKTFISAEFVNFDLTKRDIAP
FT                   YQNKKIIAKPNQKVTIYRYPDNQAKTQQKLPANQLLKIQNFNGSPKNMWIYTKLGWVKA
FT                   KDILFYGFFSQDDFRDYQSLPRVSQYTNLVLLPYNPNQAIAPTTFTQKLQQINKIIY"
FT   CDS             422038..422358
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00432"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49879"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J4"
FT                   /protein_id="CBL49879.1"
FT                   /translation="MEQLDLIEEVTRNDGSRYYEISNIDQNGIAELAADHGLIKKVKIL
FT                   QLNIPRTKALIAYEKYINDTYDLQTLTNESDWKNPKWVEWDKPKGKILDAYNMILKANR
FT                   IG"
FT   CDS             422374..423756
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00433"
FT                   /product="5'-nucleotidase/2',3'-cyclic phosphodiesterase
FT                   related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00433"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49880"
FT                   /db_xref="GOA:D5H1J5"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J5"
FT                   /protein_id="CBL49880.1"
FT                   /translation="MEQLRILHTNDLHSHFEHFPKIGRYLKKAQADQSVDDIYTFDAGD
FT                   FMDRSHPLTDATEGQANIKLMNGFNYDAITIGNNEGISNPHWVLEHLFDHADFPTVLAN
FT                   LREEDESMPKWAVGHMFLTTKKKTRIALIGLTAAYPMTYGPNHWHVKMLVDSMDHELAQ
FT                   IEGKYDVLILLTHVGLKMDRWLAKHYPQINLIVGGHSHDLIEHGEKVGHTWITQTGKWG
FT                   NYVGDIHLELEDHHVIKVVPRTISTASMPEEPEDKAVIQGYYDEGKRLLSERKVANLPE
FT                   KFADDKVAAVQVSLDAIADFAKTDLAILSSGLFLTPFKSGIITQYDLQNALPHPMHVVR
FT                   STLKGYDLWRLVMEIEKNRHYLDHFPLQGMSFRGKIFGQMYYKGIKVDMRKRVVYVNGH
FT                   EIDPQKEYKIACLDHYVLVPFFPTLAIVGENEFLFPQFLREVVGKYLAEKYPLTARSEK
FT                   DD"
FT   CDS             423749..424339
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00434"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00434"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49881"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J6"
FT                   /protein_id="CBL49881.1"
FT                   /translation="MTEENKFEQEQPIRHPLADVVQDGKSIKIGAQLYSIIVNERDALD
FT                   LESLRKKYDPYLDQYDYLVGDVSSEHLRLKGFYKDGARTAIDKKEMAIVDYLTEYCNPG
FT                   GPYFILELTHPVHYYQHQRTKIRRSRERRERDFGKNERYHARRRNYRKNKNENNPFKKR
FT                   RVHQTKFKKKQSIAVKKEFGRHHSFIIKKRKGN"
FT   CDS             424339..425109
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00435"
FT                   /product="HAD superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00435"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49882"
FT                   /db_xref="GOA:D5H1J7"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023215"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J7"
FT                   /protein_id="CBL49882.1"
FT                   /translation="MKDYRVFLIDLDGTVYRGKETVESGVRFVHRLVQAGKDYLFLTNN
FT                   TTRTPQMVVDKLKGHGIETDTDHVYTPSMATASYILQREHKEKIGLYIIGQIGLWRELL
FT                   QHPEFEINEENPDYVIVGMDTDLTYHKVRVASRAIRRGATFIGTNADMNLPAEDELIPG
FT                   NGSQCAFVAAASGVEPLYIGKPESIIVKMALDKVGYSKDEALLVGDNYDTDIKAGFNSG
FT                   VDQLLTLTGVTTKVDIADKRQPTILVNNLDEFEL"
FT   CDS             425106..425714
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00436"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00436"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49883"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J8"
FT                   /protein_id="CBL49883.1"
FT                   /translation="MITKNNIFSLIYHFLFAVSSSVIGAIVASWPLLFIFMIVQKTYET
FT                   VHMSLFKVMHNYNQLMFYLLWPFKKQLKMDNFPTSANAAEHFAECKHLFILTLLVFIIC
FT                   IIVHFVFKRQKKKLLLNLDKSVALILLLLPIIIFPFAVTNFDSFFVIFHHILFNNSDWL
FT                   FDPNTDPIINVLTEGFFASCFAVAGVIYELYFAEKLLRK"
FT   CDS             complement(425726..426376)
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="LCRIS_00437"
FT                   /product="DedA protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00437"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49884"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1J9"
FT                   /protein_id="CBL49884.1"
FT                   /translation="MSLIDFILHIDDHLITIVNQFGGWSYLILFAIIFIETGLVVFPFL
FT                   PGDSLIFAASAMAANPKYGLNIWLVYLIVAFAAIIGDSINYEIGAWSTRAGEKHSWFNK
FT                   LINQNNRLAAEKFFERHGPITIVIGRFIPFIRTFVPFISGGSKMHYGKFITYNILGGLL
FT                   WTGLFTIIGFFFGNIPFVKDHFSMIVIAIILVSVVPIAIVAIKKKISLKKEFH"
FT   CDS             complement(426386..427378)
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="LCRIS_00438"
FT                   /product="Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00438"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49885"
FT                   /db_xref="GOA:D5H1K0"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1K0"
FT                   /protein_id="CBL49885.1"
FT                   /translation="MLKLIHHYFEEVIKIKKFDLTIIGGGPVGLFAARFAHLHGLKTVL
FT                   FDSLSETGGQPQMLYPFKKIKDIPAYDSITGTELIDNLRHNLTDTTIFTNHKVENVTKQ
FT                   KDGFIIDDIVASRSILITTGAGAFKPKALPLSMDDDTQKRIHYFIKDPQKFVGQTVGVF
FT                   GGGDSALDLALELANYANVKIIHRRNQFRGLESNVKKLKSLKNVEILTPYLPKQINLVD
FT                   NQLNVNLKEMGKDSLTNIKLDQAVVAYGFKANNRFVKKWGIDLAGAQIKVNSTMQTNIA
FT                   SVYAAGDVVTYPGRVPLIALGFGEAQIAITAIMRDLFPEKTLTIHSTSF"
FT   rRNA            427906..429457
FT                   /gene="16s rRNA"
FT                   /locus_tag="LCRIS_02036"
FT                   /product="16S ribosomal RNA"
FT   CDS             complement(427983..428108)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00439"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00439"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49886"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZ91"
FT                   /protein_id="CBL49886.1"
FT                   /translation="MRSAFLSGISTCFQVVSQTMGQVPHVLLTHPPLAFLTSLPK"
FT   CDS             complement(428168..428602)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00440"
FT                   /product="PG1 protein, homology to Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49887"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H3"
FT                   /protein_id="CBL49887.1"
FT                   /translation="MEFHSPLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQR
FT                   LPPTYYRGCWHVVSRDFLVDYRQIKASYYLYPSSPTTELYDPKTFFTHAALLHQTCVHC
FT                   GRFPTAASRRSLGRVSVPMWPISLSTRLCIIALVSLYLTN"
FT   CDS             429036..429389
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00441"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49888"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZ89"
FT                   /protein_id="CBL49888.1"
FT                   /translation="MLLVASIKLGTLMRLPVTNRRKVGMTSSHHAPYDLGYTRATMGST
FT                   TRSEPAKASESLKAVLSSDCSLQLDCTKLESLVIADQHAAVNTFPGLVHTARHTMGVCN
FT                   AQSRWPNLREGAV"
FT   tRNA            429594..429668
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="LCRIS_02046"
FT                   /product="transfer RNA-Ile"
FT   tRNA            429725..429797
FT                   /gene="tRNA-Ala"
FT                   /locus_tag="LCRIS_02047"
FT                   /product="transfer RNA-Ala"
FT   rRNA            429920..432825
FT                   /gene="23s rRNA"
FT                   /locus_tag="LCRIS_02032"
FT                   /product="23S ribosomal RNA"
FT   CDS             complement(430474..430944)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00442"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00442"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49889"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZ88"
FT                   /protein_id="CBL49889.1"
FT                   /translation="MIWAVSLSTTDLITRSLTPVYGYLEFVVYLDSVTPDGPLVQTELY
FT                   LHYPLHEASPKAISERTSYLQVRLEFHRYPQLIPAIFNLRGFGPPVRFTTPSAWSWVGH
FT                   LVSGLRHLTFRPIKTRFRSGSVFSDLTSLDNVTRRFILQKARHCTLMCFDYL"
FT   CDS             432271..432558
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00443"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1K5"
FT                   /protein_id="CBL49890.1"
FT                   /translation="MTARETTRAGRKLGLSDLVVPYGRAITQRIKATLGITGLSPPRVH
FT                   IDGEVWHLDVGSSHPGAEVGPKGWAVRPLKRHASWVQNVVRQFGPYPSWA"
FT   rRNA            432898..433013
FT                   /gene="5s rRNA"
FT                   /locus_tag="LCRIS_02028"
FT                   /product="5S ribosomal RNA"
FT   tRNA            433020..433092
FT                   /gene="tRNA-Val"
FT                   /locus_tag="LCRIS_02048"
FT                   /product="transfer RNA-Val"
FT   tRNA            433097..433169
FT                   /gene="tRNA-Lys"
FT                   /locus_tag="LCRIS_02049"
FT                   /product="transfer RNA-Lys"
FT   tRNA            433183..433264
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="LCRIS_02050"
FT                   /product="transfer RNA-Leu"
FT   tRNA            433289..433361
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="LCRIS_02051"
FT                   /product="transfer RNA-Thr"
FT   tRNA            433372..433443
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="LCRIS_02052"
FT                   /product="transfer RNA-Gly"
FT   tRNA            433455..433540
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="LCRIS_02053"
FT                   /product="transfer RNA-Leu"
FT   tRNA            433549..433622
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="LCRIS_02054"
FT                   /product="transfer RNA-Arg"
FT   tRNA            433628..433701
FT                   /gene="tRNA-Pro"
FT                   /locus_tag="LCRIS_02055"
FT                   /product="transfer RNA-Pro"
FT   tRNA            433732..433805
FT                   /gene="tRNA-Met"
FT                   /locus_tag="LCRIS_02056"
FT                   /product="transfer RNA-Met"
FT   tRNA            433819..433892
FT                   /gene="tRNA-Met"
FT                   /locus_tag="LCRIS_02057"
FT                   /product="transfer RNA-Met"
FT   tRNA            433916..433989
FT                   /gene="tRNA-Met"
FT                   /locus_tag="LCRIS_02058"
FT                   /product="transfer RNA-Met"
FT   tRNA            433993..434066
FT                   /gene="tRNA-Asp"
FT                   /locus_tag="LCRIS_02059"
FT                   /product="transfer RNA-Asp"
FT   tRNA            434073..434145
FT                   /gene="tRNA-Phe"
FT                   /locus_tag="LCRIS_02060"
FT                   /product="transfer RNA-Phe"
FT   tRNA            434164..434234
FT                   /gene="tRNA-Gly"
FT                   /locus_tag="LCRIS_02061"
FT                   /product="transfer RNA-Gly"
FT   tRNA            434241..434315
FT                   /gene="tRNA-Ile"
FT                   /locus_tag="LCRIS_02062"
FT                   /product="transfer RNA-Ile"
FT   tRNA            434318..434410
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="LCRIS_02063"
FT                   /product="transfer RNA-Ser"
FT   tRNA            435164..435235
FT                   /gene="tRNA-Glu"
FT                   /locus_tag="LCRIS_02064"
FT                   /product="transfer RNA-Glu"
FT   tRNA            435270..435356
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="LCRIS_02065"
FT                   /product="transfer RNA-Ser"
FT   tRNA            435368..435441
FT                   /gene="tRNA-Met"
FT                   /locus_tag="LCRIS_02066"
FT                   /product="transfer RNA-Met"
FT   tRNA            435445..435518
FT                   /gene="tRNA-Asp"
FT                   /locus_tag="LCRIS_02067"
FT                   /product="transfer RNA-Asp"
FT   tRNA            435525..435600
FT                   /gene="tRNA-Phe"
FT                   /locus_tag="LCRIS_02068"
FT                   /product="transfer RNA-Phe"
FT   tRNA            435604..435685
FT                   /gene="tRNA-Tyr"
FT                   /locus_tag="LCRIS_02069"
FT                   /product="transfer RNA-Tyr"
FT   tRNA            435690..435760
FT                   /gene="tRNA-Trp"
FT                   /locus_tag="LCRIS_02070"
FT                   /product="transfer RNA-Trp"
FT   tRNA            435773..435848
FT                   /gene="tRNA-His"
FT                   /locus_tag="LCRIS_02071"
FT                   /product="transfer RNA-His"
FT   tRNA            435853..435924
FT                   /gene="tRNA-Gln"
FT                   /locus_tag="LCRIS_02072"
FT                   /product="transfer RNA-Gln"
FT   tRNA            435948..436018
FT                   /gene="tRNA-Cys"
FT                   /locus_tag="LCRIS_02073"
FT                   /product="transfer RNA-Cys"
FT   tRNA            436060..436144
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="LCRIS_02074"
FT                   /product="transfer RNA-Leu"
FT   CDS             436264..437442
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00444"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00444"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49891"
FT                   /db_xref="GOA:D5H1K6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1K6"
FT                   /protein_id="CBL49891.1"
FT                   /translation="MNIGLYTDTYFPQISGVATSIKTLKEALEKQGHNVFIFTTTDPNV
FT                   KKGTVEPNVFRFSSIPFVSFTDRRIAFRGLFEATKVAKEVNLDIVHTQTEFALGTIGKY
FT                   VAHQLDIPAIHTYHTMYEDYLHYILNGHLLRPYHVRQFVKSYLKNMDGCIAPSGRVEEL
FT                   LRRYGVQIPIRVIPTGVDLQGMNNDIQRDVRQELGIDQDAPVILTLSRIAAEKKINHIL
FT                   NVMPEIIDEFPNVKFVIAGDGPDVDVLKDQVERLTLENYVIFVGNVEHGDVGNYYRMAD
FT                   LFVSASDTETQGLTYIEALAAGTPCVVYDTDYTENIFDQDIFGLTFTTQQEMLEEIITL
FT                   LKQGTKRIPQELLQNKLQKISADQFAKNVSDFYQYAIDHYQPKHDEETKKRN"
FT   CDS             437443..438486
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00445"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00445"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49892"
FT                   /db_xref="GOA:D5H1K7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1K7"
FT                   /protein_id="CBL49892.1"
FT                   /translation="MIRINMFSQADSVKGQGVGSAYNELIKLLRTHLVDEFYVTINKYG
FT                   NSDLTHYHTINPTYYANSFSPARGRKIGYVHFLPDTLEGSIKLPGVAKKVFYQYVIDFY
FT                   KRMDQIVVVNPIFIDKLVNYGIDRNKVRYIPNFVSKTEFYEESLASKNAFRHELGIPLD
FT                   KFVVFGDGQVQERKGIDDFVKMAQANPDIQFIWAGGFSFGKITDGYDHYKEMVDNPPKN
FT                   MTFAGIVEREKLVKYLNIADLFVLPSYDELFPMSVLEAFSCGTPVLLRDLDLYKAIIDG
FT                   YYLSGKDFGEMNQVLQKVVANPQTLQKYSELSRKASQQYSEDHLAKIWDEFYHEQYELG
FT                   KELGQIH"
FT   CDS             438486..439511
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00446"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00446"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49893"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1K8"
FT                   /protein_id="CBL49893.1"
FT                   /translation="MNKKHLWGILVVLAISAFVLYADLKATPISEILRAAHGLNIFALI
FT                   MVFALMLLSYVCEAGILATLAHRKKEPKRSAWSFLRIPIIQALFNAITPMSTGGQPSQL
FT                   AAMIQMGMEGGRSTSILLMKFIIYQIVVLFAYVFTIIFGFHMVMTKFAGLAIFIAIGFL
FT                   IHVSSIIFLLAIMFAYRFTKKATNWLMDLLAKMMKKERVEKWRKAILEKIDTFYAESQK
FT                   LKKEKKKLFVASLLTVLQLLFFYSIPFMVLTALNVPCSWYQVTQMNIMIIMFMAIIPIP
FT                   GASGGAEYSFQTLFSTFISSHGALILAMFIWRFSTYFFGMLLGILGWIFKPKKIKSTKN
FT                   D"
FT   CDS             439586..441646
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00447"
FT                   /product="Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00447"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49894"
FT                   /db_xref="GOA:D5H1K9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1K9"
FT                   /protein_id="CBL49894.1"
FT                   /translation="MEHTKSFFRWLTQTKLGFFTIVLVLFWLKTYFIYLTKFNLGAVGP
FT                   MQQFLLLINPIPSGMLLLGFGLFFKGRKSYWIILVIDFLLTLWLFANILYYREFSNFLS
FT                   FSIIKTSGSTSDNLGKSIAGITLASDFLAFADIAVIIVLLATKVIKMDVRPLKLKVNLL
FT                   IEALAVSLMGLNLLMAQNDRSGLLTRTFDNNYIVKYLGINEYAIYDGYKTAQTSAQMAK
FT                   ANVSDLKSVRNYLKENYVKPNPAYTGVAKGKNVLIIHLESFQQFLIGYKWKGKEVTPNL
FT                   NKIYHQKDTISFDNFFNQVGQGKTSDAEMMLENSLYGLQSGSAMSTYGTSNTFESAPAI
FT                   LHQQAGYTTAVMHGGAGSFWNRNNAYKSFGYQYFMPLSFYQNKPSYYIGYGLKDKIFFD
FT                   QSIKYIERLPQPFYLKMITVTNHYPYNIDKKNQTIDKTNTGDETVDGYVQTAHYLDQAI
FT                   GEFMRWMKKTGLDKKTLVVFYGDHYGISGNHHKASAELLKKDSFNDFDNLQFQRVPLMF
FT                   HMKGLKGGINHTYGGEIDVLPTLLNLLGIKDKDTIQFGYDLLSKNAPQIVAQRNGDFIT
FT                   PEYSKVGSDYYDTKTGERIKPNKKLKEKLTAISNTVTTQLSLSDRVINGNLLRFYKPKW
FT                   FTRVKPKDYDYNKAPSLKRLFDDPSKTSLWYQNHRKTTQKDFKTDAPELKK"
FT   CDS             441714..441947
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="LCRIS_00448"
FT                   /product="Preprotein translocase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00448"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49895"
FT                   /db_xref="GOA:D5H1L0"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1L0"
FT                   /protein_id="CBL49895.1"
FT                   /translation="MYNLVMTLLIIVSILIVIATMMQPQKQQDALNALSGGAVFSGQTK
FT                   KRGFEAFMEKVTSVLLVLFFVFAIILAYMSSK"
FT   CDS             442020..444359
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /locus_tag="LCRIS_00449"
FT                   /product="Ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00449"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49896"
FT                   /db_xref="GOA:D5H1L1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1L1"
FT                   /protein_id="CBL49896.1"
FT                   /translation="MAQNEKILAGVLEIFRHNPQKQFRVDQIEREARRDRLGNFTELIK
FT                   ALSFLEHDKKIITDGKGQYQLAQENTEVEGEFRANDKGFGFVRLDDENADDVFVAADYT
FT                   KYAVNGDRVKVKITAGGNPWNGKGPEGQVEEILEHGLETLVGEFHPLTDEQRKISHFIG
FT                   YALSNDKKLHKYRVYLSENGLIPQMGDMVKVSIKDYPDEENPESMTGAVVNIIGNKNDP
FT                   GVDIMSIVAAHDVRTEWPEDAMAQANAIPDHVTEEEKKGRVDITDQPAVTIDGDDSKDF
FT                   DDAVVLWKKPNGNYHLGVHIADVSHYVTENTPLNEEAFARGNSTYLVDRVIPMLPFRLS
FT                   NGICSLNEGVDRLVLSCDMEITPEGKRVGYKIYPSVMRSHGRMTYNKVNKTLKGEMNGL
FT                   EDKYVKLRPMLEEMADLHAALYKQRHQRGAIDFEEPEAKIIVDDQGKPTDIVLHERGTA
FT                   EKMIESFMLMANETVAEDFFKKHVPFLYRVHETPDAERIKTFFEFCSAFGLNIHADPNN
FT                   VKPIDLQKVVSKTTDTPEEAVVQMMMLRSLKQAHYSEEALGHFGLAAEYYTHFTSPIRR
FT                   YSDLMVHRMIHAYQDQGTNEEVQKHFASYLPDVAEQTSTQERRSIDTEREVNDLKMTEY
FT                   MADQVGQHFDAVVSSVTSFGMFIQLPNTIEGLIHISNLTDDFYSFNEKSLTLTGRGTHK
FT                   QYKVGMPIKVTLINANVEQHQLDFEIYDPNAPKHEHNDRGMNNRRRGNRGFRNNHGRRG
FT                   GQFNNHSDHGRGRGNGNRGGRRNFKH"
FT   CDS             444372..444830
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="LCRIS_00450"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49897"
FT                   /db_xref="GOA:D5H1L2"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1L2"
FT                   /protein_id="CBL49897.1"
FT                   /translation="MKKEKEDNLIAQNKKARHDYFIKETLEAGIALTGTEIKSVRARRI
FT                   NLRDGYVQIVNGQAWLENVHISEYKQGNRYNHEPLRSRRLLLHKKEIARLAKAQSERGI
FT                   AIIPLKVYLKHGFAKVLIGVGQGKKEYDKRQTIKERDQKRDIRRKYGV"
FT   rRNA            445456..447007
FT                   /gene="16s rRNA"
FT                   /locus_tag="LCRIS_02035"
FT                   /product="16S ribosomal RNA"
FT   CDS             complement(445668..445784)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00451"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49898"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1L3"
FT                   /protein_id="CBL49898.1"
FT                   /translation="MADQSLNSAMHHRLGKPLPYQLANAPRGHPIATAYAAF"
FT   CDS             complement(445718..446152)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00452"
FT                   /product="PG1 protein, homology to Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00452"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49899"
FT                   /db_xref="UniProtKB/TrEMBL:D5H0H3"
FT                   /protein_id="CBL49899.1"
FT                   /translation="MEFHSPLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQR
FT                   LPPTYYRGCWHVVSRDFLVDYRQIKASYYLYPSSPTTELYDPKTFFTHAALLHQTCVHC
FT                   GRFPTAASRRSLGRVSVPMWPISLSTRLCIIALVSLYLTN"
FT   CDS             complement(446333..446440)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00453"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00453"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49900"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1L5"
FT                   /protein_id="CBL49900.1"
FT                   /translation="MLRIKPHAPPLVRAPVNSFEFQPCGRTPQAECLMR"
FT   CDS             446586..446939
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00454"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49901"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZ89"
FT                   /protein_id="CBL49901.1"
FT                   /translation="MLLVASIKLGTLMRLPVTNRRKVGMTSSHHAPYDLGYTRATMGST
FT                   TRSEPAKASESLKAVLSSDCSLQLDCTKLESLVIADQHAAVNTFPGLVHTARHTMGVCN
FT                   AQSRWPNLREGAV"
FT   rRNA            447220..450125
FT                   /gene="23s rRNA"
FT                   /locus_tag="LCRIS_02031"
FT                   /product="23S ribosomal RNA"
FT   CDS             complement(447774..448244)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00455"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00455"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49902"
FT                   /db_xref="UniProtKB/TrEMBL:D5GZ88"
FT                   /protein_id="CBL49902.1"
FT                   /translation="MIWAVSLSTTDLITRSLTPVYGYLEFVVYLDSVTPDGPLVQTELY
FT                   LHYPLHEASPKAISERTSYLQVRLEFHRYPQLIPAIFNLRGFGPPVRFTTPSAWSWVGH
FT                   LVSGLRHLTFRPIKTRFRSGSVFSDLTSLDNVTRRFILQKARHCTLMCFDYL"
FT   CDS             449571..449858
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00456"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49903"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1K5"
FT                   /protein_id="CBL49903.1"
FT                   /translation="MTARETTRAGRKLGLSDLVVPYGRAITQRIKATLGITGLSPPRVH
FT                   IDGEVWHLDVGSSHPGAEVGPKGWAVRPLKRHASWVQNVVRQFGPYPSWA"
FT   rRNA            450198..450313
FT                   /gene="5s rRNA"
FT                   /locus_tag="LCRIS_02027"
FT                   /product="5S ribosomal RNA"
FT   tRNA            450326..450398
FT                   /gene="tRNA-Asn"
FT                   /locus_tag="LCRIS_02075"
FT                   /product="transfer RNA-Asn"
FT   CDS             450694..451701
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="LCRIS_00457"
FT                   /product="PTS system, mannose-specific IIAB component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00457"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49904"
FT                   /db_xref="GOA:D5H1L9"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1L9"
FT                   /protein_id="CBL49904.1"
FT                   /translation="MVGIVLASHGGFADGIAQSAQMLFGEQDNFAHVILKPDEGPDDIR
FT                   GKMEKAIASFDNQDEVLFLVDLWGGTPFNQANGLAEKHDKWAIVAGMNLPMVVQALTER
FT                   MMDANATAKHIATAVVQPGRDGIKTKPADLMPKTAAAGPAADKAAAKGSKKSIPEGTVI
FT                   GDGHIKYVLARIDSRLLHGQVATGWIPAMKPDRVIVVSDSVAKDDLRKSMIREAAPAGV
FT                   KAHTVPLKKMEEIAKDPRFGNTHALLLFENPEDVLRAIKGGIDLKNINVGSMSYKEGDV
FT                   NANNVLSMNQKDVDTFRELEKMGVKFDVRKVPSDAPGNMDAILKKAQTLLDEKK"
FT   CDS             451723..452532
FT                   /transl_table=11
FT                   /gene="manY1"
FT                   /locus_tag="LCRIS_00458"
FT                   /product="PTS system, mannose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00458"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49905"
FT                   /db_xref="GOA:D5H1M0"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M0"
FT                   /protein_id="CBL49905.1"
FT                   /translation="MNAIQMILVVFVAFLAGMEGILDEWQFHQPLVACTLIGLVTGHLD
FT                   LGVALGGSLQMIALGWANIGAAVAPDAALASVASAIILIEGGQGIKGIGTATGIAIPLA
FT                   VAGLFLTMIVRTISTAIVHIMDAEAKKGNWRMINLWQWIAVCLQGLRIAIPAALLLAIP
FT                   SGTVRSWLAMMPQWLNEGMTIGGAMVVAVGYAMVINMMASKEVWPFFAIGFALAAIKDL
FT                   TLIALGAIGLSMALMYLALEAKGGNGGNNNSGDAGTGDPLGDIIDDY"
FT   CDS             452561..453481
FT                   /transl_table=11
FT                   /gene="manZ1"
FT                   /locus_tag="LCRIS_00459"
FT                   /product="PTS system, mannose-specific IID component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00459"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49906"
FT                   /db_xref="GOA:D5H1M1"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="InterPro:IPR018405"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M1"
FT                   /protein_id="CBL49906.1"
FT                   /translation="MADKKTKLTKRDRFNVMWHSQFLQGSWNYERMQNGGYAYSMIPAL
FT                   RKLYPNKKDLSAALQRHLVFFNTHPYLASPVLGVTLALEEDKANGAEVTDDAIQGVKVG
FT                   MMGPLAGVGDPVFWYTVRPIVGALGASMAIAGNVMGPILFFVIWNIIRIAFLWYTQEFG
FT                   YKAGSAITSDMSGGMLQKVTRGASMMGMFVLGALIERWVNIKFTPIVSQTPIQKGGYIE
FT                   WDKLPSGAKGIQSALQQWDMGNGKALSSTKVTTLQDNLNQLIPGLAGLLLTFFCMWLLK
FT                   KKVSPIWIIIGIFVVGVLFHVWGIL"
FT   CDS             453485..453853
FT                   /transl_table=11
FT                   /gene="manO"
FT                   /locus_tag="LCRIS_00460"
FT                   /product="ManO"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49907"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M2"
FT                   /protein_id="CBL49907.1"
FT                   /translation="MAKSINTKVDLTVDATWFRGIASYGKIMIGDRAFEFYNERNVEDY
FT                   VQIPWNEVTYVVADVRFGGRYIPRFEIRTKSNGKFIFAARDPKKVLRAIRKYVPADHMR
FT                   RALSLWQRLKQRFSRKKK"
FT   CDS             complement(453896..454777)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00461"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00461"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49908"
FT                   /db_xref="GOA:D5H1M3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M3"
FT                   /protein_id="CBL49908.1"
FT                   /translation="MELRVLNYFVATAQELNMTRAAQKLLVSQPALSRQIADLEDELGV
FT                   KLFNRQPRHLTLTPAGQYLYEQAKEILTLASKTKSNLQSSAVISGDLTIAAGESFAMQR
FT                   LMNIVSNIIRDYPTVKIHILSGDYEFAERRLNTGAVDFAVIIGNLPLDNYASLQLPEKD
FT                   TWGVLMTKDDPLAKKSAITAEDLVGRNVLNSQQAENRKYFDSWFGNYKEQINIIGTVNL
FT                   NFNGTLLVKNKAAIMLTLDKLANISDESNLTFRPITPMLKQPVTVIWKRETNLSPVADL
FT                   FLNRLRVSIDDD"
FT   CDS             454886..455416
FT                   /transl_table=11
FT                   /gene="maa1"
FT                   /locus_tag="LCRIS_00462"
FT                   /product="Maltose o-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00462"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49909"
FT                   /db_xref="GOA:D5H1M4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M4"
FT                   /protein_id="CBL49909.1"
FT                   /translation="METEDHDLRRKLVQQNQRLLQNLNTQRHCSCEVRQLVSEIIGQKI
FT                   AASTEIRLPFYSDYGNNIKLGERVFINANVMMVDLGGITIENDVLIGPGAYLISVNHKL
FT                   DPQHRKELELKPVVIKQNAWIGAKATILPGVTVGKNAVVAANAVVTKDVPANTVVAGNP
FT                   AKIIKKLQNKRSS"
FT   CDS             complement(455435..456808)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00463"
FT                   /product="D-serine/D-alanine/glycine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00463"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49910"
FT                   /db_xref="GOA:D5H1M5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M5"
FT                   /protein_id="CBL49910.1"
FT                   /translation="MSEKKTQTASGYKRTLSNAHIQLIALGGTIGTGLFLGVGDSIHRA
FT                   GPSVILIYIIVGIFLFLLMRALGELIMSDLNKHTYIDFIEQYLGKNIGFITGYLYWLSW
FT                   ITLGMAETTALGIYFKYWFPTLKPWIPGIITIVILLLINLISARVFGNLEFSFAIIKIV
FT                   TIIAFVILILYLLVTGGKTSFGPVSFANLDDHGGFFARGSKGFLQGFQMVIFSFIGVEL
FT                   IGLTAAEAQKPETTLKRAINQLPIRIILFYVMAILGILLVIPWSKVATNASPFVEALGA
FT                   TGIKNASSIINFVVISAAVSSTNSFLYSAGRLLFSVTFDGKGKWNKTFGHLSRRQLPQN
FT                   ALILSALLMGCAPLITLVIGDQAFNFISSTSTSMFLIIWSLMILTHMAYRRKTPANRLN
FT                   DFQMPGYPYIDYVILSFFVLMIILLLILPSYRVPMVAAIAIFIVLYIISKIWSNEKAV"
FT   CDS             457121..459745
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="LCRIS_00464"
FT                   /product="Aldehyde-alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00464"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49911"
FT                   /db_xref="GOA:D5H1M6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M6"
FT                   /protein_id="CBL49911.1"
FT                   /translation="MAKTQQKETLTEDEKKKQIYDMVDNLVKKSHVALDQMANFTQEQV
FT                   DKICEAVATAGEQNAYPLAKMAVEETKRGVVEDKTTKNMYASENIWNSLRHEKTVGVIE
FT                   EDKELGLTKIAEPKGVIAGVTPVTNPTSTVIFKAMLALKTRNTIIFGFHPQAQKCCVET
FT                   GKIIRAAAVAAGAPADAVQWIEEPSLDATTDLMTNPGVQTILATGGPGMVKAAYSSGKP
FT                   AIGVGPGNGPSYIEKTANIDRAVYDIVLSKNFDNGMVCASENSVVVDTEIYDKVKEEFK
FT                   KWNCYFLNKGEIKKFEEHFIDPRRGTVAGPVAGKSAYEIAKLCGVDVPKTTKVIIAEYK
FT                   GVGRNFPLSAEKLSPVFTLYRAKNHDDAFKICTDLLNYGGRGHTAGLHSNDKKIIDEFA
FT                   MKMDACRILVNSPAALGGIGDLYNNMLPSLTLGTGSYGANTFSHNIGAKDLLNIKTVAR
FT                   RRDNMQWVKVPSKTYFEHNAANYLRHMPNVNRFFIVTDEGVADQGFADEITDIISKRLG
FT                   QKEYEVFKAVTLDPNTDVIKDGVHRMNIFKPDVVIAIGGGSVMDAAKAMRLFYENPEMS
FT                   FEEAYQKFLDIRKRVVRFPKINGVQLVCIPTTSGTGSEVSPIAIISDAKTGIKHTLCDY
FT                   ALTPDVSIVDDQFVQTLPKRLIAWSGFEALGHAIESYVSTMATDFTRGWSLEAIKTIFA
FT                   NLKKSYDGDLDARKRMHDAATLAGMAYSNAFLGLEHSIAHTVGSTFDIPSGVSDAIALP
FT                   QVICFNAKRPEKLAMWPHYSVYRADKDYAEIARAIGLTGSSDAELIEKLVQKIIDLAES
FT                   VGIKMAFKDYGVDKAEFDKKVDQLAVEAYGDQNTVTNPSAPLISQIAQLMRDCYEGKGI
FT                   KNK"
FT   CDS             459942..461753
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="LCRIS_00465"
FT                   /product="Glucosamine--fructose-6-phosphate
FT                   aminotransferase (Isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00465"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49912"
FT                   /db_xref="GOA:D5H1M7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M7"
FT                   /protein_id="CBL49912.1"
FT                   /translation="MCGIVGVVGKPAKDIILNGLTNLEYRGYDSAGIYLNDLNGNEYLT
FT                   KAVGRISNLKEKLTPDEQGLVGIGHTRWATHGKPTVDNAHPHFDETKRFYLVHNGVIEN
FT                   YTELKEKYLQGVKFHSDTDTEVVVQLIGKIARDKNLDAFSAFKEALKLVKGSYAFLLVD
FT                   NTEPDHVFIAKNKSPMMLGIGDGFNIIASDAISVLDQTKTFVDLQDGDVGDITKDSYTI
FT                   ETVDGKKVDREPHVLNIDPNAASKGTYEFYMLKEIDEQPGVMRHMSQNYLDENGEPKVD
FT                   QDIVDAISKADRLYIFAAGTSYHAGLVGKTIFEHYTGIPTEVGYASEAGYHFPMMSKHP
FT                   FFIFLTQSGETADSRVVLKEANKRGIPSLTMTNVEGSTLSREANYTMLLGAGPEIAVAS
FT                   TKAYTAQVALQAILAKALGEKLGNQDAKDWDLQHDLAIAAEGIQQIVDGKEKLKELADQ
FT                   YLVKSRNAFYIGRGIDHAVALEGALKLKEVSYIQTEGFAAAELKHGTISLIEDGTPVIA
FT                   LINDPVTADLTRGNIQEVASRGASVITIVGKEFANSDDTIVLPKINYYMSALLTVVPTQ
FT                   LLAYYASKDKGLDVDKPRNLAKSVTVE"
FT   CDS             461853..463907
FT                   /transl_table=11
FT                   /gene="mtlR"
FT                   /locus_tag="LCRIS_00466"
FT                   /product="Transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00466"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49913"
FT                   /db_xref="GOA:D5H1M8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M8"
FT                   /protein_id="CBL49913.1"
FT                   /translation="MFLTQRQKHILQILLGNPSGVSIKQIEESLKISRRTVYREFGDLK
FT                   KNDFKIENQKGKYFLSGDSKQLQEIKQSVQQSHSQNVISVAKREKIIAAKLLLSTEPCK
FT                   IIQFALDLNVSEATIQSDLNTVERSLKRYHIDLIRKKGVGLLIQAPEKIRRQVLVDIML
FT                   NQINEYNFFKYLHNETTSKDMFLTMIDKALLVEVADCLKKSVFGKIKLDSDQKLIELIL
FT                   TFAVTIKRTLAGCKLDFIHPSADSLKYQGYVYRFMALFAQKRQVEVDQNDVSYLANKLL
FT                   SCDYHNTYLTYNEHELAISVKVKELVQHVSEEMHWDFQKDPSFMTKVTKHVIGLVQHKV
FT                   ALLPDTPIEILAGLSQKFPDLYLAIQKYWHLAFPENYLTASELQLILLYFANEYTSRNQ
FT                   QRNLSALVICENGIGTSAILGAKLKREFSEIKEVKTSRVSALNQIDLSNYNLIFSTLRL
FT                   KGFSRDYLLVSPLLLDDELIKIRAYLKDYEQKYPQPVPAKQVVEEKHPHSVEQLAKLSI
FT                   STLFCSELVNGIKIQQLEYNSQDLIAVIQECLAHSDSTLIRKQMPVAKNLLKRVRMAPV
FT                   GIPNSHIALLHTRSPEITRCSFTMFDLDNEISLQSMDHDTIQVKRVLLMLAPDNLTAPE
FT                   QRVMSTISSMIIMSSQNLDLFTNGSQKEIKEAIAALFLQDLKDRLLGNQ"
FT   CDS             464042..465823
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="LCRIS_00467"
FT                   /product="PTS system, mannitol-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00467"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49914"
FT                   /db_xref="GOA:D5H1M9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1M9"
FT                   /protein_id="CBL49914.1"
FT                   /translation="MAQAKSKSSVKVKVQKFGTALSGMIMPNIGAIIAWGLTAAFFMYP
FT                   HGWFPNKEINNLVQPMLHYLLPLLIGYTGGRMVYEERGAVAGAIGTLGVIVGTDQPMFL
FT                   GAMIMGPLSAWLLKKLDQVFQDKIKSGFEMIYNNFSLGILGMIAAIFAFFIIGPIMEVG
FT                   SQWASAGVNAIIRVHLLPLANIIIEPAKVLFLNNAIGNGILVPLGIQQAAQVGKSVLFL
FT                   MESNPGPGLGILLAFTLFGKGKSKSSAPGAAIIEFFGGVHEIYFPYVLMKPSLILAAIG
FT                   GGVTGTFLFTTLGGGLKAAASPGSILAILLVSAKDAYFGNIVGVLGAAIVSFIIAAVIL
FT                   KNDKSTGDELEAKQAQMQAMKAQSKGQSMPEAEDAHESVKSYENVKKVIFACDAGMGSS
FT                   AMGASLLRDKFKKAGIKVSVTNTAVRNLKDEDGLLVITQEELADRALQKTPHAMHVAVG
FT                   NFLSSPKYDTIVASFKALTQVEDKPKVEKPVKKVGSLEGIDFSKVKEVDFIRHDQHLGT
FT                   ATMATSLFNDAIKKAGKTTPVKAVRINELTDDPSHLVIVTPAANKNLAVRYSDIQTLVV
FT                   DDLLKDKKLGEAIQKLN"
FT   CDS             465839..466291
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="LCRIS_00468"
FT                   /product="PTS system, mannitol-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00468"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49915"
FT                   /db_xref="GOA:D5H1N0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N0"
FT                   /protein_id="CBL49915.1"
FT                   /translation="MALQLDPKMIKLNQDVPTRDQAIRMAGQLLVDGGCVEPEYIDSML
FT                   ARNEDVSTYMGNFIAIPHGTDEGKKHIKKTGISVVQIPMGVDFSDPKDDTEQLVTVVFG
FT                   IAGLNNEHLNILSQIAIFCSDVSNVAKLADAQTPEEIIDLLRNVGD"
FT   CDS             466294..467463
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="LCRIS_00469"
FT                   /product="Mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00469"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49916"
FT                   /db_xref="GOA:D5H1N1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N1"
FT                   /protein_id="CBL49916.1"
FT                   /translation="MRAVHFGAGNIGRGFIGETLADNGFGIDFVDVNETIIDELNKRGE
FT                   YDIELAAPGKKRIHVSNVDGINNAKDPDKVVEAIKSTDMITTAIGPKILAIIAPLIAKG
FT                   LTARIQSGNTTPLDVIACENMIGGSEHLKEEVYKHLDDDVKPEIDKYIGFPNAAVDRIV
FT                   PIQHNDDPLFVSVEDFKEWVIDESQMKNKDIKLKGVDYAPDLEPYIERKLFSVNTGHAT
FT                   VAYTGKSLGYDTIGDAIKDPFVLKQVKRVLSETRSLLYHKWNKEFTEESLEEYHNKILS
FT                   RFQNPYISDDIARVGRTPIRKLGYNERFIRPIRELKDRDLDYSALMETVGRIYHFDEPN
FT                   DKESVKLMQMLKDEDLKDVIVETTGLKDDPELVEEIVKSYHDAEEDAKN"
FT   CDS             467624..468355
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00470"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49917"
FT                   /db_xref="GOA:D5H1N2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N2"
FT                   /protein_id="CBL49917.1"
FT                   /translation="MSIKEDAQRAHANLLKVTDPEALERINHFAFDEVQADVDLPDRTK
FT                   MLSTLAYLLGMQGKEEYEVMLPVALDNGVSPVEAKEILYQAVDYLGLGRVFPFFKITND
FT                   VLTKRGVELPLAGQATTTLDNRLEKGEETQVRLFGPQMKDFSKKGTINKWLVDNCFGDY
FT                   YTRNGLNDQDREMITFCYIAAQGGCEPQLMAHAQANIRLGNDKEFLMKVIEQNVPFIGY
FT                   PRSLNAVSVVNKADEAVNGKN"
FT   CDS             468819..469232
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00471"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00471"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49918"
FT                   /db_xref="GOA:D5H1N3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N3"
FT                   /protein_id="CBL49918.1"
FT                   /translation="MKMEHSAGAVIYRRRVTGELEYLIVQSVVNHNWGFPKGHLENDEN
FT                   AEEAARREVFEEVGLKPEFDFNFKEKVKYQLTENKEKTVVYFIAKYLAGQEVKTQKEEI
FT                   LASKWVSLVEAQKYLTEHGKMDVLTKAQNYIEQ"
FT   CDS             complement(469378..470232)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00472"
FT                   /product="ranscriptional activator Rgg/GadR/MutR-family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00472"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49919"
FT                   /db_xref="GOA:D5H1N4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N4"
FT                   /protein_id="CBL49919.1"
FT                   /translation="MYGQKFKALRLQQHISLEQAANRVISPSTLSRWENNKIDIRFNLV
FT                   IKLLDNIHINLKEFTNYCKINHSNPFVAKVAMYYEANDDRHILQLIQSKKKEYQNSHNQ
FT                   FDLLLLAIACNCYYDLTDNNVFPVSYQKKLFYILSNIEYWTEMYINVFGNTVFLYDSKE
FT                   LYSISIRILKNLNSNTFNDFQEYYYALSSVINALTALIIKNPKLASQLLTKIEKVSIPK
FT                   PISYLKIRTNVLKYLLDYRLGKTYEKLISIKLENLKWLGLTDIAKDLTFFFNRIKNDRS
FT                   PLS"
FT   CDS             470385..470951
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00473"
FT                   /product="Protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00473"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49920"
FT                   /db_xref="GOA:D5H1N5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N5"
FT                   /protein_id="CBL49920.1"
FT                   /translation="MNREGYSFIPKYINAFWVNNSLFLEESYIPGKTLDEIIRNDLKER
FT                   KQVMSNFKNILLIIHKLHKFDDYIIHDISPANIIFYNKRFYLIDFESFSKSEVKVSTLY
FT                   GTRGFFDNDYDMNDQTIDYFALARVYYFLRNAKEYRQLSEKRQSFQLTDSEIQKNLWFK
FT                   KCMNHSYKNDEDWLVDYEKYVGIKQ"
FT   CDS             470948..472567
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00474"
FT                   /product="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00474"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49921"
FT                   /db_xref="GOA:D5H1N6"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N6"
FT                   /protein_id="CBL49921.1"
FT                   /translation="MNTQQINFKWVVKHVPIYLQIVFLVLSAISAFEGVLNAVLFGQLT
FT                   NINFSNIDHVYKFIGLAFGAYLIVYIAMLLFYLVQNRIVMLLNIALKQEYFYSKFANSD
FT                   MKQARGADVINSISGTAKEIEQKYFFGITDIVQFVFNVVASAIVVVETNLILGIIYLLL
FT                   SALTLIPSYIGKKRMNEKTEKWNKSNSQLIQAMKDIFEGRLEILNFGVRHLFFKRFDRI
FT                   LVNEEDKYRKMNNCQFQVQFIAWLISLVTLLLPIFIGLLFMQRGWFNVTVAAIITLSLS
FT                   ADRVVGYLRTIALYQTQIHSTDAIRKIKSYNFEESESVKQDNHDSQAILKIKDLSFSYG
FT                   DKKILDGINLTLRDHDKIIVTGASGIGKSTLINCIANNLKYNGEITFAGHQINPADFIK
FT                   ISQRIWLFQGTVRENLSLLQNIPDDLMLHEAKKMGLIHEFGNDFLDKLISDDANNLSGG
FT                   QAQRLALVRGLIRSKKIYLLDEICSSLDPKNSDAIHKIIYQLPAIVIEIAHNYNPQLAQ
FT                   ENKVQVYKLIDAKLQKQNYIEQ"
FT   CDS             complement(472656..474314)
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="LCRIS_00475"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00475"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49922"
FT                   /db_xref="GOA:D5H1N7"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N7"
FT                   /protein_id="CBL49922.1"
FT                   /translation="MSTKERYSQDELRKDNPMFSRTRATIESAFYGNNVHEVTSVAEAY
FT                   NLAKKQSGVIVTDLPILHTKELGLPHGATQLVYNHGKILGRTASARHFVDNPNEDAEAL
FT                   DGNLREDIYKGHEQKYLKATVLVGLDPSFTVKAHIMMPEDQAFNLLSYILNFHFFDDEA
FT                   EKLYEKSKFYDEPDIYFYFDPNVQDEDYPKGLGVFDAPHNCAAVFNLRYFGELKKGTLT
FT                   LAWAIAHRHGYTACHGGEKSFHFDDKDDKTFAFYGLSGSGKSTLTHEMYDGKYDITVLH
FT                   DDAFIISREDGSSVALEPSYFDKTHDYPAGHHETKYYTTIMNCDVTLDKDGKKVIVTED
FT                   LRNNNGRVIKTRYTSPHRVDFEKSPITALFWIMKDGSLPPIIKIDDPVLATTMGCTLAT
FT                   KRTSAENLPKGFDMNTLVIEPFADPFRAYPVSGDYRDFKELFTKRGAACYSLNTDAFMG
FT                   KDIPKEVTKKLIEDLANGNIKDSDFKPFGNFKGVSYLPIEGYEVHLEDPEYQKTLAKRM
FT                   QDRLNWLNKYDEEHPETPIQDEAKKTLEAIIKELS"
FT   CDS             474527..476347
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00476"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00476"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49923"
FT                   /db_xref="InterPro:IPR025266"
FT                   /db_xref="InterPro:IPR028932"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N8"
FT                   /protein_id="CBL49923.1"
FT                   /translation="MDSNQLFKYVYAKYGLKFKPAVPGSTSVYVLMSPVDSGYFAMLSR
FT                   GQGQSILDLKCGAMAALIRDLPGFTDPMKIKSADWVGAILEKVSEDSLKKALDFAFKLA
FT                   MNGDEVNIAQNQYFYIAPDKVDDRYQAQAIKPSENLRKKHNNSLVPDRIRKMLEIYDYS
FT                   ILPSRGRAKNFYQQARMMADYDDDYPEFFAFKRFYPTYHDMNTGQLRSYFTWRSKIRQH
FT                   VFEKTSTSYAFVYIYELLNNIGVDDAQDGYEKLLEFEGKYVQQFDISIDVYLQDWLKDY
FT                   VLYYDLDEKIIKQRFASEIKRDHDYEVLHHPEKFTAQELAAVFAKKTTYWNSSKVINKN
FT                   EKLFVQLLRYVWLELLDAKKYGIAYYSAFVGKPDIIEKPIFAGSVFYLRKQQVADHQID
FT                   AVRKYHFYQGKWQIHCDQQISRQRVNLNNFLHELDRVARTEFKLGRSIKPRFIDQAVLK
FT                   AINAGVAEYHIQEKKAQIDQIKIDFSDLDQIRANASKTRDSLLTDEEKQLEQAEAQEEV
FT                   EKQADETVKVDNEYGLDENEMFFLTALLMQQPWQTYLKQHHLMASILMDNINEKLFDEF
FT                   GDVVLENNEQDQPQVITDYVDDLKDMFLKG"
FT   CDS             476352..477680
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00477"
FT                   /product="Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00477"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49924"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1N9"
FT                   /protein_id="CBL49924.1"
FT                   /translation="MPQKRRVPKRIAQTVLNSLKGGVVPRIGLPYITVGRKAEIEALLH
FT                   DVDVIQEGGASFRFIVGRYGSGKSFLLQTIRNYVMDKNFVVVDGDLSPERRLQGSKGQG
FT                   LATYRELIQNLSTKTRPEGGALTLILDRWINSVQMQVSQETGLNNDDPKFEQAVDQKIY
FT                   GVISSLNELVHGFDFAKLLNMYYHAYMSGDDETKAKVVKWFRGEYSHKTEAKKELGVDI
FT                   IISDSDWYEYLKLFATFFRQAGYAGLMIMIDELVNIYKIPNAISRQYNYEKILTMYNDT
FT                   LQGKAKYLGIIMCGTPQAIEDRRRGVYSYEALRSRLATGKFAQAGARDMYAPVIKLEPL
FT                   TAEEMVVLTEKLADMHAGLYGYERTITDDDLAQFIKIEYARVGADTNITPREIIRDFIE
FT                   LLDIVWQNPQTDIQTLLNSDQFSYAKSEAVSDNQEKDYTEFQI"
FT   CDS             477690..479927
FT                   /transl_table=11
FT                   /gene="lhr"
FT                   /locus_tag="LCRIS_00478"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00478"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49925"
FT                   /db_xref="GOA:D5H1P0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P0"
FT                   /protein_id="CBL49925.1"
FT                   /translation="MDVFSHYAPFIQDYIYEHGWRTLRPIQVAAAEEIFETEDNVLLSA
FT                   STASGKTEAAFFPILSDIYQEPEDSVKVLYIAPLKALINDQYDRLIELCQDVDIPVWCW
FT                   HGDVAQTQKRKLLKHPSGILQITPESLESFMINKHMDIPHLFGGLKYIVVDELHSFLRS
FT                   DRGGQTFCLIERLSKLAGVNPRRIGLSATIGNLKEASAFLGAGSNRKTVAPKVQNQPQI
FT                   WHLSMEHFYQTDPQASSKDFDPSQIEPKTDQAPELADPGIGYIFEHTRGRKCLVFTNSR
FT                   EECEAVCQELRAYCAYNHEPDRFMIHHGNLSPALRETAEAAMKDEDVYMTTCATATLEL
FT                   GIDIGQLEAAFQIDAPFTVSGFLQRMGRTGRRGNPPEMHFVMREEHPESRAMLPELIPW
FT                   PLLQGIALVQLYAEEKWVEPPAPNRLPYSLLYHQTMSTLASGGEMTPAELASRVLTLSY
FT                   FHNVSQEDYRILLKHLLKTGHIEWTENHGLIVGLAGEKVVNNFKFYAVFQENEEFSVHA
FT                   GSEELGTIVKPPPVGDKIAIAGRVWVVEDVDHKRHQVYCHEVKGRIPAFFGDVPGDIQP
FT                   KILQRMKKVLTEKGMYPYLMQNAQARLTQARDTAALAELPKKNLIKLGGNMWCLFPWTG
FT                   TYAFLALERLIRIKCGEKLNIRGFNSSRPYFMYFAMDADEDDFWRIINEEAQKDFDPLD
FT                   LVYPKEVPGIDKYDQYLPDELLRKEFAQSVLDIQEMRRCVKAMAEDYQENK"
FT   CDS             479973..480344
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00479"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00479"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49926"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P1"
FT                   /protein_id="CBL49926.1"
FT                   /translation="MALKINQSVSKDAQARDLLKELIKVHQVHQAYNVRDLTDADEQIL
FT                   EKAFNKTRQLMPRITAKKIKFDDKQWDSLFNLLMAEQIAFARVLSEGDENLTTYAQAKN
FT                   QAEQAAALVNAQMVKLDKK"
FT   CDS             480469..481227
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00480"
FT                   /product="Nitro/flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49927"
FT                   /db_xref="GOA:D5H1P2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P2"
FT                   /protein_id="CBL49927.1"
FT                   /translation="MLHNSTVDAQINHRSIRKFKDEVLNKEQLETLYTVFQHTATSMFM
FT                   QNASLLHVTDPEQKKKIQELCNQKYVGAEGDLFIFIVDLYRNQQIRQQLGKDDGRVHTT
FT                   DIFFQAMEDTLLAFQNVVNAVESMGLGYVPLGTVNDHPLEMLKTLNLPKLTFPVLGMQV
FT                   GVPDQEPQLKPRLPLEYTCFEGSYKKDFDVKDLKDYDDVVTTYYDLRDANRRIDSFTKQ
FT                   ITGKKLDNHETDRDQLPEELHKQGLCLDWK"
FT   tRNA            481302..481377
FT                   /gene="tRNA-Thr"
FT                   /locus_tag="LCRIS_02076"
FT                   /product="transfer RNA-Thr"
FT   CDS             complement(481596..482003)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00481"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00481"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49928"
FT                   /db_xref="GOA:D5H1P3"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P3"
FT                   /protein_id="CBL49928.1"
FT                   /translation="MKNFNKFTAKFARLLQNLLVVAIGLLGIILIILLFRDLIPLCQSL
FT                   FSTKIEESNSEIMSEIIVFFLFFEFTAMIISALRHHGHTSINFLLGLGVTALIRSLITS
FT                   HSNIWSTLATSASILVLVIAMIIFNKNLRNM"
FT   CDS             482144..482746
FT                   /transl_table=11
FT                   /gene="maa2"
FT                   /locus_tag="LCRIS_00482"
FT                   /product="Maltose O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00482"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49929"
FT                   /db_xref="GOA:D5H1P4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P4"
FT                   /protein_id="CBL49929.1"
FT                   /translation="MSLRTKFNYMATGRPYNDADPRLDTLRDLATLKTNNINNENDHAK
FT                   KEILIKELFGSTGEHPFVNPNFRCEFGQNIHVGDNFYANYDCTILDGAPVYIGNNVLFG
FT                   PKVGLYTSNHLFDPAERKAGGCVAHSIGIGDNVWLGAGVSVTPDTIIGRNSIIGAGSIV
FT                   VNDIPDNVIAAGNPCKIIRKIIAADRTGFDPNSGQFL"
FT   CDS             complement(482798..483193)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00483"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00483"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49930"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P5"
FT                   /protein_id="CBL49930.1"
FT                   /translation="MKITFTDKALDYLKRREILNKILILIADDGGGKYSIKGGGCAIGS
FT                   HFSIIYVDKVDPDYPIKFENNQGINIYTSKYDTTMMGPNLVVDYANASLNLKSDEGLLD
FT                   GGVDIGNGAELIKAQKNVKMTGVEWRC"
FT   CDS             483290..483520
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00484"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00484"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49931"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P6"
FT                   /protein_id="CBL49931.1"
FT                   /translation="MTDKSHDPDNFDWLDSIINEETDKRVKNEGPQKKDQTSDDSDNHW
FT                   FDSIIDAAVEKRTKENERILHKLKEKENQNK"
FT   CDS             complement(483567..483767)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00485"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00485"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49932"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P7"
FT                   /protein_id="CBL49932.1"
FT                   /translation="MFNEENAIDAKNLHVDSFKYQSTEDMPSDAYSSWEEKHPNARVFK
FT                   LEFRNIGESNEWQEMIIIYTE"
FT   CDS             483911..484783
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /locus_tag="LCRIS_00486"
FT                   /product="Phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00486"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49933"
FT                   /db_xref="GOA:D5H1P8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P8"
FT                   /protein_id="CBL49933.1"
FT                   /translation="MKKIINRTLLDDRVKENYIFISDIHGNLETLDLIKQATADFPEAQ
FT                   LVAGGDYVDGREHVKEVLDYLIEQKSEGAIVLLGNHEQMLLNFAEKQEHQDGIWFYNGG
FT                   GKSLVSLFGSIVLPDELRDSEYYRFLKGCPIMYETPHLIFVHAGVRPDEQYNDPETYSE
FT                   IEYGLKFDYDFYRIWARDKYWYSDSLLKMMAHNKTGKTIVTGHTPTAALEGKYDDGRQM
FT                   RRLSIDDCIVRTVQYPGEPARIFTDGGSHSDPLIYPHNDGNVVVLDGMGKIVRVYNWKH
FT                   PHGTRFENQ"
FT   CDS             485253..485879
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00487"
FT                   /product="Resolvase, N terminal domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00487"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49934"
FT                   /db_xref="GOA:D5H1P9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1P9"
FT                   /protein_id="CBL49934.1"
FT                   /translation="MTDYSNRIMYLKEAAAYVGKAPFTLQSWDRAGKLKAHRTENNRRF
FT                   YYQSELDAYLGIRRDQADHRKTVAYARVSSNGQKDDLQDQIAFLRQFINAKGIIADEFI
FT                   SDIGSGLNYKRPKWLKLIKEVDQNRIKEIYVTYEDRFIRFGFKFFQEFCSWHNCKIIVL
FT                   NNEDTSPDKEMVDDLISIIHVFSCRLYGLRRYKKKIQDDPALKNK"
FT   CDS             485884..487203
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00488"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00488"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49935"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q0"
FT                   /protein_id="CBL49935.1"
FT                   /translation="MNKEKGGEIMSNYYIKTRSYEVFASKAMKNILDRNCDYRRYCWNQ
FT                   ALALWNDLYSAHQIYDKICYTTFTPKKNKRSNKLKIIQKDVHLNPSPNWRLVRDRLVEE
FT                   KEDWQFAYSAHLLQLTVQDLGKAWKSFFDKAQPDWGKPHFKSKRAPRQGFKSDQAKLID
FT                   GRLFLEKPQGLKKDWEPLILSEKPMNYPTGVMSFYRENGRYFVSIPYKIPKQKIDRKAD
FT                   TGKATGVDLNVGHFNYLGGNKSILPKKLEQTYEKIKHYQRLLARKREVNGKEQAMQSKK
FT                   YLKTKTKLQAAYQRASNIQNDLMQKFTTMLVDNYDSIVIEDLDVKKMMMSHVASKGMHR
FT                   SMFGKFRQVLSYKCEWYGKKLIVANKLYPSTQRCAVCGLVKKGDEKVTLYGNIKHGTKH
FT                   NEFICYNPACSNYNKKVDRDENAMLNLTILIKHPELNRAL"
FT   CDS             487397..488038
FT                   /transl_table=11
FT                   /gene="celB1"
FT                   /locus_tag="LCRIS_00489"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00489"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49936"
FT                   /db_xref="GOA:D5H1Q1"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q1"
FT                   /protein_id="CBL49936.1"
FT                   /translation="MANSKSSEGLNAFVNKHIMPVAAKIGSFKPLIAVRDGIAMAMPLI
FT                   IVGSLFMIINSFPVAGWSDWLSKTAVHGISLAQILAKITNGSFGIMSLIAAFGIAWSYA
FT                   NQYKTDGVSAGIISASVFFILTPSIMSGDKVPVEGFPYTYLGSRGLFVAIIFGLLSAWI
FT                   FQWFINHNIQIKMPATVPPAVAKSFSAYDCANGKCDYHLLCNEPRLSSIM"
FT   CDS             488010..488213
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00490"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49937"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q2"
FT                   /protein_id="CBL49937.1"
FT                   /translation="MNLGLVPLCNGTVIPWTMPPIISGFLATGSIAGSMLQVINIILDI
FT                   LIYLPFIVALNKRQLIEEDKAE"
FT   CDS             488581..489252
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00491"
FT                   /product="Aggregation promoting factor"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00491"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49938"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q3"
FT                   /protein_id="CBL49938.1"
FT                   /translation="MKIKSILVKSIAVTALSVTGLVAANNNTNTAQAAIVENDTDVVTV
FT                   KNVSDNAITVYNSYKNPEATGQTLASNTSWKVIKTAYDAKGHKWYDLGKNQWVRAKYVT
FT                   RGYHTQAAVTQAPVQHQTQTENTNSAATTTAANNTNTQTTTSTVSGSEASAKEWIAGRE
FT                   SGGSYGASNGQYVGKYQLSASYLNGDYSAANQERVADNYVKGRYGSWTAAKAFWQANGW
FT                   Y"
FT   CDS             489414..490478
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00492"
FT                   /product="Surface exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00492"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49939"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q4"
FT                   /protein_id="CBL49939.1"
FT                   /translation="MNKKIIATLLTSVCLMGTASAIYETAPQTVQAAVKGKVQVKGNKK
FT                   VRLYTSKGKKSKYYAVAKRTYSYSAQKYLKIGKKKHLAYKIGNNSHWLLAKNAKKVKQT
FT                   APVANYQVAAFKMPSGYTRASLLEAYKGKPSAKFIQACMQGMQENDFSRVSSGESKNDQ
FT                   RMINPAALSSSDQKELAEFSLRLINSARSQLGLKPWIYSSGVEQLADSIAQEYAQNGHS
FT                   IKDGDHYVAGIVRACKKHGLELNDNYVEDMAGFTINKKTMSMAEMKRNVYFGLKQMIFG
FT                   FAGAGEAERGNKNLYREWEHAGDLFNTQGSRHDGDYNYYGFSISKISNIYSMHYISVPS
FT                   FVVNSSEYNKHFKI"
FT   CDS             490520..491095
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="LCRIS_00493"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00493"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49940"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q5"
FT                   /protein_id="CBL49940.1"
FT                   /translation="MTKTLYLVRHGQTYFNYYHKVQGRCDSPLNERGIRQVEMARDYFK
FT                   KQDIHFDQAFSSTQERACDTLEIITDHQMPYKRLKDLREKCYGIFEGRDEFLLPWNYNN
FT                   PNVDPTMEKDEDVVARMRRAVVEILAGLEDGQTALVVGHGDILAQFVRDATENKNFGGF
FT                   GNASIVKLTVDGKNIHFDSYVWPAEDLK"
FT   CDS             491097..491687
FT                   /transl_table=11
FT                   /gene="pgm1"
FT                   /locus_tag="LCRIS_00494"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00494"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49941"
FT                   /db_xref="GOA:D5H1Q6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q6"
FT                   /protein_id="CBL49941.1"
FT                   /translation="MAINLYLVRHGQTWFNKKHRMQGSCDSALTPLGIKQAQAVRDYFQ
FT                   TQGITFARTYCSTQERASDTLEIIAGPETEYVRLKELKEKDYGSFEAHNALLWPLHRLG
FT                   KFRVEDDREVVERMERGINLIMRDAQDDDNILVVGHGDSLSQYINETTNHREFLGLPNC
FT                   SFVQLTSNEGSTLEYVRTEWPAKAVKIDQITGE"
FT   CDS             491756..492415
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00495"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00495"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49942"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q7"
FT                   /protein_id="CBL49942.1"
FT                   /translation="MDETPIFRITKLNIKENDRGEYIREVENNMHNSIPAEEGTLLIGS
FT                   AHDDAHGEDNYEIELFRNSLAEDLHIAAAHADDFAETIDKISTDKEVIELKPEVITTKA
FT                   HDALNDNADHFVMRLVKVEVKPEDAEKFAHEVKKEMTTSMAAEPGMEIMMSGVNKKNEN
FT                   EWYFVEVYFDDKAYDAHIKSAQYLEYVENTDGMVVRRDVKNLVRDTLATQGAIVLD"
FT   CDS             492462..493142
FT                   /transl_table=11
FT                   /gene="glpQ2"
FT                   /locus_tag="LCRIS_00496"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00496"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49943"
FT                   /db_xref="GOA:D5H1Q8"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q8"
FT                   /protein_id="CBL49943.1"
FT                   /translation="MTQTIIFAHRGLPVKFAENSLQGFKYAATHGAEGVEFDVHLTKDK
FT                   VPVVMHDETLDRTTNGTGYIKDYTLNEIRKFHLENGEPVPLLSELFEILQDKDLYINLE
FT                   FKTNKIHDVGIEAIVLSLAKQYHFVHPIIFSSFNYQTLKNCQKIDAQQQYCFLTKMPIP
FT                   FPAHFIAKNHFAAIHPHWYLPSKITQRIWTVDKVSTAKKYFKLGVAGIFTNNFELMNRV
FT                   KQRV"
FT   CDS             493176..494147
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="LCRIS_00497"
FT                   /product="Sugar-binding transcriptional regulator, LacI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00497"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49944"
FT                   /db_xref="GOA:D5H1Q9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Q9"
FT                   /protein_id="CBL49944.1"
FT                   /translation="MATMKDVAQKAGVGVGTVSRVINHVPGVKESTLNKVNEAIKALNY
FT                   IPDAYARGLKTKSSRTIALIVPSVWYPFFSEFAYYVEKRLDKEDYKLLLCNSDNNPAEE
FT                   AKYIKMLKQNKIDAIIAITYSDIEQYIYSNIPFVSLDRYFDKKVSYVTSDNYEGGKLAA
FT                   KELLKHGAKDLVYVGSHSKYPNGTMLRRDGFRDYLEDNGIDYKEIFLQEPVKDFTPYVL
FT                   EMLQLHPEIDGIFCHTDSLLLKLQKILLQHGYQVPKDIQLIGFDGMNLSADLPLGISTI
FT                   AQQVESLANGAVDLVLRKIADPSLKNEAKMYPVKYIEGNTTK"
FT   CDS             494344..495642
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00498"
FT                   /product="ABC transporter, sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00498"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49945"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R0"
FT                   /protein_id="CBL49945.1"
FT                   /translation="MKKWKLGVVSAAAAIAALGLTGCSNNQGSSNSKNVTMWVHVSNTD
FT                   PEGKALQKNVNDFNKENKHGYKAKVQFIPRSGSGGGYEDKVNAALNSGSLPDVLTLDGP
FT                   NTAAYAHSKIIQPVGKYIQGKDDFVKSIMDQGTYDKKLYAIGYSESSIGFYYNKKMFKE
FT                   AGIKDSELPTLSKPWNWNQFKAICKKITNHFHEPAINMNLNDHSEMALYSFAPFVWSAG
FT                   GSITNPAGTKAVGYFNSKQTTSAFQLIQDMVKDGYTTISPKDKGFETGKYAMFMTGVWE
FT                   VQTLQNQYKNLKWGVLPYPVSPKTNKEVSPTGSWQYAMSSAAKNKKAAGALINYLVSKK
FT                   ALMTNERIMGNTVLPVRKSVAKELVPKVGPAMKFFIKQNQTTGHARPVLVNYPQVTRTF
FT                   ADTVQNVTLYKKNPNVQKVMDEQAKVIQKYLQK"
FT   CDS             495663..496547
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00499"
FT                   /product="Sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00499"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49946"
FT                   /db_xref="GOA:D5H1R1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R1"
FT                   /protein_id="CBL49946.1"
FT                   /translation="MQAKGIKRQIGWLYVFPAILILLTFLIIPFLMSFSYSFTNYNILT
FT                   PWAKQYVGFTNYINTFKDPVFLQSLKNIAQFVIFIMPIQVGAALGLALIVNKKRPGNTF
FT                   FKISFFAPQVVSLTVVSILWMYILNPDQGLLNGILGIFHIKPQPFLTSPKQAMFAIIGV
FT                   SAWQGAGYQMLIFLAGLQNIPDSLYEAAELDGANGWQRFLHITLPMLKPTSIMILTTTF
FT                   ISAFNLMIQPMIMTQGGPENATMTPIYYIYRTGFTDRQLGYASAMSVIYGIIIIIFTII
FT                   QRKITNAGGDENA"
FT   CDS             496540..497397
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00500"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49947"
FT                   /db_xref="GOA:D5H1R2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R2"
FT                   /protein_id="CBL49947.1"
FT                   /translation="MHKFMTRRRFHIIWTTVLITILALFFLFPLVWMIVSSMKPESQIY
FT                   ANISNFKAFLPSGNISDWGKAYVSIFHRFPVMRYILNSVFYATSVTVGSIVINALAGYG
FT                   FAKFNFTGRKLLFGLLIALLVIPGTTLLIQQFQIAKTIGILNTPLAVILPGMSSPFYIY
FT                   MFRNAFAAIPDSITEAAELDGASNLRIFWNILLPMTLPTVATVGTLSFIGSWNDYVWPL
FT                   MVLTNSDQFPLQVAITNINSTNPVYMNQVMAILTISTVPLVLVYIFFQKYLTQGMGSAG
FT                   NGDK"
FT   CDS             497397..498689
FT                   /transl_table=11
FT                   /gene="sacA"
FT                   /locus_tag="LCRIS_00501"
FT                   /product="Sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00501"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49948"
FT                   /db_xref="GOA:D5H1R3"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R3"
FT                   /protein_id="CBL49948.1"
FT                   /translation="MKENSYLYEKIRKIDNDELRPLFHFTAPVGWINDPNGLIYYKNYY
FT                   QLYYQYNPYAPHWDNMHWGHARSKDGLHWEDMPIAMKPDHQYDKTGVFSGSAIEKDGKL
FT                   YVLYTGHVDEDGQITETQCVAVSDDGVDFKKYENNPVMTVADLPGETDDSNFRDPKVFK
FT                   HGDKYYCVVAAALEKHGSLVLFESDDLLHWSFKSVLLQGEEYGIMTECPDYFNINGQDY
FT                   LAFSVILGDGRNSVVYLAKGHMDWQNFKFKLEEQHRLDASDDFYASQSFVDEKDNRIII
FT                   PWLRSADHVNYLEESGHLWNGMMGIPRMLTTINCQLIQKPIGTINDMSLSDSQDIDLGS
FT                   YKLTEEIPIDHSLILKGDNGEIHITRKKEDQYVIEIHSPVFIKTVSWHPDNHKLTLVID
FT                   NSSLELFGQSKTLSIVTFVAGINRVMLKDVK"
FT   CDS             498704..499810
FT                   /transl_table=11
FT                   /gene="msmK1"
FT                   /locus_tag="LCRIS_00502"
FT                   /product="Sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00502"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49949"
FT                   /db_xref="GOA:D5H1R4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R4"
FT                   /protein_id="CBL49949.1"
FT                   /translation="MTEVDLNHIYKKYDGNDKYSVNDFDLHIKDKEFIVFVGPSGCGKS
FT                   TTLRMIAGLEDISKGTLEIDHKVMNDVAPKNRDIAMVFQNYALYPHMSIYDNMAFGLKL
FT                   RHYSKEDIDKKVKHAAEILGLTDYLKKKPAALSGGQRQRVALGRSIVRDAPIFLMDEPL
FT                   SNLDAKLRVSMRAEIAKLHQRLGTTTIYVTHDQTEAMTLADRVVVMSVGEVQQIGTPLE
FT                   VYNKPRNMFVAGFIGSPQMNFFNVHYKDGRISDGKGLNIGIPEGKAKMLNEKGYNDKDI
FT                   VFGIRPEDIHAEEAFLETWPDAVISSTVVVSELLGATIQLYQKVDGTEFVADVNSRDYH
FT                   KPGDHVKMGFDVNKAHFFDKDTTMAIYN"
FT   CDS             499932..501374
FT                   /transl_table=11
FT                   /gene="gtfA1"
FT                   /locus_tag="LCRIS_00503"
FT                   /product="Sucrose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00503"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49950"
FT                   /db_xref="GOA:D5H1R5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R5"
FT                   /protein_id="CBL49950.1"
FT                   /translation="MKLQNKAMLITYADSLGHNLKDLSQVMERYFNKAIGGIHLLPIFP
FT                   SNGDRGFSPTRYDVVDPKFGSWEDVEKLGQQYYLMFDFMINHLSKHSDYFQDFQAKHEE
FT                   SKYHDLFLSWDKFWPAGRPTQKDIDLIYKRKDKAPYQEIHFKDGSQEKMWNTFGPDQMD
FT                   LDVRTKTTQEFIKQNLQNLAKHGASLIRLDAFAYAIKKLDTNDFFVEPEIWSLLEEVND
FT                   YLKDTPATILPEIHEHYTMPFKVAKHGYFIYDFALPMVLLYSLYSGNSTQLANWLKKCP
FT                   MKQFTTLDTHDGLGVVDAKDVLTDDQIDYTTNKLYKIGANVKKKYSSAEYHNLDIYQIN
FT                   TTYYSALGNDDKKYFLARLLQIFAPGIPQIYYVGLLAGENDIQLLEKTKEGRDINRHYY
FT                   ELDEIEEQVQRPVVKSLIKLLEFRNSVPAFDLDGSIKVETPSEHEIVITRMNKAKTDVA
FT                   SAKVDFQNLTYQVKYNDQVFGF"
FT   tRNA            501548..501619
FT                   /gene="tRNA-Gln"
FT                   /locus_tag="LCRIS_02077"
FT                   /product="transfer RNA-Gln"
FT   CDS             501751..502923
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="LCRIS_00504"
FT                   /product="Aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00504"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49951"
FT                   /db_xref="GOA:D5H1R6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R6"
FT                   /protein_id="CBL49951.1"
FT                   /translation="MVDLTKHMKKGLVEQKPGQILAFAAYTSKIPNIVKFTVGEPDFNT
FT                   PEHIKKAAQESIANNHSHYAPSNGTPGLRQAAAKFLAEKYGQKYAADEILITNGVTESI
FT                   YDFLTAVINPGDVVLVPTPIFPLYIGDAQSMGAEVVQLDTSADDFKLTPQKLQAALDKY
FT                   GDRVKALVMNYPTNPTGVMYSQDELDALADVVRDKPVFVLCDEIYSELNYDKPHASMEK
FT                   TLHDQVVLMNGVSKAWAMTGYRIGVVAAPKPILDQLAKIHQAITTTEPTPMQDAAEEAL
FT                   VNGINDAEPMKKEFQKRRDVLYEGLTKLGFECVKPKGAFYIFAKIPAGLEQDDTKFIYD
FT                   LAEKGHVAVIAGSFFAKGGAGYIRLSYATSMDQIKEGLKRLEKYVAENKQ"
FT   CDS             complement(502978..503967)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00505"
FT                   /product="Oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00505"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49952"
FT                   /db_xref="GOA:D5H1R7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R7"
FT                   /protein_id="CBL49952.1"
FT                   /translation="MKKFNWGIIGTGWIAHDMADALNKVNGEIYAAANPNEEALRAFVQ
FT                   EKHVQHAFNNPDEMIKDPSIDIIYIATPHTFHYDYIKKALNAGKHVFCEKAITVNAQQF
FT                   DEVAQLAKEKHLILMEGFTLYHMPIYQKMQDMIKTGKFGDIKMIQINFGSLKEYNPQNR
FT                   FFNKDLAGGALLDIGGYATAFAISFMDEYPESINTTVKFFETGVDEESGIILKNSKGQM
FT                   AVMSLSMRAKQPKRGLVSGTKGYFEINQYPRGTEAYITYTQSAHEESYDKVTAGNADQA
FT                   LEYEVTDFQKYIEQGHDEGELEKSRMIAHILTSIRTAWGMTYPFDNEE"
FT   CDS             complement(503954..504637)
FT                   /transl_table=11
FT                   /gene="rpiA1"
FT                   /locus_tag="LCRIS_00506"
FT                   /product="Ribose-5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00506"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49953"
FT                   /db_xref="GOA:D5H1R8"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R8"
FT                   /protein_id="CBL49953.1"
FT                   /translation="MKINSISDLALSKIKPKMTISLGGGSNVFKLAQAIAQHNLDITLY
FT                   SPSELTRFRCQELGLELLPSTAATKIDIAFDGCDSIDKNFNVLKSLGGIHLFEKQAAQI
FT                   AKQFILLLPSERIQPILNPKIPLCLEVAPPCVNQVQKYLSSLHLTSKIRQDSSVAAFAR
FT                   TPLGNYLIDVFNEDWHNITELNRQLCLQNGVVSSSLFENLATSLITEKDGKIIELKRGN
FT                   DHEKI"
FT   CDS             504790..505623
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00507"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00507"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49954"
FT                   /db_xref="GOA:D5H1R9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1R9"
FT                   /protein_id="CBL49954.1"
FT                   /translation="MTKIIDTIYSKLATMSASDQKIAQVILKQPEQVVNYTISKLATEA
FT                   EVSDASVTRFCHNLDLTGFHDLKIQLAQNATESVSLQNMSRDDASANLELIEKNKVAEI
FT                   KATLENVTEAKLDQVLHFLTESRIVQVSAEGDTYPVAADAVYKFNQIGLLAIDSGGTIE
FT                   TAIAQTMNLSKKDCLLVISNSGEAAGIIKQIKVAKQKGMPVIAITNRDDSPIALLADVH
FT                   LKTAVRQTVMQSQYYFSRVASMTMIEALYLLLIAGDAGRVEHIKEHEAIISNQKI"
FT   CDS             505952..507427
FT                   /transl_table=11
FT                   /gene="slpX"
FT                   /locus_tag="LCRIS_00508"
FT                   /product="S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00508"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49955"
FT                   /db_xref="InterPro:IPR024968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S0"
FT                   /protein_id="CBL49955.1"
FT                   /translation="MRKNTRIVSMAAAALLAVAPVAASAVPVNAAISLGTVTNTTGTTS
FT                   TTTATTAKPTDRSYFTYGNQVIDAASTTDKTANVVPTTISIKAKDTVASVTKAINDLGL
FT                   VFFSTNNASGEKVNLKDSEVAAILKNAGVTLDKDNKNITAVPTSDFNLTLTGTGSTSTQ
FT                   TATVQIPVVVSGSSSTTDTTQNPVINWSLNGQSKGSVNGQIFQVAVGSQFNPTNFVNSN
FT                   GEPVIISAVQNSNNNTAASLEATSNPVNTSEAGRYYNVTLTATGLTGKKTIATYTVLIT
FT                   SSHKQALYANGASSIATYHIYGINVRPASTTFKDGDTVYVADQTRTLNNVSYSQVSTKS
FT                   KSDANSSNIWVKTSSLVKPAGDTNTKTLPVMVDSRAYDKNGNYLGHMYYAYNDIEIVPT
FT                   IVTINGKTYYKVANKDEYVRVTNITGNQRTLKHNAYIYWSSYRRTPGTGKMYRGQTVTT
FT                   YGGQMRFKNGKKYYRIEGCRNNNKRYIKAVNFY"
FT   CDS             507572..507730
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00509"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00509"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49956"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S1"
FT                   /protein_id="CBL49956.1"
FT                   /translation="MDYLSKKKEFIFLNSQNASVYVHTVQLKNYKYELYVEGKSKKYRK
FT                   SLRNKSF"
FT   CDS             507743..507994
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00510"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49957"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S2"
FT                   /protein_id="CBL49957.1"
FT                   /translation="MNTFEDAKNTLDSNLEKYVSQQISLDRSYLVENVSIYAEKSYEYA
FT                   KMAQYFRSAKPDKDGIAIIVFKKKLLKMFWLHFKKILA"
FT   CDS             508254..509621
FT                   /transl_table=11
FT                   /gene="npr"
FT                   /locus_tag="LCRIS_00511"
FT                   /product="NADH peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00511"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49958"
FT                   /db_xref="GOA:D5H1S3"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S3"
FT                   /protein_id="CBL49958.1"
FT                   /translation="MSKKQIVIVGASHGGQEAAYEILDRYDDVDVTVYEASDFVSFMSC
FT                   GMKLYLEGKTTGQDNVRNFTPEGLAERGGKVVNNTAVTALDPTNKTVTVKNVKDGSTKE
FT                   VNYDKLIISSGVNPAGLPLPGADLKNIMLMRGYDCASEINAVAQNDAVKNVAVIGAGNG
FT                   IAAAEVFAKAGKNVTLIDSGHKPLENYLNDTYTDLFAKELTDHGVNLAMDTKVTGFAGD
FT                   GKVEKVETDHGEIATDCVIITVGIKPNTAWLKGTVDLYDNGYIKVDNYFRTNVKDVYAI
FT                   GDAVFPFSIPANRRVPMPSAIAVRHEAQYVVEHLFEAKPECVFKGLVGAQLLEAFDLHA
FT                   VTTGLSEKNAKRAGINAKETVLKSYLRPDYIPEKDNPTCYIAVVYNEDSHQILGGSVLS
FT                   SYDISGQANVLSLAIRNKLTLEDLAEADFFFSPTYDKQWSLVNQVAQKALGLKLTV"
FT   tRNA            509744..509825
FT                   /gene="tRNA-Tyr"
FT                   /locus_tag="LCRIS_02078"
FT                   /product="transfer RNA-Tyr"
FT   tRNA            509860..509931
FT                   /gene="tRNA-Gln"
FT                   /locus_tag="LCRIS_02079"
FT                   /product="transfer RNA-Gln"
FT   CDS             complement(509937..511652)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00512"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00512"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49959"
FT                   /db_xref="GOA:D5H1S4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S4"
FT                   /protein_id="CBL49959.1"
FT                   /translation="MYQNYTIGQTALTLNLDFAIPHNHLANTISWFVDSIPEDVLLGNT
FT                   AKTGRPAYHPAMMLKILLFAYSRRVFSGRKIELMLEENVPMMALAEHQQISYHTINNFR
FT                   SSKHANELVKKSFLYFTNLLEAEGLINEGAIFIDGTKIEADANRYTFVWRKAVEKFHDK
FT                   LKGQAVELYDELIAKEVVKAMAKEKVQTSQGLAELAQETEAEIEKLTEEIEQEPKAIPG
FT                   GSPRKARRRGLKKLLHKLRKDYVPRMKKYEEAKEIFAGRNSYSKTDHDATFMHMKEDHM
FT                   KNGQLKPGYNIQAATTDQYVVDFALYPNPTDFRTFEPFLKQMTTLDKFDKIVADAGYGS
FT                   EYNYSMLEEEYSDKKYYIPYTMYEKEKTRKYRNDPTKLANWFYDEKDDYYLDQNGVRFN
FT                   FKYYSQRKDRSTGQVRDFKVYEADEFQLTPELERLAKTKSGRQRQVRYNPNWQYLKEKA
FT                   KAVLQSPEGRHIYSMRKYDVEPIFGHLKNVFGMRRTHLRGKKKVETDIGIAFMMMNLSK
FT                   YWNRRWSKDQFSLFKNKNRQKKTVKQLKLRVGLIVFQYLRVSFFPDTFSGWVFF"
FT   CDS             511957..513540
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00513"
FT                   /product="Oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00513"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49960"
FT                   /db_xref="GOA:D5H1S5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S5"
FT                   /protein_id="CBL49960.1"
FT                   /translation="MTAAAALVLAACSNNDSNAAPTKTMNTSVTNEISTLDSSKYGDTT
FT                   SSEVLQNSMEGLYRFNKKNQPELAGATKVERSKDQKIYTFTLRNNAKWSNGDPVTAQDY
FT                   VTAWRRTVDPKNSSLDADSYAIIKNGEAISQGKAPVNSLGIKALGKYKVQVTLANPIPY
FT                   LPQILEGAQFYPQNSKLVKKLGSKYGTSSKNLVYNGPFTVSGWTGSNLKWTYKKNPTYW
FT                   NKKIVDLNKVNVQVVQTPSTGVNLFRSGELDYTTLTSDFVKQYQNNSSYHTKVTPTNGY
FT                   LSFNLKRKSTGNVHIRRAISRAINKQQLVKTVLHQGKVSNGIVAANFITDQATGNDYRK
FT                   DAGDLVTYNAKKAKKEWQLGLKQLGKKKLTLELLTSDIDDAKRVGEFIQSNLMKNLPGL
FT                   TLRVRSIPLKSRLSNTTNYNYDFVYGTWQPSYEDPIDFLTVGGLFNLAPDYHNANFWKQ
FT                   IDLARSTYATDPQKRLNALVNAEKQLIQKDAFAASLFQQGTSYLLNKRVKGFQLSPYGN
FT                   VAYYWNVKMK"
FT   CDS             513717..514766
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00514"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00514"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49961"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S6"
FT                   /protein_id="CBL49961.1"
FT                   /translation="MRADDVLMLGPGYYYLPQGITLTDITIKGTGSLPEDTTIYGYISV
FT                   SEDSRYVTLENLCIDTTTEHNSLSVPVGVDGYLTLRNCFIKGTGTDTAAIAVNGKITLE
FT                   LYSTKIVNGSVSMYDHANFRLEMNDSEIDYFSDKYCALAIEGEGTAIVNNSKIHGSINT
FT                   FAKTNAELDLNNSEVDYVLLHGQTWMNMLNSKVKSASDSCLYLSDDCWSNIMNSTFLGG
FT                   VYIDKKTRTIIQNSTINRMIVVDEAKVTMNNAVILAHADFQDQAKCDATRVTFTGNMNY
FT                   EYFLALSGEANMKGHNIVLNPNQANLAVKDEAKFSASVVANDNEQVEVEYNKRPNVYIL
FT                   GVKWTAKKK"
FT   CDS             514854..515555
FT                   /transl_table=11
FT                   /gene="gntR1"
FT                   /locus_tag="LCRIS_00515"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00515"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49962"
FT                   /db_xref="GOA:D5H1S7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S7"
FT                   /protein_id="CBL49962.1"
FT                   /translation="MEEPMYIKIHNQIKRDIENHVYQVGDRIPAERQLAVKFGVSRMTL
FT                   RQAIKTLEDEGILERRLGSGTYVASQKVQEKMSGIMSFTEITKANGQVPSSKLISYQIG
FT                   NPSLSEKERLALKDNENVLRMERIRYADKTPICYEVVTVPYYLVKNFSKEDVSTHLYKT
FT                   LEKRGGFAIGRVTEHISASIANEQDARLLKAKKGEPLITRRQVTELADGQPFEYTRARY
FT                   VAERFEFTFSK"
FT   CDS             complement(515603..515989)
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /locus_tag="LCRIS_00516"
FT                   /product="Glycerol-3-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00516"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49963"
FT                   /db_xref="GOA:D5H1S8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S8"
FT                   /protein_id="CBL49963.1"
FT                   /translation="MKRVITYGTFDLLHYGHVRLLKRAKELGDYLIVGLSTDEFNEFKK
FT                   HKEAYNTYPERKYILEAIRYVDQVIPEKDWDQKITDVQKYHIDTFVMGDDWKGKFDFLK
FT                   PYCDVVYLPRTPGISTTKIKEDLK"
FT   CDS             516116..516847
FT                   /transl_table=11
FT                   /gene="tagA"
FT                   /locus_tag="LCRIS_00517"
FT                   /product="UDP-N-acetyl-D-mannosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00517"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49964"
FT                   /db_xref="GOA:D5H1S9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1S9"
FT                   /protein_id="CBL49964.1"
FT                   /translation="MSKVNILGVDFDNKTFNQFQNEFINRLNNHLSTFIVTANPEIVMA
FT                   ANENPEFMKILKNDPDYITADGIGIVKAAKMLKQPLPERVTGYDLFTWLMDVANDRGSR
FT                   VYLIGAKPQVIHAVQSKIAKEYSNINLVGAEDGYFTEDLELVARRIQKAQPDMVFAALG
FT                   FPKQEKLLSILRKNETPALMMGVGGSFDVFSGIVKRAPEAFQKTHLEWFYRLITNPSRF
FT                   KRMLVLPQFVVRVKQSKKKGK"
FT   CDS             516858..517949
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00518"
FT                   /product="Glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00518"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49965"
FT                   /db_xref="GOA:D5H1T0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T0"
FT                   /protein_id="CBL49965.1"
FT                   /translation="MKVLHVNAGLENGGGLSHIVNLLTEAKNEGKDFELLTLAEGPVAQ
FT                   AARAAGITTHVLGANSRYDLGSLGRLTKFINEGHYDIVHTHGARANLFLSLIHKRIRAT
FT                   WCITVHSDPYLDFEGRGIIGNIFTKLNLRALRKADCIFVVTQRFAKLLINRAHVNKNKV
FT                   HVIYNGIFFHSDSEIPAKYEHTYFNIINVARTEKVKGQELLLKAVKKLDDQHIRLHIAG
FT                   DGSQLEALKALTRQLDMAPQVTFHGFMTQHQLSGLYKRIDLAVLTSYSESFPLVLLEAT
FT                   DNLIPILSTDVGDIHKMIPGPEYGFIAKTGDIDSIAKEINLAVNKTHEELRQMANTEKR
FT                   YAEEHFSIKNQLDSIEKVYLTLR"
FT   CDS             518036..519514
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="LCRIS_00519"
FT                   /product="Nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00519"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49966"
FT                   /db_xref="GOA:D5H1T1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T1"
FT                   /protein_id="CBL49966.1"
FT                   /translation="MFYPELAKDDSLALHTDLYEINMMYTYFKKGIADRNAVFESFYRR
FT                   EPFGNGYAVYAGLEHIINYLKNLKFTESDLQYLKENEGYDDDFIDYLRNLKLKLTIRSM
FT                   KEGELVFANEPILQVEGPLAQCQLVETAILNIINFQTLLATKAARIKLAVKDDGLMEFG
FT                   SRRAQETDAAIWGARAAYIGGFDSTSNVRAGKLFGIPISGTHAHALVEAFGSEYDAFKA
FT                   YAETHKNCVFLVDTYDTVRSGVPNAIKVANEMGDKINFLGVRIDSGDMAYISKQVRKEL
FT                   DDAGYPDAKIFASNDLDENTITNLKMQGAKIDVWGIGTKYITAYDQPALGAVYKLVAME
FT                   DELGAMRDTLKISSNAIKVSTPGKKQVWRISANTAKKNEGDWVSRYNEDPRKFDALFMF
FT                   HPQYNYINKVVTDYTAIPLLHDIFKDGKLVYDQPSLDEIKKFCADNLDGLWDEYKRSLN
FT                   PQEYPVDLSQNLYESKMDLIQDIRRKIRERSIGR"
FT   CDS             519511..520341
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="LCRIS_00520"
FT                   /product="NH(3)-dependent NAD( ) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49967"
FT                   /db_xref="GOA:D5H1T2"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T2"
FT                   /protein_id="CBL49967.1"
FT                   /translation="MRELQKEIIAYEHVLPEIDPKKEIRRSIDFLKDYLKANPFLKSYV
FT                   LGISGGQDSTLTGKLCQMAIEEMREETGDDSYQFIAVRLPYGVQADAQDAEDAVAFQKP
FT                   DQDLIVNIKEPVDAMVKVVEATGQKITDFNKGNIKARQRMVVQYAIAGANKGAVVGTDH
FT                   AAENFSGFYTKFGDGAADLTPLFRLDKRQGKALLKELGCPKHLYEKAPTADLEEEKPDL
FT                   PDEVALGVTYQEIDDYLEGKEVSDKAADQIEKLWNKSKHKRHLPVTVFDDFYKK"
FT   CDS             520528..523197
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00521"
FT                   /product="Cation-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00521"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49968"
FT                   /db_xref="GOA:D5H1T3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T3"
FT                   /protein_id="CBL49968.1"
FT                   /translation="MAKKYYVESIPDIEKDLNTSVKYGLSASDAKARLEQYGPNALASK
FT                   KKQSMFMRFIDQFKDFMIIVLIIAAILSGVLAHEWTDAAIIMIVVILNAILGVFQEARS
FT                   EAAIDALKEMATPDAHVRRDDTIVTIPSTELVPGDVVLLEAGDVVPADLRLNQAHSLKI
FT                   EESALTGESVPVEKHAETLEGEDIALADRVNMAYSNTNVTYGRGEGIVTSTGMHTEVGK
FT                   IATMLNNADETDTPLKRNLNQLGKTLTIMILAICVIVFIVGVLKADPAERNSTLMINMF
FT                   LVAVSLAVAAIPEGLPAIVTIILALGTQTMAKHKAIVRKLPAVETLGATDIICSDKTGT
FT                   LTQNRMTVEKIFYDKKLHDNSESISENNSALLAMTLANDTKIENGGDLLGDPTETALIQ
FT                   FAFDQNIDVTDLLEKYKRIQEVPFDSERKLMSTVNKDGEQYFVAVKGAPDMLLQRVTRI
FT                   ENGGQVESITDKQKQNILAQNKQMAQQALRVLGLAYKKVDQLYTDPTTDNVEQDLIFAG
FT                   LVGMIDPERGEAKAAVAEAKSAGIRTVMITGDHQTTAQAIAERLGIIEKGQDSRVLTGA
FT                   ELDKLDDEYFKQHVGDYSVYARVSPEHKVRIVKAWQANDKIVAMTGDGVNDAPSLKQAD
FT                   IGIGMGITGTEVSKGASDMVLADDNFATIVEAVKQGRKVFSNIQKAILYLMSCNVGEVL
FT                   TVFMMTMLGWDILAPVQLLWINLVTDTLPAIALGVEPVEAGIMKRKPRGKKSNFFSGGV
FT                   ASSIIYQGILEGILVLGAYQIGLHVGPHVGDPSLQHGDALTMAFLTLGLIQLFHAINSK
FT                   YVHQSIFRPHTFSNKWFSGAIIIAAVIMAAVELPFMTKFFDVTELDGPQWLVILIAGIL
FT                   MVLIVEIVKFCQRKMGKE"
FT   CDS             523287..524441
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00522"
FT                   /product="Teichoic acid biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00522"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49969"
FT                   /db_xref="GOA:D5H1T4"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T4"
FT                   /protein_id="CBL49969.1"
FT                   /translation="MKSFLFRLYLAWMSFLARFTTMENNNVVILNGSGRSGSNGYAFYK
FT                   WLQLNHPEYNVTLVEPWPSSHLKWKTWQKIGAARYVITTHQPFKVRKHQINVQLWHGVP
FT                   LKRMGIMANNTKRCDNRRNEKLWHKNADIVASSSDLYESLMSACMAIETKKYRKLGFPR
FT                   LDLLAKPVISKKQLLADLFKTEDDQAQIGIYMPTFRYELEDKSIMEKIKERNFFAFRDF
FT                   DVEKLNTELKKRHQYLIVKLHPYEMRLFANFKSSYSNIAFMNNDYLFDHNYDLYELLGD
FT                   TDFLMTDFSSIYFDYLHLNKPIVFVTNFLEQYEKTRGLLMGPYAEITPGICVNSEDELI
FT                   RNLDQLDNQQIANRRLYWLHLTNQVHGDSYCENVFKYMTQEYRG"
FT   CDS             524443..525873
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00523"
FT                   /product="Capsular polysaccharide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00523"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49970"
FT                   /db_xref="GOA:D5H1T5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T5"
FT                   /protein_id="CBL49970.1"
FT                   /translation="MRKTFLNILYNAVYQIFIVLVPLITVPYLSRVLGPKTYGIYSSVN
FT                   NTVQFLMIFCILSVSYVGMRTISRARTYGTPQELTNAFWGLWYFQGIAGIITILVTVFV
FT                   ATVFHVQYWFYILLMVPYLISAQVDISWFFQGLADFGRVVLKNTAVKLVSVVLILLWVK
FT                   SPADLWKYLLIMSVSTMLGSFVFWFDIRRYVGKPVAHFYKFKQTAIAIGTLMIPQIATQ
FT                   IYTSLDKPILGWFSNSTQVSFYDNSQRISNMILGVITSISLVIMPKMASEGKKAQKIVM
FT                   KKSLEATVMLGTLFAVIIMANTKQFVPFFFGNKYVPMTPLMFWFTLTIIMIPTGGVFAN
FT                   QFALANQRDKDYAVPVVIGAILEIVLSYLLDRPYGAVGAMIAILITEAVVLILRLWVVR
FT                   DGYEFSYVFHDVPKYLLIAVLTVAIGMFMPNIIPSAFFNMAFKSIVMLIIYLTLMFLFK
FT                   LDFNDDIVKLIKNFLKRG"
FT   CDS             525876..526574
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00524"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00524"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49971"
FT                   /db_xref="GOA:D5H1T6"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T6"
FT                   /protein_id="CBL49971.1"
FT                   /translation="MIPKKIHYVWVGHNPKSPIIEECIATWKKKLPDYQIIEWNEDNFD
FT                   MHENRYIEQAYAAKKWAFVSDYVRARAIYEQGGIYLDTDVRVVDKLDSLLNDSAFIGFE
FT                   NHDYLSAAIFGAEKGHPFIQDILDYYQDRDFEYDTKNQMAGVNSISVTEILVNKYGLKL
FT                   GNQEQVLKDGIHVYSDGVLCNPSKDSKSIHLFTGTWMDGKKSFKHDLVTFLKRHISTPK
FT                   QAGMYAKIFR"
FT   CDS             526634..527092
FT                   /transl_table=11
FT                   /gene="sprL"
FT                   /locus_tag="LCRIS_00525"
FT                   /product="SprT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00525"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49972"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T7"
FT                   /protein_id="CBL49972.1"
FT                   /translation="MNENELQNLVEEISLKYFDRPFKHRVKINRRMTTTGGRYHLDDYH
FT                   LEINAHFLVPQYHDYLVGIIKHELTHYHLHLLGLGYRHRDRNFKILLKKVGGSRYAPDI
FT                   GLRKKKKYRYLYFCENCGLRYPRMRRINTQKYRCGKCRGHLRLAQTFA"
FT   tRNA            527169..527253
FT                   /gene="tRNA-Leu"
FT                   /locus_tag="LCRIS_02080"
FT                   /product="transfer RNA-Leu"
FT   CDS             527339..527986
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00526"
FT                   /product="N-acetylmuramidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00526"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49973"
FT                   /db_xref="GOA:D5H1T8"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013338"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T8"
FT                   /protein_id="CBL49973.1"
FT                   /translation="MARKRKSRVPKSVKTVVRVFVILFILMVAFVGFRYYRRYAIQSEQ
FT                   IRQAQLQKEQEAAKLLKQKKDFIKKIGPIAREVDKSYDLLPSITIAQACLESNYGQSDL
FT                   SQKYNNLFGVKGSNPNTSAVMTTKEYVKNKWVTVKARFQIYDSYEASIRAHARLFQNGT
FT                   TWNHDQYKHVLASKDYKTQAKALVTDGYATDPDYADKLINLIEQFDLEKYDK"
FT   CDS             528072..530318
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="LCRIS_00527"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00527"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49974"
FT                   /db_xref="GOA:D5H1T9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1T9"
FT                   /protein_id="CBL49974.1"
FT                   /translation="MSEKSILAGLNPQQKEAVETTEGPLLVVAGAGSGKTSVLTRRIAY
FT                   LVEENHVAPWNILAITFTNKAASEMREREQKLLGPAANDIWMSTFHALCVRILRRDADK
FT                   IGYGHNFSIADSAEQLTLVKHIEKDLNINPKMYDPRGILAAISNGKNDLLDPEAFMQSA
FT                   SSPFEKMAAKVYEEYQRRLRRDQIMDFDDLIMQTLVLFKKDSEVLHYYQNKFRYLLVDE
FT                   YQDTNQAQYELCHALAAQYKNICVVGDADQSIYGWRGANMENIMNFEQDYKKYDVKTVK
FT                   LEQNYRSTGHILSAANSVIKNNQNRKAKNLWTDQGDGQKVTYYQAQSGDDEAHYIISKI
FT                   QEEVKDKKRAYKDFAILYRTNAQSRTVEEAFVKSNIPYQIVGGHKFYDRKEIKDVMAYL
FT                   KLVANPADTMSMNRIINTPKRGIGAATVDKLITFADENHYNILDAMGHVAESSINTRAA
FT                   KKLSDFGTKLRDAITYAQNGTVTGLTEKILTDFDYTDALRAENTIESETRLENLDEFLS
FT                   VTKRFDDHYEPEEDESNPLSDFLAEVSLLSDQDDLDEDDNQVALMTLHAAKGLEFPVVF
FT                   LIGMEDGLFPLQRAMMDDNELEEERRLAYVGITRAKQELFLTNAYSRMMYGRMQNNPPS
FT                   RFLDEIDEQDLHKEENEKLQSSFIQSSFEKQTAPFARKAERARAEVYTAKKASGAIGAE
FT                   RKGWNVGDQVEHKAWGHGVVTKVNGTGEDMELDIAFPGKGIKRLLAAFAPIKKV"
FT   CDS             530353..532359
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="LCRIS_00528"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00528"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49975"
FT                   /db_xref="GOA:D5H1U0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U0"
FT                   /protein_id="CBL49975.1"
FT                   /translation="MAEITLDEAKKEAASLRKQLNEWAEAYYSKDAPEVEDNVYDQSYN
FT                   RLLELEKEFPEIVTPDSITQRVGGQIDSDFTKVEHPIPMLSMGDVFSKAELKDFDQRMQ
FT                   KLVGHPVEYNVELKIDGLSLSLEYENGKLVRASTRGNGYVGEDVTANAKYISDIPQTLP
FT                   EPLTTEVRGECYMSKEAFAKLNAEREEQGLAVFANPRNAAAGSLRQLDPKVTKKRQLST
FT                   FIYTWVNPPEEITSQHQAIQKMHDLGFHTNETGRKLKILDEVFAFIDEYTAKRNSLTYG
FT                   IDGIVLKIDDLGIEQELGNTVKVPRWEIAYKFPPEEQETVVRDIVWTVGRTGVVTPTAV
FT                   MDPVQLAGTTVARASLHNPDYLNEKGIRIGDTVKLHKAGDIIPEISEVVMAKRPADSVA
FT                   YQIPTTCPSCGQKLVHLEDEVALRCINPSCPAQVEEGITHFASRPAMNIAGLGPKIVKQ
FT                   LIAKDLVHNVADLYHLTADDLAQLDHFKEKSINNLLTALDNSKQNSVELLITGLGIDHV
FT                   GAKAARLIAQKFKNLAKIMSLDVQEIASIDTIGMTIAESMTTYFAQPEAQKVIDELRES
FT                   ALNMDYLGADEPAEIEDNPFKDKTVVLTGKLEHYTRSEFTKKLQALGAKVTGSVSHKTD
FT                   YVIYGKDAGSKYTKAQTLGVPLLTEEEAIAQIE"
FT   CDS             532372..533520
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00529"
FT                   /product="Sex pheromone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00529"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49976"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U1"
FT                   /protein_id="CBL49976.1"
FT                   /translation="MKKYLQVMALAGIALTLSGCGKLKDSSLANNATTTSTTKKKSYQT
FT                   TNTGTNGYTVLMKNGRYNISPIAGLTATDNDNSVDTRELERGLIQISKNQFSPNQYVFQ
FT                   EGQYLDTSTVTDWLMRKSKSNPDGLNPVNNGKTGTDTRNPIYLEEIIEQDYLTGSGSKY
FT                   NLGGMSLGLAMNSVDYYQKKRNGAEFQTTISRAEQKAQGEKIANEIVARLRKKKALKNI
FT                   PITIGLFSKTGKDSLVGGTYFAYGTAAANSSKISKWKSMSEKMQVLPTTGSEKAINSDD
FT                   ASHFNDFKTAIQNYFPNISGVTATLRYTNGKLSQENISVTTQFYGYEQIQSFTRLVLSS
FT                   AKKYLSGNIPIEIKIGSVDDVQALVAKETGDSDYQVHVYGGE"
FT   CDS             533532..533840
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="LCRIS_00530"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49977"
FT                   /db_xref="GOA:D5H1U2"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U2"
FT                   /protein_id="CBL49977.1"
FT                   /translation="MEITKDTIKHVATLSRLAFNEEELDKFTDQMGSIINMADQLSEVD
FT                   TEGVDETVQVVDRDTVFREDKPEHWQGQDRETLMANVPEKANGYIKVPVIINKDEDE"
FT   CDS             533840..535279
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="LCRIS_00531"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00531"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49978"
FT                   /db_xref="GOA:D5H1U3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U3"
FT                   /protein_id="CBL49978.1"
FT                   /translation="MNYLNENIDSLNKKLASGDLSADKLAKDTVANIKDTDKKLNAWIT
FT                   VLDDAKPADNLDYSKSKLAGIPIAIKDNIITNGIKTTAASHILYSYMPMYDATVISKLK
FT                   KAGVTFVGKTNMDEFAMGSSTEHSYYGATHNPWNLDKVPGGSSGGSAAAVASGQVVAAL
FT                   GSDTGGSIRQPAAFNGIFGIKPTYGRVSRWGLIAFGSSLDQIGVMTKRVKDSAEVLNVI
FT                   AGADEHDSTVSTREVPDFTKFIGQDVKGLRVAVPKEYMEAVDGKMREVIQKQIDALKDA
FT                   GAVINEVSLPHTKYVVPDYYIIASSEASSNLQRYDGIRYGYRAKDTKNLLDVYVKSRSE
FT                   GFGAEVKRRIMLGSFALSAGSYDRFFRQAAKVRTLICDDFDKIFAENDVIVGPTTTEPA
FT                   FGIGEEVSDPIKMYNNDILTISANLAGIPAASVPAGLVDGMPVGLQVMAKRFDEGNVFK
FT                   TADFIERTNKFYEKTPTGMED"
FT   CDS             535284..536714
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="LCRIS_00532"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00532"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49979"
FT                   /db_xref="GOA:D5H1U4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U4"
FT                   /protein_id="CBL49979.1"
FT                   /translation="MNFKSTIGLEVHFELKTKSKIFSPSPVTYGAEQNTETNVIDWAMP
FT                   GTLPMVNKNVYRLGIMVAIATHAHILPTTHFDRKNYFYPDNPKAYQITQFFQPLARDGY
FT                   IEVEVRGKKKRIGIHEMHIEEDAGKNTHGTNGYSYVDLNRQGVPLLEVVSEPDMEDPEE
FT                   AYAYLEKLRKIVQFTGASDVKMEEGSMRVDTNISIRPAGQKELGTKVEMKNLNSFDHVR
FT                   RSLAYEEKRQEQVLLAGGHIQLSTRRFDEATGKTVLERVKEGASDYRYFPEPDIAPDHI
FT                   SQEWIDQIAKELPKSPFDRYDDYVNKYGLKPYDANVLLQTKESSDFFDEAVAAGADPTL
FT                   AANWMNTQVNGYLNDHRIELKDIKLTPEHLAEMIKLIKDGTISSKIAKKVFAETIENGT
FT                   DPKKYVEDNGMVQLSDTSVLAPMVKKVVDDNPQSVEDFKNGKDRAIGFLVGQIMKQTRG
FT                   KANPKMVNKLLNQELQSR"
FT   CDS             536739..537659
FT                   /transl_table=11
FT                   /gene="dagK"
FT                   /locus_tag="LCRIS_00533"
FT                   /product="Diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00533"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49980"
FT                   /db_xref="GOA:D5H1U5"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U5"
FT                   /protein_id="CBL49980.1"
FT                   /translation="MTRKARLIYNPVSGHEQMPKNVADILDVLEQAGYEASAFRTTPEE
FT                   NSARNEATRAAKEGFDLIVAAGGDGTINEVVNGIAFLENRPKMAIIPAGTTNDYARALA
FT                   IPRDNIPDAAKVILKNKTRKMDIGKAVFGDQIQYFVNIAASGSLTELTYGVPSEVKSAL
FT                   GYAAYLIKGAEMLPHLTENEMRLTYDDGVYEGKLSMFLLGMTNSIGGFEQVMPDAQLSD
FT                   GLFQLIVVKPSDPVSMMKLMALALNGKHVDDPNIIYTKTRSLKAELIGKSEGQDLPVNL
FT                   DGEIGGYCPVEFNNLQQHIEFYVGG"
FT   CDS             complement(537729..538439)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00534"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00534"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49981"
FT                   /db_xref="GOA:D5H1U6"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U6"
FT                   /protein_id="CBL49981.1"
FT                   /translation="MDNFSNTPGRRQVQDISAVNSFLTKMYSLMILAVLVSAATAFLTT
FT                   TVFASAIANMSQAVYWIIVFVPIVLCMTISFKAAKNPTLGIVLLLILSAVYGFEFAFIA
FT                   GAFTSASIAGAFLSAAGVFAAMAVFGSVTKRDLSNWGSYLGAALIGFLVAWLVNAFFIR
FT                   SGAATFIFSCIGVLIFTGLTAYDAHNAKKIFMTYGGQVSDTGLAVMGALSMYLDFINIF
FT                   MFLLQIFGMGGDRD"
FT   CDS             538964..539062
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00535"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00535"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49982"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U7"
FT                   /protein_id="CBL49982.1"
FT                   /translation="MVRTMMVDSGYTGQNFANEISSLTSAKVIVVK"
FT   CDS             539509..540426
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00536"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00536"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49983"
FT                   /db_xref="GOA:D5H1U8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U8"
FT                   /protein_id="CBL49983.1"
FT                   /translation="MTTAIIELDHLQKNFGKFAALKDVSFTLAPGQVLGFLGPNGAGKS
FT                   TTIRVILGLLKKSGGSVTVFGKDAWRDDAAIHPRIAYVPGDVYLWPNLSGGEIIDLLLR
FT                   LNGRQHNQKTDELIKAFEFDPKKKARTYSKGNRQKVALIAALSQDADLYIFDEPTSGLD
FT                   PLNEQTFQQEVLKLKRAGKSVLLSSHILSEVERMCDSIVIIRDGSVIESGNLDQLRHLS
FT                   RIKIEVTTATPMTALAKQAGVHDLTYRDSEHTKAVFTADRDALGTIMTTLAANTVVDMQ
FT                   STPPTLEELFLRYYGKQGETHAAQ"
FT   CDS             540413..542029
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00537"
FT                   /product="Exporter of polyketide antibiotics"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00537"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49984"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1U9"
FT                   /protein_id="CBL49984.1"
FT                   /translation="MRHSNRNAGYLLRANLKQNLKFSLIWLVILIMMIASGAGKLEAAF
FT                   AGGASGSKEIVKMLQAPGMAAMFGAMPKVDTYNTAIVFAGVMVVFMIILQALWVMPLMI
FT                   RNTRGQEESGLLEMVRARNVGRTAAITAASLELLIDSAIMGILYFVSLAAVNMGGTDLY
FT                   GDFLFSLGMVIANLLFGAIALLFAQLTNNTRTANMLSYMVLTAAYLVRLVTDIQHQNLT
FT                   WLSPIGWFEKANFYTDNNVWALGLALLVSILLAASATMIARNRDLGAGIIAERTGRAKA
FT                   AGWLRSIPALLWRTERGLFAGWLIGAVVFGGVMGSVLGGVGDILKTNPLYRKILDVGQI
FT                   NAANQTMVLSFLGMYLGIFVALAVTAGVQVAFRLKRDDNLGYLSVIHAEKPTRTTISVS
FT                   YYCFGLLAGVFVLSAGLLALFFTGNTVLSHPLPLKYLGRLFVASVPAVISFIALGIALV
FT                   GLWPRLSSLFWLYMGAGLIVQIFRGLFDLPKHAGNFTPFGWIANVPVENVDQTWLIVMV
FT                   VSAIVLFILGIAGYRRQDLSL"
FT   CDS             542026..542664
FT                   /transl_table=11
FT                   /gene="rutR"
FT                   /locus_tag="LCRIS_00538"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00538"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49985"
FT                   /db_xref="GOA:D5H1V0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V0"
FT                   /protein_id="CBL49985.1"
FT                   /translation="MKNVVTDPEKVTRILKTATEIFGQQGFIKSKTDQIANQAQVSKGL
FT                   LFHYFGNKQALYLDAFKYAYHRIYDHMDPKKWQNAPGLAAMMTTAVKYELKLQFKFPAE
FT                   YRLMMQAYADLPHFPEPLRQQVQQETTAISAETDRIFREKIEQLPRREGLSVDDVFGVV
FT                   SALIAQQTAVTTRLIASGHYRKFEDLQSVVETMARQLLIVEHGFLPDES"
FT   CDS             542781..543368
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="LCRIS_00539"
FT                   /product="Resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00539"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49986"
FT                   /db_xref="GOA:D5H1V1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V1"
FT                   /protein_id="CBL49986.1"
FT                   /translation="MAKIGYARVSSKEQHLDRQLAALKDVDKLFTDKLSGANTNRPELQ
FT                   KMLAYIREGDIVMVTELDRLGRNNHDLTKIMNSIQNKGATLDVLNLPSMTGIADPNLRQ
FT                   LMTNLIIELYKYQAESERKRIIERQQQGIALAKQQGKYHGRKPQYAKDDPRLQHAFKLY
FT                   RAGMSDIDVSRNTGIKRTTFIRYRVKYGIKRK"
FT   CDS             543441..544157
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00540"
FT                   /product="Phage Mu protein F like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49987"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V2"
FT                   /protein_id="CBL49987.1"
FT                   /translation="MLANASPSDKLSKRLQAIFAQASISRRDMLGAMIGAGMNIATAKS
FT                   ESFAVNELKQQYIDGYNNSSPNKLSTVPDKVANQAEYSQRIWVHGDVMTTRMKETLNKG
FT                   LSRRMKKSDINKMTRSIPQSGDRIDDNLTTPMNQMLSRIHTLTTNEAIRNSNGGKNRAY
FT                   DEQNVQYVMWLTEEDDRVCDICEPLDRQTFAYGQAPIPVTDTHPRCRCQLVACDEDGNL
FT                   LSGELDRVFKEQKKPT"
FT   CDS             complement(544276..544524)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00541"
FT                   /product="Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00541"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49988"
FT                   /db_xref="GOA:D5H1V3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V3"
FT                   /protein_id="CBL49988.1"
FT                   /translation="MHWLWVLIIGAIIGAIAGAITSKGKSMGWIANIVAGLVGSSIGEA
FT                   ILGSWGPQLAGMAIIPSIIGAVIVVAVVSFFVGKSKN"
FT   CDS             complement(544887..545807)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00542"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00542"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49989"
FT                   /db_xref="GOA:D5H1V4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V4"
FT                   /protein_id="CBL49989.1"
FT                   /translation="MGTSTLSRFQRGALAQLVNEGNKSYQVMADALGVAKATISYELDR
FT                   VKPYDPELAQQDADRKRRNCGRRSMLTAALATLITNHLRLTWSPETIAAAYNLSTASIY
FT                   NWLNRGWLPFKLTDLPNRNVRQHRVSENRGKFTSGTSIEQRPTTVNQRLAFGHWEVDTV
FT                   LSSRSESRSCLVTFVERKTRLLWAIKAPNRTAKALNTAFGKFMGAFGPQVKSITVDHGK
FT                   EFANYQALEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFSQVTTDEILAAL
FT                   ELINQRPLKIHHQQTAIERFRACSD"
FT   CDS             545952..546236
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00543"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00543"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49990"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V5"
FT                   /protein_id="CBL49990.1"
FT                   /translation="MKYQLEYDKLALTEPFYYEERGEWLDCLQIWLRFSPIFTVPKGDT
FT                   PIEVPLNLKDGTKKMLSDLVRVAFDGKNLLLRTFKILWFNMKLLHTVEV"
FT   CDS             complement(546375..546749)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00544"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00544"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V6"
FT                   /protein_id="CBL49991.1"
FT                   /translation="MNKQEFDPNLVTQFLNQYQDRGMMKWQGFYLSDHTASLNKVDRED
FT                   EIKLNRRHSEQMALNEIESCLSQALEKSQVVRVERSLQDQNGYVAPFIEGKIEGYYQDK
FT                   LMIGGEFIAINEIYAISLMK"
FT   CDS             complement(546742..547065)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00545"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00545"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49992"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V7"
FT                   /protein_id="CBL49992.1"
FT                   /translation="MKINATNDNGLLAAYAITLFRDKWQGEAVRNISISCAGLVDDNVV
FT                   QLNLFDTKYKTLKNRNLDRTVDDIRKKYGFTSLIKLSSKSVGATAVQRAGLVGGHAGGN
FT                   SYE"
FT   CDS             547215..547838
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00546"
FT                   /product="Transposase ORF_A"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00546"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49993"
FT                   /db_xref="GOA:D5H1V8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V8"
FT                   /protein_id="CBL49993.1"
FT                   /translation="MKANQVMEILQISRSTLKRYREKGFINAVQKPTGQFEFDDDSVWL
FT                   FKNKHTPRQTILYGRVSTYKQKHDLANQMQELRDFAENKGYHVDNSFSDIASGISFKNR
FT                   KQFFKLLDLVLAGKVERVIITHQDRLSRVGFELFEYLFKNYGTAIETISNELNPKTDEE
FT                   ELFEEIISLLHCFSMREYSHRRVERKLIESTLNQKGGEKDGKKE"
FT   CDS             547822..549150
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00547"
FT                   /product="Transposase ORF_B"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00547"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49994"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1V9"
FT                   /protein_id="CBL49994.1"
FT                   /translation="MAKKNKQVPRNDLQYEQLASEYLIKANPKLDEYSLVAHNLYNRAL
FT                   FDLRQGFFKKRYIKGYSQLDQIFKERYQKRELMLYHSLGYVQSAQQTLREVTTVWQAFF
FT                   KALKAYKANPSKFSGKPRLPRYLRDKRHTFFVTNQNAKVKDGYLIVPKLDLKLKLAPNI
FT                   EKIGRVAFKPVANGYKVIVPYKANKEIKYLPDNGKYIGIDPGIDNAFACASNTGNRPLL
FT                   INGRGIKSVNQYYNKKRAELRQLQARHHQLERIINTKQGKKVVYQDTQAMKKITAWRND
FT                   KIRQFAHKASKRIVDYALNCEANTIVIGKNKSWKRSSNMGKRNNQNFIGIPHQVMIDMI
FT                   KYKANLAGITVIQTNESYTSQTSSLDHEQPCWENGNKSRKRQGKSPVNRRIKRGLFKAN
FT                   DDRLINADINGALQIIRKVFSNFQVNDEIAGVVLRPVKWSPKF"
FT   CDS             549382..549729
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00548"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00548"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49995"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W0"
FT                   /protein_id="CBL49995.1"
FT                   /translation="MEKRYIDNDIRGQRSEYPDKIGEFRRETILSFTPEAAEKYHQLTS
FT                   SQKTFIDRELDDLKFNQDTTINKKVNAELDQAIVFERNDHEIIITDIVAQPTRDSQEYR
FT                   RAQIRMDRQNH"
FT   CDS             complement(549704..550372)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00549"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00549"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49996"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W1"
FT                   /protein_id="CBL49996.1"
FT                   /translation="MPWIKAICNWVKHSYCRLAVAVISSGIIYFTWLSFYDHFVLSGPE
FT                   ATHWYLLDRIFISFLIFGLYGGLSWNFHHEIQTFLFKYWWLIVGFYLLTYFRTRDLFLA
FT                   TFKLTDLTNDSYYLPSMAIYALAVILLIYLICIAQKVFNMNYWLKSIHFLAFYAYRAFL
FT                   ANVFWDRIFWQYFNFKQLALQNIYLAVLLLWICTWCASYLSVYVVHHLWLKINGSVGPS
FT                   "
FT   CDS             complement(550442..550738)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00550"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49997"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W2"
FT                   /protein_id="CBL49997.1"
FT                   /translation="MLQPIITLFLTLPFDHSQQLFLVSLYNLVKFTSPAFIFGIVFTVI
FT                   RKNDQQAKLPLKSYFSDQWDNNFFPTFAWTLFYLIAMPNLQQHGHFHNVASFI"
FT   CDS             complement(550823..552196)
FT                   /transl_table=11
FT                   /gene="nhaC"
FT                   /locus_tag="LCRIS_00551"
FT                   /product="Na /H antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00551"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49998"
FT                   /db_xref="GOA:D5H1W3"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W3"
FT                   /protein_id="CBL49998.1"
FT                   /translation="MKKKKVSFTESIIILIALLTILGLAVIKLALSPEVPVLFIVLLLT
FT                   FWARLRGFSWQDVQDGIKEGISVAIIPIFIFILIGALIGIWIKAGIIPSIMVLGFHLIS
FT                   GSFFVPSVFIVCSIIGMAIGSGFTTISTVGIALFGIGTSMNLNPALVAGAIISGAVFGD
FT                   KMSPLSDSTNLSSAVAESELFAHIKNMMWSTIPAFVVSLILFWILGNSGNMDPTKIERT
FT                   SHILQTNFSISWWAIVPIILMIFCAWRKISAIPTLFLNIAITVIMIFIQSPHESIQSLN
FT                   NLVMNGFVAKTSDASVNALLTRGGISNMMATVALIISTLSLGGMLMKFNIVQSAMEPLV
FT                   KHLTKPGRLITVTILSGICINLFVGEQYLSVILPGRAFKPAFDKIKLSPLALSRVLEDG
FT                   GSVINYLIPWGVAGSFAASTLGVPVLHFLPFVFFSLLSPIFSILSGITGIGLKWAKEK"
FT   CDS             552597..553631
FT                   /transl_table=11
FT                   /gene="pbp1"
FT                   /locus_tag="LCRIS_00552"
FT                   /product="Penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00552"
FT                   /db_xref="EnsemblGenomes-Tr:CBL49999"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W4"
FT                   /protein_id="CBL49999.1"
FT                   /translation="MHKKRALSIFLALCAFAIFLFIVQPGDKLDNGIKNQKEQLHDYMK
FT                   FHHINGVMLINDKKGQPIVVQNKETTDSSQIVNANQLFPIASLQKIMTGTAIYQLQQEK
FT                   LLGWNTSLSNYYPQVSGSKDITIRELMNHTSGLVNNARPSSPLKNQKEQIAYMLNHMEN
FT                   DHLHTWDYQDVDYELLAAIISKQTNLSYNAYIQTDFAKPLKLQKVKDFSEVNQNEIPQP
FT                   MSKNVDWHQVTVTTSSDFGAGNLFMSPIDYWKFVYNDVLKNPKMVNEYYHQAQHQTVAY
FT                   FGGVYFNGDIIRANGSIPGYNCCFVANYKTKRMIMLFSNNINYLRLKVAANHILHAYMG
FT                   DSWF"
FT   CDS             553715..555064
FT                   /transl_table=11
FT                   /gene="rumA1"
FT                   /locus_tag="LCRIS_00553"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00553"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50000"
FT                   /db_xref="GOA:D5H1W5"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W5"
FT                   /protein_id="CBL50000.1"
FT                   /translation="MKKNQIIDLEITDLSYEAMGVAHYEGMTVFVTNALPGEVVSAKIL
FT                   KVKKNFAFAKIEEIKKESPDRVKIKLNQWVQTGLASLAHIKYDKQLEFKRNQVVNLLKK
FT                   AHLDEIEVGQTLPSPEQTGYRNKAQVPVREYNGQLEIGFFRRHSHDLVPLTNFFTTDPE
FT                   IDRVLVAVRDVLRKYKIAPYDEVNNTGIIRYLDVRRSKANGEIMVILVSRVKDFPQMTG
FT                   VAAEISQIPKVSGLVLNYNPKKTNVILGKKDYLVFGNDQITDQIGDLKFRISPQSFFQI
FT                   NSLQTPRLYDLAIKQADLGSDDVVIDAYSGIGTIGLSVAKHVKAVRGIEVVRDAIKDAK
FT                   DNAELNGIENAKYYLGKAEEIMPRWAKKGMKTDVVFVDPPRKGLTPEFINATVKTGPKK
FT                   VVYISCNPATMIRDLLLFQEQGYEFKRIDPVDMFPQTPHVEAVTVLTKKK"
FT   CDS             555067..555567
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00554"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00554"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50001"
FT                   /db_xref="GOA:D5H1W6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W6"
FT                   /protein_id="CBL50001.1"
FT                   /translation="MIIKPLISEDEAKQTSKLFQTTWQETYKGVLPDVFLDNIPATAWV
FT                   KRLNESGRHNLVFKDDNNEVQAAVSYGRPRDTRMLGCGELMALYVKPDFQGYNVGKTLL
FT                   NAAENELKKMGYGKIYLWCLAEDKDAQEFFKHFGWRNIATQRFIEIAGKEYKYLLFQKN
FT                   LHS"
FT   tRNA            555658..555747
FT                   /gene="tRNA-Ser"
FT                   /locus_tag="LCRIS_02081"
FT                   /product="transfer RNA-Ser"
FT   tRNA            555752..555825
FT                   /gene="tRNA-Asp"
FT                   /locus_tag="LCRIS_02082"
FT                   /product="transfer RNA-Asp"
FT   CDS             555801..556022
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00555"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00555"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50002"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W7"
FT                   /protein_id="CBL50002.1"
FT                   /translation="MGSNPIWTVDGGIGEGVNTLVCGSSMRGFDSHIPPHNGGLAQLGE
FT                   HLPYKQEVTGSSPVSSIFFYSKALEIFV"
FT   tRNA            555832..555907
FT                   /gene="tRNA-His"
FT                   /locus_tag="LCRIS_02083"
FT                   /product="transfer RNA-His"
FT   tRNA            555912..555984
FT                   /gene="tRNA-Val"
FT                   /locus_tag="LCRIS_02084"
FT                   /product="transfer RNA-Val"
FT   CDS             556055..557521
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00556"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00556"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50003"
FT                   /db_xref="GOA:D5H1W8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W8"
FT                   /protein_id="CBL50003.1"
FT                   /translation="MNKKQITMVTAALMLGNVMSGLDGTIINTAIPAIVAALHGIQFMG
FT                   WIVAIFLLGMSISIPIWTKIGEKITNKRAFELSLLLFVLGSALQGIAPNIIFFLCSRFI
FT                   MGIGAGGMGSLPYIIAGYVFKNIKTRTKVLGYLTASWNGAAILGPLVGGWLIDAFSWHW
FT                   VFYINIPIGLIAFLICLIYYKPVTPKKTPVFDIPGATLLVIGLLLFLMGVQLVGLTASW
FT                   IIIGLIIISLVFIVFFFIREGHADNPIIPISLFKNKDLDGDFLLFAFTWGAFLAVNTYM
FT                   PMWAQALLGLSALIGGMTLIPNSIVEIIASQSVAAIQEHMTTFKLVLIGIVAMIISSAG
FT                   LFISGIHTPVQMLTFIGAFSGIGVGFIFVALQLKVQLDAGLKNMATATSTSYLIRILAQ
FT                   TVMAAVYGVIMNLNLASGVQMHKGITMTMMNKLSDAQSAKSLPQNLVPTMRTIFHGGIK
FT                   EIMLVSLILLIIAFVMNFYFNFGKKCKKLQ"
FT   CDS             complement(557564..558076)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00557"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00557"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50004"
FT                   /db_xref="GOA:D5H1W9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1W9"
FT                   /protein_id="CBL50004.1"
FT                   /translation="MNMKSLHTQQQIEHALFKLLQKKPYTEISIAEITRKAKVSRTSFY
FT                   RNYDQKDEVIAQFLFNQYHNFIADIDQHNLRTFKQQLTAYLEFFKDNPQLMKLLLDAGF
FT                   EGELLNFQTKYLKKLMSVYHSDVHLPDYAIAYQSGGIYMLLVWWVKQNYQTSLTDLITY
FT                   AEKHIML"
FT   CDS             558182..559954
FT                   /transl_table=11
FT                   /gene="mycA1"
FT                   /locus_tag="LCRIS_00558"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00558"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50005"
FT                   /db_xref="GOA:D5H1X0"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X0"
FT                   /protein_id="CBL50005.1"
FT                   /translation="MHYSNGNYEAFVKADKPKDVDQKSAYIVGSGLAALATAVFLIRDG
FT                   QMKGEKIHIFEELGLPGGSMDGIYNKEKESYIIRGGREMEPHFECLWDLFRSIPSPDHE
FT                   GESILDSFYRLNRKDPSYAKTRVIVNRGQALPTDGQLLLTPKAVKEIVDLCLTPEKDLQ
FT                   NKKINEVFTKEFFESNFWLYWSTMFAFEPWASAMEMRRYLMRFVQHVATLKNLSSLRFT
FT                   KYNQYESLILPLVKYLKDRGVIFHYNTVVDNIFVNRSDDEKVAKQIILTEDGEKKTIDL
FT                   TPNDLVFVTNGSITESTTYGDQLHPAPAEHELGASWQLWKNLAAQDEDFGHPDVFCKDI
FT                   PKANWRMSATITFKNDDVVPFIEAVNKKDPHSGSIVTSGPTTIKDSNWLLGYSISRQPH
FT                   FKAQKPNELIVWLYGLFSDTKGNYVEKTMPDCNGLEMCEEWLYHMGVPEERIPEIAAAA
FT                   TTIPVHMPYITSYFMPRALGDRPKVVPDHSKNLAFIGNFAETPRDTVFTTEYSVRTAME
FT                   AVYTLLNIDRGVPEVFASAFDVRMLMNAMYYLNDQKKLADLDLPMPEKFAIKGMLKKVK
FT                   GTYIEELMKKYKLM"
FT   CDS             560314..560784
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00559"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00559"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50006"
FT                   /db_xref="GOA:D5H1X1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X1"
FT                   /protein_id="CBL50006.1"
FT                   /translation="MKAFPAWERFSMFSLLAMSLHRNVKFHAIYNDGQFCGITYYAEND
FT                   NTVYLTYLAINEKLRGQGYGSKILMMLEDRFPDKQIVIDIEPVTKKAKNYKQRVSRLKF
FT                   YERNGFHRTDRKLVDPDGEFEALTTGKKLDIDSFTRMLKQMSFGFYQAKVEK"
FT   CDS             560948..561784
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00560"
FT                   /product="Oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50007"
FT                   /db_xref="GOA:D5H1X2"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X2"
FT                   /protein_id="CBL50007.1"
FT                   /translation="MQDYVILNNGVKMPRLGFGVYQIDDLAQTQQVVENGLEVGYRLVD
FT                   TAQIYGNEQAVGDALVHSSIPREDIFVTSKVWVDDYGYDQTLKAFDDSMKKLQLDYIDL
FT                   YLIHKPYNDYYGTWRALERLYKEGRIRAIGVSSFWNERLADLITFNDVKPAVNQIETNV
FT                   WNQEWKSQQYMEKEGVQPEAWAPFAEGANHIFTNPVLQKIAEKHHKTTAQVMLRWFLQR
FT                   NYVVIPKSIHKNRLMENFDVFDFELDDEDMALIKTLDQGYSVLEDEMDPEIAESFR"
FT   CDS             561865..562137
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00561"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00561"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50008"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X3"
FT                   /protein_id="CBL50008.1"
FT                   /translation="MKKIGLIGTIIGVAGAIGAAAAIVYKKIKEKQVVVNTPQDKTLLL
FT                   GNTTSDTKSELMKAELSEKDQVETNNTEIPHVSLDDDKPRIFEDK"
FT   CDS             complement(562190..563722)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00562"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00562"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50009"
FT                   /db_xref="GOA:D5H1X4"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X4"
FT                   /protein_id="CBL50009.1"
FT                   /translation="MDFLNFKAITQTGNFKTPSENENIEYKEASWKLPKSFWETVSSFA
FT                   NTSGGIIVLGIAEDKSKHEFSITGVDNVEDIETQIFNDNNNISCLNRPVIQNNDVQISF
FT                   FQNKTIIQVIIHPEPFNTRPITAFGKAYIRTGDGDQVATKEQLKYFTVESQSEINTHLL
FT                   PSTYTIEDLDAESIKEYRKIIEEKGIINTNSQLSDQDFLYSIGVFRKDRLSNSNEYHLT
FT                   DSGLLFFGKYISITDRFPRFQLDYQQYNSDNSTNWNDRVSAGDMNYPTLNIFSFYNLVL
FT                   AKIETNIPDPFIQGSDLSRTSYHNDLIIAAKEALVNCLMHSYYDGMVGVKIVDRPSYFE
FT                   FTNPGTMRVSKESFLRGQYSSIRNTEIASLFRRIGVSETAASGGPRILNTVLQNNLNDP
FT                   EINIDYEINTTRIRIFKTFAIDNQEKLTEPEKFIMSFASRNPNFSINDIVKDPQNHFGK
FT                   QTTIRKYVNSLVEKHLLSNEKIGKKYIYNLQKNNDYLNRVKHLKHLEDNLLK"
FT   CDS             complement(563909..565240)
FT                   /transl_table=11
FT                   /gene="uraA"
FT                   /locus_tag="LCRIS_00563"
FT                   /product="Uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00563"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50010"
FT                   /db_xref="GOA:D5H1X5"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X5"
FT                   /protein_id="CBL50010.1"
FT                   /translation="MNKKEKYRNPEAVLDVYEKPEFGQGVLLSLQHMFAMFGSTVLVPI
FT                   LIGINPSIALLSSGIGTLVHMLLTHFKIPAYLGSSFAFVATMQALMKADGYPAVAQGAI
FT                   ASGLVYVVVAIIISKIGSGWVNKVLPPIVVGPIIIVIGLSLATTAANDAMMNNSKYDLT
FT                   YFGVAIFTLVMTLVFQMCFKGFTSLVSIMLGIICGYILSCCLGIVDFSGVEKAAWFTLP
FT                   ALDVPGISYHFKWYPAAILAMAPIAFVTMTEHMGHIMVLNSLTKRDFFKNPGLHRTMMG
FT                   DGLSTIIAGFIGGPPTTSYGENIGVLAMTKVYSVWVLAGAAVSAIIFSFVGKLAALIES
FT                   IPMPVIGGISFLLFGTIASNGLKILVDDQIDFGEKRNMLIASVILVIGIGGAYLQLGNF
FT                   QLTSVALSTIIGMLLNWILPKKAASEKAQEEKIKQEKQEGKIYQ"
FT   CDS             complement(565252..565779)
FT                   /transl_table=11
FT                   /gene="pyrR1"
FT                   /locus_tag="LCRIS_00564"
FT                   /product="Uracil phosphoribosyltransferase / Pyrimidine
FT                   operon regulatory protein pyrR"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00564"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50011"
FT                   /db_xref="GOA:D5H1X6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X6"
FT                   /protein_id="CBL50011.1"
FT                   /translation="MAKEIIDALSMKRALMRMTYEIVERNKGTKDLVLVGIKTRGWYLA
FT                   ERIAKNLKNLEDVEVPVGAIDISQYRDDLPEAEKEKMIHSQQLDFDITDKNVILVDDVL
FT                   FTGRTIRAALDALMDQGRPAKINLAVLVDRGHRELPVRPDFIGKNIPTAMNEKVKVAMT
FT                   EVDDKDSIEIVK"
FT   CDS             566064..567533
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00565"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00565"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50012"
FT                   /db_xref="GOA:D5H1X7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X7"
FT                   /protein_id="CBL50012.1"
FT                   /translation="MTKKQISMVTLSLLLANIMSGLDATIINTAIPAIVSDLHGIQYMG
FT                   WIVACFLLGMSVSVPIWSKIGERMGNKFAFELSLALFILGSVLEGVAPDIYFFLVSRVL
FT                   MGVGAGGMGSLPYVIVGYIYPNIKRRTVILSYIAASFSAACIAGPLVGGWIVDALSWHW
FT                   VFYINVPLGLISIILSFLFYRGIRKPNINTVFDRLGAFTLIGGLTCFLIGIQMLGLASN
FT                   FLVAIFVIIGIVMLVWFILVEKKAASPIVPLSVFTNKALVGDFILFAFAWGAYIAVNTY
FT                   LPMWSQAILGTSALIGGMTLIPNSIFDIAGSQSTPHLLRRFNNYHLLIFDLSLIAITVI
FT                   GLIVVPISTPYQVLMSIAALSGLGVGSIFVILQIKVQIDAGEKDMAPATSLSFLIRILA
FT                   QTVMAAVYGVIMNLALARGIAGHHNITMTMMNKLSDVESAKSLPRALMPTMRTIFHTGI
FT                   REIMIVSLLLIICGYVANFIYNHHEAKKAAE"
FT   CDS             complement(567569..568768)
FT                   /transl_table=11
FT                   /gene="mdtG1"
FT                   /locus_tag="LCRIS_00566"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00566"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50013"
FT                   /db_xref="GOA:D5H1X8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X8"
FT                   /protein_id="CBL50013.1"
FT                   /translation="MNEKPIWKKNLLVLSIAVFIAGIAFSEVMPFLPLYIDTLGNFTHK
FT                   QLNFWSGFIYSGTYFVSAIISPWWGKLADKKGRKPMTLRASLGMAIVLGCMGLVTNVYQ
FT                   LFILRMLQGIFAGFVSNSNALVATETPKEKSGQALGTMASSFTAGNLLGPFIGGALASI
FT                   FSYRVTFFITGGLLLIAFLLSLFFVHETDFKPVTEKKLDKASGVIKELRSPQLIFGLLL
FT                   TTLIIQAANNSINPIVSLYVKQLMANHGNVVFISGVIAALPGIATFLAASRFGALGDRI
FT                   GTHKIIIAGFIGATILFFLTAFVQNTVELGILRFLVGFTDACLFPQVQTLLTKNTPAKI
FT                   TGRIFSWNQSAMYIGNIFGPLLGSTISGLTNYSTVFIVTAGIVVFNLILFRFNVIKNLQ
FT                   "
FT   CDS             complement(568761..569519)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00567"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00567"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50014"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1X9"
FT                   /protein_id="CBL50014.1"
FT                   /translation="MQWQNVWLTLGLLLAILLIREGWNSGKDIFSIFGIIVSAVVIINY
FT                   LIKLALSQKHGKLSRKMQYRLTIAGLCQDFTTIFSAVYISVLFGAKNYYWLFVIILIAS
FT                   FIKRPLLKTLREYLPFDDFTIQSWGIVLGLVITLFRPTYFAGIFLIRIFYSLQNTDTLD
FT                   LIRDHVDTNIYMINYRFRTAGGFLTQLILWGGLLLFNGPHIFEQIFNYHINKSVMNSSQ
FT                   PLFLTHLILVLFIISFTIYTLKLNKGNKNE"
FT   CDS             complement(569626..569898)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00568"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00568"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50015"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y0"
FT                   /protein_id="CBL50015.1"
FT                   /translation="MFLFKGGENEDNVIGWFGSLAALFGYFLGIFGIFLPALYCISASL
FT                   AGIGAACFPSVQKQIAIESDYHPSKNDLFAYFGAILILLSNNCLC"
FT   CDS             complement(570063..570647)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00569"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00569"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50016"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y1"
FT                   /protein_id="CBL50016.1"
FT                   /translation="MKNKFSMIILFPLFFSLSACSNRSSRPATVNETVSSSATHKASKQ
FT                   ANEFKPNLKKKYPGFKLTSIPEQFRGTWYRSDPLSKSARKLIINKHTIGDSVVYRQVDK
FT                   SIKLDHNSEQNNKTYSGGDSMIAIEQHQEQTWMRVREFLTTVDIIYITGQFKGHPCLYL
FT                   AYSSGDIHNALFKNKALAIKYKNYDFSKIKS"
FT   CDS             570749..571831
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00570"
FT                   /product="Aminopeptidase I zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50017"
FT                   /db_xref="GOA:D5H1Y2"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y2"
FT                   /protein_id="CBL50017.1"
FT                   /translation="MQKEQEIQMLKEFSDANSTSGFEEEFVKLFTSYAEKTADIEVDGM
FT                   LNVYAAKKENKGNRPVIQLDAHSDAVGFITQAVRPNGLIKFVPLGGWVKYNIPALRVKV
FT                   RNRDGEYIPGVVATKPPHFMTAAERNNVPDVADMSIDVGSSSREETIKDYKIDTGCPIF
FT                   VDVKCEYHEKSGLFFGKDFDDRFGAGAMVDVLDNLKGEETNFDVVAALSSQEEVGLRGA
FT                   YVTARKVKPDLCLVLESCPADDTFTPDWLSQTGLKRGPMLRDMDTTFLPNPKFQQYACD
FT                   LADKNNIPYTRSVRTGGGQDGAAIYYENGAPTIVIGIPVRYEHSPYCFSSYKDFKASVD
FT                   LATAIIRDITQEKLDSFKKF"
FT   CDS             571925..573547
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00571"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00571"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50018"
FT                   /db_xref="GOA:D5H1Y3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y3"
FT                   /protein_id="CBL50018.1"
FT                   /translation="MITVSDVSLRFGGRTLYEDVNLKFTPGNCYGVIGANGAGKSTFLK
FT                   LLEGKLEPTTGSISIDPNERMSSLNQDHFAFEDFTVMDTVIQGHKELYQVMKEKDALYA
FT                   KPDFGDEDGVKAAELESKFAELDGWNAEADAAKLLQSLGIPEEEHQMMMKDLPESEKVK
FT                   VLLAQALFGNPDILLLDEPTNGLDVHTVEWLEDFLADYPNIVIVVSHDRHFLNQVCTEM
FT                   CDVDRGKIQLYVGNYDFWYESSKLANELAANQNAKKEEKMKQLQEFIARFSANASKSRQ
FT                   ATSRKKQLDKITLDDIKPSSRKYPFVKFEMHRDLGNDLVKVENVSYSVDGEKILDNVSF
FT                   IVRPGDKVAFLSRNALATTALLDIVAGKLKPDTGTVTWGQTTAFNYMSRDLNANFNNDE
FT                   LTILDWLRQYATKEQDDNTFLRGFLGRMLFSGEEIEKKIKVLSGGEKVRCQLSRMMLEP
FT                   ANVLIMDDPTNHLDLESITALNDALVSYPGSILFTSHDHEFIQTIANHIIEVGPKGIVS
FT                   RQDTSYDEFLDKESIQSAVAKIY"
FT   CDS             573635..574555
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00572"
FT                   /product="Oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00572"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50019"
FT                   /db_xref="GOA:D5H1Y4"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y4"
FT                   /protein_id="CBL50019.1"
FT                   /translation="MKRIKMGCTTLSIPAMALGIMRMNQKSVPEAQVAIQAAYDAGINF
FT                   IDSADIYGGGKSEEIFGQAFSQMQIKREEMFIQSKTGIVPGKRYDFSKEHILHSVDEIL
FT                   ERMQLDYLDSLVLHRPDALMDPEEVAEAFDQLQAAGKVRFFGVSNFDTAQFKLLQSCLS
FT                   QRLMFNQLQFSLKHTGMIDFGMHMNMVDKPSVDRDSQFLDYARLHKVTVQAWSPFQYGM
FT                   FEGTFIDNDGFPKLNQELQKLADKYEVGKNAIAAAWILRHPANIQMLVGSMNPQHIRDS
FT                   AKGAKIRLTRQEWYDLYLAAGNYLP"
FT   CDS             574650..575453
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00573"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00573"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50020"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y5"
FT                   /protein_id="CBL50020.1"
FT                   /translation="MKKKYGKNLIFEDFIHDREVKMYRSDAEDSVHSDYTLNVQVFTLD
FT                   NLPFSPLTGDQQHIFFDYEKAGTDAVKITGVEGHFYNAITRRYEVTDHTFVVGELLDDK
FT                   VSETVATQQMREAAEKVIAELSKRIPMPPHIKHPKILTDVQRAEKLVTDRNVKITSLSK
FT                   ATGISTYTLYNYRKNPASLHKASQATVDCLTSKYFETYFSRNEIERFRMMLINIVGAYL
FT                   KETEGNPIAYDPAHALYTMCQKGDWHRLAKMEELWRASYSVERSL"
FT   CDS             complement(575450..576769)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00574"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00574"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50021"
FT                   /db_xref="GOA:D5H1Y6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y6"
FT                   /protein_id="CBL50021.1"
FT                   /translation="MDNKLKRSIGFGSAFSIVIGTIIGSGIFFKQASVLDSAGSTTMAL
FT                   LAWIFGGLITLAAGLTIAEIGAQMPYTGGLYVYIENLYGRILGFMAGWMQIIVYGPAII
FT                   AAVAGFMSIMMTNFFGLNHSWRIPLALITVLAIGIMNFFENKVGAIFSVITTIAKMIPI
FT                   AVIIICGICWGQQDAINQTVAEVSQHTSNFGVAVLATLFGYDGWILIANLGGEMKKPKK
FT                   LLPRAIIAGITAVLAIYTLITIGIFRFIPANQIHQLGENTTTYLANAVFGAIGGKILSI
FT                   GIIISMMGTLNGKMLTFPRIVYAMAKRGDLPFSKYLAYVTPKGKSPVVATLFIVLLALL
FT                   MMIFFDPDHLSDLCVFTVYCFYLLAFFGIFILRKKNKAERPFSTPLYPFVPIIAILGGL
FT                   FVLISELINDPAGVLLFAGIVIIGLPIFYAVKRMNKHRLH"
FT   CDS             complement(576996..578327)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00575"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00575"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50022"
FT                   /db_xref="GOA:D5H1Y7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y7"
FT                   /protein_id="CBL50022.1"
FT                   /translation="MDNHLKRSIGLGSALSIIVGTIIGSGIFFKQASVLDSAGSTFMAL
FT                   LAWILAGIITLTAGLTIAEIGAQMPYTGGLYVYIEKIYGRVLGFMAGWMQAIVYGPAMI
FT                   SAVTGFLSIMVTNLFGIGTEWRIPIGLITIIAIGGLNFLENKVGAAFAIITTIAKMIPI
FT                   FAIIFCGICWGDQNAVAQTVTELNRSTGGLGVAVLAALFAYDGWIFIANLGGEIKNPQK
FT                   LLPKAIIIGITTVLVIYALITIGIFSFIPADKIHALGQNSTTYLADAILGPIGGKVLSV
FT                   GIIISMLGTLNGEMLTFPRIIYAMAKRGDLPFSRFLSYVTPKGKAPVMATMLLITLTGI
FT                   MMTFFDPDYLSNLCVFTIYSFYVLAFFGLFILRYKNKDQRPFSVPFYPLIPLVAIAGGL
FT                   FVLVSQFFNDPAGVLLFTGITAVGWPIFFLVKKMSKAQNTIIED"
FT   CDS             578488..579156
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00576"
FT                   /product="Glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00576"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50023"
FT                   /db_xref="GOA:D5H1Y8"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y8"
FT                   /protein_id="CBL50023.1"
FT                   /translation="MRVNVLQHAPNEGPGSIQAWCHARDNEMFVYHPGNFGILPTVDET
FT                   DLLVVLGSPNSPNDDLDWVKNERVLIRQMLDQHKPILGICFGSQQIAKTLGYKVLDAPA
FT                   KEVGWAPVYLQDQTITGIPDKLTALHWHEQMSEIPTEAKLLFSSDLVKNQGFLLGDNVI
FT                   GLQFHFEPQIDNVREIAINDGAYALENNDLHQTPTEIINHGVPEKNKDVMFTLLDFIAK
FT                   "
FT   CDS             complement(579199..580017)
FT                   /transl_table=11
FT                   /gene="glnH1"
FT                   /locus_tag="LCRIS_00577"
FT                   /product="Glutamine ABC transporter, glutamine-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00577"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50024"
FT                   /db_xref="GOA:D5H1Y9"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Y9"
FT                   /protein_id="CBL50024.1"
FT                   /translation="MRKKFLLIISIVVLFALPLSGCKQNKKQNVYQAVKTSKTINWGVK
FT                   ADTPLFSSINIKTGKLNGFEIDLANALTHEMLGKNAKANFITTTANTKIQLLKNTNVDA
FT                   VIAAMTITPERKKQVEFSHPYFPAGQSIMVADSSAIKNAKNLNNKKVLVVKGTTAADAI
FT                   HQVAAKAEILQFDDYGQAFAALKAGQGDAFVTDNGILAGILRDSSGYKLVGGTFTNQPY
FT                   GIAVNKGQNDMLKHINTALAKLEKNGTYNHLVKKWFGNIPGMNIKELEKK"
FT   CDS             580195..580647
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00578"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00578"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50025"
FT                   /db_xref="GOA:D5H1Z0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z0"
FT                   /protein_id="CBL50025.1"
FT                   /translation="MKISETEKLNLSIIHGSRAYSQWEQDHDLPDYLVVIMYELLIRGK
FT                   LTQRELVNLSDLPKQSINKGIKILRDHDHITMTVDPSDKRVRFCQLTEAGRKYAYDRLR
FT                   PLFELEEKTAQAMGTDKMKLLAKLSEEWSTTFWHFLSEERSKNGKL"
FT   CDS             580634..582367
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00579"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00579"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50026"
FT                   /db_xref="GOA:D5H1Z1"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z1"
FT                   /protein_id="CBL50026.1"
FT                   /translation="MENFKIILPYLKRYKKDVVCAIIAILVSAFSGLYQPKLLENIQKA
FT                   LMANQKQAVLSDGIWLVVLGIIAIISGIFNVYFAAKIAQGVVSDLREDTYAKIQTFSFG
FT                   NIKKFSAGSLTTRLINDMNQVMNMMMQLFMQMLRLPILIVGSFIFCIVIIPRFWWAPVV
FT                   MVALIFGFGAYVLRQMNSLFTKFQEMMDRISNQAQETLQGVRVVKSFNQGPQEIKKFDQ
FT                   TSDQLNDYNIVIGYWFSAIMPAFQMIAYTVIALIVYLIGKNITAHPSDIAVVSPFVNYV
FT                   LTLLFTIMIAGMTLMQFSRANISLGRIREVLETEPDVKFVESGSVAPLSGSVEFDHVSF
FT                   TYPDGDDPTLKDISFKIKPGQMVGIVGATGAGKSTLAQLIARLYDPTKGEVKIGGQNIK
FT                   DVTEAALRKTVSFVLQRAVLFSGTIASNLRQGNAQAKLHELQRAANMAQASEFIERYND
FT                   SFDHEVEERSANFSGGQKQRLSIARGLIAKAPILILDDSTSALDAESEKKVQQALEHEL
FT                   PDTTTFIIAEKIVSVINADTILVLDDGKLVAQGTHEELLKTSPVYQEIFKTQKGKKGGN
FT                   E"
FT   CDS             582368..584137
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00580"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50027"
FT                   /db_xref="GOA:D5H1Z2"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z2"
FT                   /protein_id="CBL50027.1"
FT                   /translation="MSNTKKALRYFAKYLKPYWKGITIVVILSLISSGAQVMAPTYLGR
FT                   SVTALTTYLVDLKKGTASMNTFYSALWSMFLFYLLSQIAIFIAWMVMSKLNADSTNDMR
FT                   ENLFAKFQRMLVRYFDTHQDGKLLSLFTSDLDNIFNAMNNAIFEIISQGIMFVGTIIVM
FT                   FTINSTLAWTTIATTPFILIISVLLMKKARVYIDKQQDEIGDLNGYITEQINGEKVIIT
FT                   NGLRQESVDGFKVYNNKVRTALFKGQFYSGILFPLMNGLNLLNLAIVIAMGSWMIISGQ
FT                   ISQAIGLGLIVTFVEYSQVYFQPLTQITSIYSMIQLALTGARRLATVEEQKDENEVPNG
FT                   KVISGLNHGVKLENVHFGYNKDKEILHGVNISVDKGQSVALVGPTGSGKTTIMNLLNRF
FT                   YDVNSGKVTFDGTDVRDIQLTSLRNNVGIVLQDSVLFTGTVADNIRYGKPNASMDEVIS
FT                   AAKQANIHDFIETLPDGYDTQVSDASSIFSTGQKQLMSIARTILTNPPFLILDEATSNV
FT                   DTVTEEKIQKAMDTVIAGRTSFVIAHRLKTILNSNKIVVLKDGNVIEEGSHEALLKEKG
FT                   FYYKLYTDQMAFD"
FT   CDS             584318..584896
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00581"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50028"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z3"
FT                   /protein_id="CBL50028.1"
FT                   /translation="MFTRSSKWNVKSVILVTLIGIIMGVIYTYGFNNVYNLVKLSFLPT
FT                   GYAPVVDNVFTGLWYMAAPLAMYFVPTKGAGTIGELLAATVEMAIGGQWGALTIFEGLI
FT                   QGAMNEIGFFPKKERYEKFSWKSVLTGAFFANLGGFIPSYFLFGWSHYQVNVQILMFIV
FT                   SMISSFLFDGVLVKLITNLFDKALKPKVA"
FT   CDS             585004..586395
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00582"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00582"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50029"
FT                   /db_xref="GOA:D5H1Z4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z4"
FT                   /protein_id="CBL50029.1"
FT                   /translation="MARRSNAEKEAEAEAIKNWNPRYKHNVIIYLWIYGILGAVTGITN
FT                   DAALSYYKIVAPHLISGLNIFNAATAILMSVMIATVHKWGYRKILLILPPMTAIFMALT
FT                   CITTNQLVIMIAYTISWTAIGVYDLMYPLMWTSYVPGKIRTKMFSTVMIVNLITQTICT
FT                   FLGGKAVVWFFGLIRGIPYHEASVLSGKSEMLTGQTLADYTNSYRILLYITAAVTMLAF
FT                   VLALFIHDVPRDYRSTADDKEPSRAEKMAMYKKLLSKKTLMWIVYIAGIQLGARLVAVY
FT                   VPIYLNSYLHIPRDVTSTINTFVQAAMLIGYFFAPFLEKKMGAIVSVAAGTLTCVPVML
FT                   LLANGRRLGSGTVLFVIVGLLLFLRTGLANATMPIQQEVQMVIVDKDLRPAFTGVVQIA
FT                   YAVVGVIDGLFTEFYLFTTQDGYANAYYIAAVIYVIASVLLLVFFAKKYNRILDTANAQ
FT                   DDNQN"
FT   CDS             complement(586460..587089)
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="LCRIS_00583"
FT                   /product="Uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00583"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50030"
FT                   /db_xref="GOA:D5H1Z5"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z5"
FT                   /protein_id="CBL50030.1"
FT                   /translation="MGKLEKPVIIGIAGGSGSGKTTIAHEIADNINDQDRIMIMTQDSY
FT                   YKDNTGVSMEERMKINYDHPDAFDMPLLEAQLSQLMHRKPIEMPTYDFTAHTRSDETIH
FT                   VEPADIIILEGILVLFNEDIRNLMDIKVYVDTDDDIRFIRRLERDMKERGRSLDSVINQ
FT                   YLGTVKPMYNQFIEPTKRYADIIVPEGGENDVAIDMLTTKLQSVLK"
FT   CDS             587728..588468
FT                   /transl_table=11
FT                   /gene="glnQ2"
FT                   /locus_tag="LCRIS_00584"
FT                   /product="Glutamine ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00584"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50031"
FT                   /db_xref="GOA:D5H1Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z6"
FT                   /protein_id="CBL50031.1"
FT                   /translation="MTAIIEFKHVDKYYGKLHALKDINLKIDEGQVVSIIGPSGSGKST
FT                   LIRTMNGLEPINSGQLIVTGYDLADKKTDINKIRKNVGMVFQHFNLYNNHTVLENVMLA
FT                   PKIVLKRPDDENRKVAMQYLEKVGMADKIDSYPRQLSGGQKQRVAIARSLAMHPKVILF
FT                   DEPTSALDPEMIEDVLEVMRYVAEQGITMVVVTHEMGFAREVSNRLIFFDNGHILEDRK
FT                   PEEFFAHPDTERARQFLSKVISKD"
FT   CDS             588480..589298
FT                   /transl_table=11
FT                   /gene="glnH2"
FT                   /locus_tag="LCRIS_00585"
FT                   /product="Glutamine ABC transporter, glutamine-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00585"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50032"
FT                   /db_xref="GOA:D5H1Z7"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z7"
FT                   /protein_id="CBL50032.1"
FT                   /translation="MKKIKRFLFLPLLILLAFTLTACGQHASSNVYQKVKESKTIVWGV
FT                   RADTRLFGLTNIKTGHIEGFEIDLAKALTKQMLGKDAKTDFVTTTANTRIPLLKNGNVD
FT                   AVLATMTITPERAKQVTFSKPYFPAGSSLLVPNNSKIKNVKDLEGKTVLAVKGTTAVDD
FT                   VHKYAPKARILQYDDYGQAMSALKANQGVALTTDNGLLAGIAQENPGYKLVGGVYSNAP
FT                   YGIAVNKGQKQMADHIDQALNELQKNGTYDRLIKKWFAGIPGFSLKGVLK"
FT   CDS             589298..589939
FT                   /transl_table=11
FT                   /gene="glnM"
FT                   /locus_tag="LCRIS_00586"
FT                   /product="Glutamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00586"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50033"
FT                   /db_xref="GOA:D5H1Z8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z8"
FT                   /protein_id="CBL50033.1"
FT                   /translation="MWQIITNNWGSFLTGFWNTILSSIIALVFSLILGVIFALLEVAPS
FT                   KFGQVIAKIYIAIFRNIPLLVIVMIFYLIVPRYIVKLSGFQAGTIGLTLYTSAFIAETV
FT                   RAGINSIGTGQMEGARSNGMTYVQAMRYVILPQAMKIVIPPLGNQFVNLVKNSSVLAFV
FT                   AGFDLMYQAQLIAFSTFQTIDTYIIVGLFYLILTLPLSYYMRHLEKKLVN"
FT   CDS             589957..590610
FT                   /transl_table=11
FT                   /gene="glnP2"
FT                   /locus_tag="LCRIS_00587"
FT                   /product="Glutamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00587"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50034"
FT                   /db_xref="GOA:D5H1Z9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D5H1Z9"
FT                   /protein_id="CBL50034.1"
FT                   /translation="METFIHAYSWVDIRFLLQGLWVTIYVSLISIALSFVVGLILGLVR
FT                   YMKIKYVSAIVGFIIDIIRNLPLLLIIFFTYFGLPQLGIVTNPTTASIAALVIFEGAML
FT                   AEIVRSGIGSVDSGQMEGARSNGMSYGQAMYHVIMPQALHNMIPALLSQFVSLVKDTSL
FT                   ATIIVLPELLYHAQIIYSQNTTYLIPMYVIIAIMYFIVCFCLSTIANYLQKKYD"
FT   CDS             590686..591597
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00588"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00588"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50035"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H200"
FT                   /protein_id="CBL50035.1"
FT                   /translation="MSVNAQLTDRERVELTKKAYDELQLGDTIKIDQHYLGTVCRNVYA
FT                   KDGMRAFVISSPNEITILFKGSYGFKKGTPQTWRDEWIKTNLPILKALLARKRTIPSQL
FT                   KSAAHLLNQTINQFKGSRIYIYGHSLGSINAQFALANCRHPEAIAAAYLYEGTNIWLLL
FT                   TPTERRQVAKMREKIFNYVDIYDPVTLGITETHHMVGKLCYVDSEPMQPIKQHMWGGYH
FT                   FNADGSLKLRKVDQAFLAESRSERKLLARSGDLADFLEKMGSAEEVKKLATDKIEQLVQ
FT                   RYPDHKSLSNWPLFLKEKEMIN"
FT   CDS             591684..592298
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00589"
FT                   /product="Resolvase, N terminal domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00589"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50036"
FT                   /db_xref="GOA:D5H201"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H201"
FT                   /protein_id="CBL50036.1"
FT                   /translation="MAVLKPKEMAERLGVTVRTLQEWDRKGIFPAHRTPTNKRYYTEQD
FT                   YLKYINNNSDPKKDKRKVVGYARVSTANQKDDLKDQEEFIREFVNTKGIILDEMITDIG
FT                   SGLNYKRKKWNKLLDEVMQGKIKTIYITYQDRFIRFGYDWFEKLCNQNGTKIVVLNNRE
FT                   TSPNEELVQDVLSILHVFSCRLYGLRKYKHKISEDKELTNK"
FT   CDS             592295..593578
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00590"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50037"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5H202"
FT                   /protein_id="CBL50037.1"
FT                   /translation="MIVKTRVYRLKPDEAMKQILDDWCNYRRYCWNQALALWQDLYMAR
FT                   TIFDKVVATTFIPKQNKKTKKWRMTHQDYHLNPSPNWRLVRDLMIEQKEDWQYAYSART
FT                   LQLAVQDLGKAWQNFFNKAQPDWGKPKFRSKKNPRQGFKTDRAKIEDGLLWLEMPRDTP
FT                   YKDRWAGIELSNKPLSGKIGVVSIFKVNHKYYASIPYKLEKPLPKAKTGKGTGVDINVG
FT                   HFNYQDGQCLVLPKSLKRLYAKIKFYQKRLAKKRTVNGRIKGTQSNKYLKTKTKLQSCY
FT                   ERVSNIQHDLMHKFTTKLVNDYDQIVIENLDVKGMLMSHVASKGMHRSMFGLFRQLLAY
FT                   KCDWYDKELILANKLYPSTQRCAVCGMVKKGDEKVTLKGNQKHGTKHNEYICYNPDCPN
FT                   YGKVVDRDENAMKNLTLLISHPELNKAI"
FT   CDS             complement(593838..594335)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00591"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00591"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50038"
FT                   /db_xref="UniProtKB/TrEMBL:D5H203"
FT                   /protein_id="CBL50038.1"
FT                   /translation="MKKKLLLFVSFLAGLLFLVSTSTYASKLPKGYGIAKTFTTPKATR
FT                   GTWYYREKGDKTISKVKITAHSVDGKKLYVPSQKFFEKNVYNVSAKKRNQFIKKTENIY
FT                   AAANYKKGFNVNNWVNLAGDGEYYIPVTRTVNGKKVKALRIATGAGPYTAAYAYKTKAL
FT                   VK"
FT   CDS             594487..595887
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00592"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00592"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50039"
FT                   /db_xref="UniProtKB/TrEMBL:D5H204"
FT                   /protein_id="CBL50039.1"
FT                   /translation="MTIDYRKDIIDLMQATGSDPQSLKQSMIALKIISKIYNQAVLGNP
FT                   PENKNEVVKIAEKADQAVKNEPEIKTENKPENKTEIETKKENDENTVEKIKPKKTKEEL
FT                   EKEKAKKEEAAKALSPTVLKNKNKYATITPIPKPVVKKIIPVAKPKEKQYEIRRKLLGA
FT                   EAVDENGHSVQYFNEHLTRIEKLENGDTVTLLDHLNDSGNRPIIKVEHHAKSFAPDEEI
FT                   IEFGPAVVHRDSFGLYIKQDSNGKNLSKVNPEKAILYLDMNTVSHFNLHENDLISIVWR
FT                   VSDPSFIRVRWRYAEAEVTIPEKKEKPDKNKETEKHKTKGRHKSLLHQLEKKEKQSSEK
FT                   QNEDYASRIDFDLDKKRVTVVVGDKSLTSNLAKVIEAHNGVARIIEMKQASNVLRACKE
FT                   SNYVILIQSYIKHSISQILINSPHKSYSIAMATTAGQLAVEKALYRARYKLNVTDNDQI
FT                   QYPFLVNN"
FT   CDS             complement(595951..597255)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00593"
FT                   /product="Glycerol-3-phosphate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00593"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50040"
FT                   /db_xref="GOA:D5H205"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H205"
FT                   /protein_id="CBL50040.1"
FT                   /translation="MKFYKKLVLTGAAALAVLGLSACSNNNSSSSSSNKKIPTKINKKT
FT                   TVTFWYSLTGNAQSSLQKLTKDFEKKNPNITIKLQSQGGNYSDLQSKLVSGLQSPKDLP
FT                   TITQAYPGWLYNAAKNNMLVNLTPYINNSEIGWGSYAKSGIKKALWNGANINGTQYGVP
FT                   FNKSVEVLFYNKTLLDKYDVKVPTNMSELASASAKIYRESHHKVRGVGFDALNNYYMMQ
FT                   MKETYGKDFNKNLNFAAKDSVKAINYYANGVRAGYFMQAGTEKYMSTPFNNGRVAMFIG
FT                   STANEAYLKQGLKKGYTYGVAARPSTMNVQQGTDIYMFKKATAMQKSAAFKYLKFLTSK
FT                   SSQLYWAKQTGYMPVNTAAINDKVYQSAKNSKIPAIIAKTSKNLYFLPVTKNATAAYDQ
FT                   VNANMQTILAKASKKQSWNSDIKTGKDKLDAAWKQ"
FT   CDS             597419..598222
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00594"
FT                   /product="Galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00594"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50041"
FT                   /db_xref="GOA:D5H206"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR012361"
FT                   /db_xref="UniProtKB/TrEMBL:D5H206"
FT                   /protein_id="CBL50041.1"
FT                   /translation="MDKNPLVYKYSIGKRKPYDYDYGNRQGNQNAGCPFCDVQHLINIY
FT                   EKDGDKIWLKNKYPTLKDTNQTILIESSDHQGDISTYTREDNQELMKFGLKCFQKMNNS
FT                   GRYQSVLWYKNFGPKSDGSLTHPHMQIVGLYHKDGYHDIGADNFKGFEVGRSGSVEMNL
FT                   SARPVQGYQEVNILTHDNTNLDTWADLIQKGTQYVRSVLSHGVDSYNLFFYPINDGQGT
FT                   CCKIIPRFYASPYFVGYKISQVDDSDTLKWEAERLKGFVNGGILQ"
FT   CDS             598312..599238
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="LCRIS_00595"
FT                   /product="Ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00595"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50042"
FT                   /db_xref="GOA:D5H207"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5H207"
FT                   /protein_id="CBL50042.1"
FT                   /translation="MKKIVVIGSSNVDTTLHVKDFPKPGETINALDITTAGGGKGANQA
FT                   IAAAKSGAETYFINRVGEDSEGNFITHQLKSYGVDTTYVQTTMGAKTGHAYITLNEAGQ
FT                   NDIIIDHGANYELTVEDIRAAGDLIKSWDCVIAQFEIPLDVTLEAFKIAKKAKKITILN
FT                   PAPAVDEIPKELLQYTDIITPNETESAKITGIAIKDNSTLATNAEKLHMLGVKNVVITY
FT                   GDKGAYISTPDVEELIPAYKVEAADTTGAGDTFIGYLVSNLNSDLSNFEEAAKIASRAS
FT                   SIAVQRLGAQPSIPTEQEVKQAMEDDE"
FT   CDS             599238..599930
FT                   /transl_table=11
FT                   /gene="rpiA2"
FT                   /locus_tag="LCRIS_00596"
FT                   /product="Ribose-5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00596"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50043"
FT                   /db_xref="GOA:D5H208"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="UniProtKB/TrEMBL:D5H208"
FT                   /protein_id="CBL50043.1"
FT                   /translation="MNKQEQDRLKKEAAEKAAAMVKSGMVLGVGTGSTVAFFIDALGKR
FT                   KDEDGLKLKAIVTTSNRSKKQLEGLGFKVSELADIDQADLTVDGADRVANNLDGIKGGG
FT                   GALTLEKNVAINSKKIIWIVDESKLVHRLSGFPLPVEVLPISCEQNFKRFEQEGLKPRW
FT                   RMDGNQRYVTHYGNYIIDLAADPVPAPHGLADYLDHTVGVVEHGLFLDMCDEVIIAHSD
FT                   GTIEDKKK"
FT   CDS             600069..602078
FT                   /transl_table=11
FT                   /gene="kup2"
FT                   /locus_tag="LCRIS_00597"
FT                   /product="Potassium transport system protein kup"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00597"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50044"
FT                   /db_xref="GOA:D5H209"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:D5H209"
FT                   /protein_id="CBL50044.1"
FT                   /translation="MNKISGKQKVSFAGLLIAIGIVYGDIGTSPLYVMKSIVTENGGIS
FT                   NVNRELIVGSISLIFWTVTLLTTVKYVIIALKATNHGEGGIFSLYALVRKRAKWLVIPA
FT                   LIGGAALLADGTLTPAVTVTTSIEGLKNMRFGDVIPVSSQDMVILITIVILVLLFSIQR
FT                   MGTSVIGKAFGPIMLLWFTFLGLIGLMNLSHDWSLLDAINPIHALRILFSPANKVGILI
FT                   LGSIFLATTGAEALYSDVGHVGKSNIMGSWPYVFVCLILNYLGQGVWILQNANYHAGNG
FT                   DFNPFFEAVPSSLRLFAIALATIAAIIASQALITGSFTLVAEASSLKFLPRMNIIYPSN
FT                   EKGQIYIPSINKMICVITVAIVFLFRTSHHMEAAYGLAITVTMLMTTILLFEYLGKKGT
FT                   ALSIRCIFLVVFAFIEGMFLFSSLTKFLHGGYVTVLIAGFILAIMYVWFYGNKIRDKRE
FT                   EQNAYVRLDEYTDMLTELSHCDDYPVYATNVVYMAKVKYNKFIKREMLYSILDKRPKRA
FT                   KAYWFVTVNVTNEPYTAEYAVNTYGTKNVINVQLYLGFRKQTSVNVYLRQIVHDLIADG
FT                   TIESQPQQFTTTPGRDVGDFAFVIVNDVISPLTKLTGYEKFMVEARVWLQNLSSNPASW
FT                   FGLEYADTVVERVPLVLGDHEEEHIQRIKPKKEK"
FT   CDS             602160..603086
FT                   /transl_table=11
FT                   /gene="iunH1"
FT                   /locus_tag="LCRIS_00598"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00598"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50045"
FT                   /db_xref="GOA:D5H210"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniProtKB/TrEMBL:D5H210"
FT                   /protein_id="CBL50045.1"
FT                   /translation="MNKRPLIISTDPGIDDIAAMTISLFAQELDVRMIVPTWGNVALKY
FT                   TLQNTLNLEKFLHTKVPVVVGANQPLVAPMISAASVHGKTGIAGFEFEQADDSLIEPGL
FT                   AATLMAKEIKSSPEKITLMGIGPLTDFALLFKQYPEVKENIAEIVIMGGNIGHGNHSPF
FT                   AEYNIAGDPEAAQVVFHSGLPVKVAPLEIGNKAHLTPEQMDKVKTCGEVGNMLYSLFSN
FT                   IHEPDGDPRIKIYDPTAVGIMLHPEMFTMKKANVNIELRGQYTYGASVMDFMDQEHANA
FT                   EIATDVDLDKFATWFIDSIKKADQGRE"
FT   CDS             603086..603811
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00599"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00599"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50046"
FT                   /db_xref="GOA:D5H211"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D5H211"
FT                   /protein_id="CBL50046.1"
FT                   /translation="MADYVYRTVMHDIKQNILNNQYKGMRLPDERSLAEHYQVSRSSMK
FT                   RALELLAQQGIVFKKRGSGTFINPLYLRKQAMFRYDGSNLGITDSFKVPGKKQQIKLLD
FT                   FHVIKATKEIAEDLFLNENDFVYEFKRLRLLDEQPFLIETGYLPIKIVPELKPETLQKS
FT                   LFNYLEDEQGKTVTKSFLNITVEPSNEEDQQKLNLKPTEPVGVMEGIFFLDDGTPFEVS
FT                   NMRVHYHYMNFNTFVNLGK"
FT   CDS             complement(603905..604732)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00600"
FT                   /product="Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50047"
FT                   /db_xref="GOA:D5H212"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H212"
FT                   /protein_id="CBL50047.1"
FT                   /translation="MTKLPFKVVAVDMDGTFMHDDQTFDHKRFDRILTELHKKGIHFIV
FT                   SSGRPYTRLRKDFAGFLNRIDMIADNGSLLLQDNQIISTHLLTYKTTLDLISFIKEHYS
FT                   KSSIIVTGINNSYTTINASPSFKQTMNFYYPDRIEVTDLAAAINPQDMITKITLSYQYD
FT                   FSAELEKEFNQTHAEKIHCTSSGFGLLDIVPYSVNKGSALKYFLRYFGAKPNELIAFGD
FT                   GMNDAEMLKLAGYSYAMANAEDQVKKIAKYEAPSNNDDGVLEVLDSYLAKVEK"
FT   CDS             complement(604854..605213)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00601"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00601"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50048"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="UniProtKB/TrEMBL:D5H213"
FT                   /protein_id="CBL50048.1"
FT                   /translation="MFSLFNQKKQSESREVYQDLRHFYNSFFSNIYNEMNIGRYRQIRD
FT                   AIGLVLNKFDSGDHPLEYTSKLVMYIQARVAMNHLHLTHEQQDLMKKLSDATKYVNLSY
FT                   VYLSPLTSVEQFVNI"
FT   CDS             complement(605219..605983)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00602"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00602"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50049"
FT                   /db_xref="GOA:D5H214"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D5H214"
FT                   /protein_id="CBL50049.1"
FT                   /translation="MTQEERLIQIKQLLEKKHQLSTRQIAAHFNVSFDTARRDVIHLTE
FT                   TGQAIRVHGGLMEINCNSVPDFLARNQVQSPVKMKMARMAKRFVHPGQCDFIGSSTTLK
FT                   QLCPMLNGIDMQIVTNSIDNALSLLATEIPSVRLLGGVINKKQRFIYSETALEILRQIH
FT                   FNTAFIGGSRIRDDGVYTPSMADSKIIETAASRANQVVLVAEKYKFTNQSSSPYMSVPL
FT                   NQIDVLITDTPLPEELKHHFNPKTQIMPVLKE"
FT   CDS             606284..608683
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="LCRIS_00603"
FT                   /product="Xylulose-5-phosphate/fructose-6-phosphate
FT                   phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00603"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50050"
FT                   /db_xref="GOA:D5H215"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H215"
FT                   /protein_id="CBL50050.1"
FT                   /translation="MAVDYDSKDYLKSVDAYWRAANYLSVGQLFLMKNPLLKTPLVAED
FT                   VKPKPIGHWGTIAPQNFIYAHLNRVLKKYDLNMFYIEGSGHGGQVMVSNSYLDGSYTER
FT                   YPEITQDEKGMAKLFKRFSFPGGVASHAAPETPGSIHEGGELGYSLSHGTGAVLDNPDV
FT                   IAAVEIGDGEAETGPLAASWFSDKFINPIKDGAVLPILQINGFKISNPTIVSRMSDQEL
FT                   TEYFRGMGWDPHFVSVFKGGRFDGEKDPMQVHEEMAKTMDEVIEEIKAIQKHARENNDA
FT                   TLPHWPMIIFQCPKGWTGPKKDLDGNPIENSFRAHQIPIPVAQGDMEHADMLTDWLESY
FT                   KPEELFNEDGSPKEIVTENTAKGDHRMAMNPITNGGIDPKRLNLPDYRKFALKFDKPGS
FT                   VEAQDMVEWAKYLDEVAKLNPTTFRGFGPDESKSNRLFQLLDDQKRQWEPEVHEPNDEN
FT                   LAPSGRVIDSQLSEHQDEGFLEGYVLTGRHGFFATYEAFGRVVDSMLTQHMKWLRKAKE
FT                   QYWRHDYPSLNFVATSTVFQQDHNGYTHQDPGILTHLYEKNRPDLVHEYLPSDTNTLLA
FT                   VGDKALQDRECINVLVTSKQPRPQWFSIEEAKKLVDKGLGYIDWASTDKGAKPDVVFAS
FT                   TETEPTIETLAAIDILHKKFPDLKIRYINVVDVMKLMDPKDNKNGLSTEEFDRLFPKDV
FT                   PVIFAWHGYKSMMESIWFARKRYNVHIHCYEENGDITTPFDMRVLNHLDRFDLAKDAVE
FT                   SIDKLKGKNADFISHMDDLLEKHHQYIRDNGKDMPEVTEWQWSGLK"
FT   CDS             608751..609599
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00604"
FT                   /product="Serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00604"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50051"
FT                   /db_xref="GOA:D5H216"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5H216"
FT                   /protein_id="CBL50051.1"
FT                   /translation="MKSGLVLEGGAMRGLFTAGVIDAFLENDITFDLAIGVSAGAAFGV
FT                   NLKSEQKGRVLRYNMRFAGKSYYASWKSWRRSGNLYAANFCYHILPDKLDVFDKEKFMT
FT                   NPMDFWCVATDAATGEPVYHQLHDAGYVDLEWIRASSSIPFFAHPVAIHGHYYFDGGVS
FT                   DSIPYDFLEQQNCDKKVVIATQPKSYRKKQSKLYPLEKVILRKYPAVVKKLATRAEDYN
FT                   AVLDQMVKDEAADQAFIIRPPFPLEIGTLETDKKEMRRVYEVGRVEAEKVLPALREYLN
FT                   K"
FT   CDS             complement(609655..610461)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00605"
FT                   /product="Hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00605"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50052"
FT                   /db_xref="GOA:D5H217"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H217"
FT                   /protein_id="CBL50052.1"
FT                   /translation="MTIKFIALDTDGTLLNSTGKILPSTKKAVKTALDQGIKVALCSGR
FT                   PIAGLKHFMDELGIIGPDQYAITLNGAITRTADGKIMTKDLVSNRLYRKMYAFANEHHL
FT                   PFNVVSPDSKIITGDHDVDLMVYTQAYENSATLYIREPDELPSDFEIAKGCFTTKAKLL
FT                   DQWEDKIRQEFGQELYIVRADDCFLELLHPNVNKGTGLKELTEKLGIKPDEVMAIGDER
FT                   NDISMFDFAGTTVCMENGSEEAKKHTDYVTTSNDEDGISNAFEKFL"
FT   CDS             611071..612951
FT                   /transl_table=11
FT                   /gene="malX"
FT                   /locus_tag="LCRIS_00606"
FT                   /product="PTS system, alpha-glucoside-specific IIBC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00606"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50053"
FT                   /db_xref="GOA:D5H218"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010975"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:D5H218"
FT                   /protein_id="CBL50053.1"
FT                   /translation="MMQKIQRFGAAMFVPVMLFSFAGIVVALGSLFNNPTLFGSIANPG
FT                   TTWNSVWDTISAGGWTVFNQEGILFTVGLPIGLANKARGRAAMEAVIAYLTYNYFIGAM
FT                   LTHWGAAFGIPNFDKIQIVANATNHGLTNIAGIKTLDTSILGALVVALIVVWLHNKYFD
FT                   KKLPDWLGTFQGSTYVYALAFFVMIPLALITCWGWPKVQMGITSMQHFIVDSGFIGVWI
FT                   YQFLNRVLIPTGLHHLVYIPFQFGPAVVAGGLQPYWLKHLAEYAASTKPLSQIASVEGF
FT                   QLYGNEKVFLVPFICLAFYATAKKNKKKQTSALLIPAALTSVLAGITEPIDFTYLFAAP
FT                   VLWVVYSVLSATMNTVMWAFGLRGFMSDGAIGIASMNWIPLWQNHWKTYVMEFIVGIIF
FT                   GIITYFVFKIMIEKFNYITPGREADDQDVHLLSKKEYKAKKAAEAAGKDANDPYIERAT
FT                   AYLELLGGPSNITELSSCATRLRVSVADPNKVASDAAFKANKAVNVVHHGKAIQVIVGL
FT                   DVPQVLDEMNTLMQQQGGDAKVSTEQDNPYIERATGIVDLLGGDSNIQDVIACSTRVRT
FT                   HVVDPKKVAPDSEFKKIADSYEVQHKDNNEVDIVVGLDADQVVNQMKQLL"
FT   CDS             613013..613822
FT                   /transl_table=11
FT                   /gene="glvR"
FT                   /locus_tag="LCRIS_00607"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00607"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50054"
FT                   /db_xref="GOA:D5H219"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H219"
FT                   /protein_id="CBL50054.1"
FT                   /translation="MANLRSMVYDNSHKLNDSEKQIVQYVLNNPRDCSKLSLAKLAKKL
FT                   YVSESAIFRLCKKLGLSGYSELKFDLVELAESKQKPIKIENNFARELSKVNLDVLKYFK
FT                   QRDFNSLYRDLDNAGTIYIYSTGWQQELIAQYLAHELFVVGKHATVLPSALEELKAAGR
FT                   FAQKGDVLFIISFTGDNKTINEEITKLELVNDKFKYVSFTNLKQNKLASLVQHNIYFPT
FT                   IAFTDDADFKSGKVAFTPAYFLIDLVISEYVAWQQSQGEDVEINVGN"
FT   CDS             613809..614306
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00608"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00608"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50055"
FT                   /db_xref="UniProtKB/TrEMBL:D5H220"
FT                   /protein_id="CBL50055.1"
FT                   /translation="MWAISKRKVGNFIDRITESMHLDTKKILTWYSYVLFIAPLLFWAM
FT                   IALRSGASGQSIRMMIMKQPMIAISTIVAIVDFILGYYMLLNHKQFLINRQTYRFLMGS
FT                   QMIAQLFVGNLLCVVLAILGFYRAKALKKTQDGVSRVIIAISLTAAGLLLASFMLILLL
FT                   EF"
FT   CDS             614327..614812
FT                   /transl_table=11
FT                   /gene="crr1"
FT                   /locus_tag="LCRIS_00609"
FT                   /product="PTS system, glucose-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00609"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50056"
FT                   /db_xref="GOA:D5H221"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:D5H221"
FT                   /protein_id="CBL50056.1"
FT                   /translation="MFNFFKKKNKGIEVDAVVDGDIMPITDVKDDVFSTKMLGDGYAIK
FT                   PKDNHIYAPVDGSISTLFPTKHAIGITNDQGIEFLIHLGLDTVELKGAPFTVNVSQGDK
FT                   VKKGQPLATMDFQMITDKGYDDSCIVVYTNMDLIKSVTPIEKGSVEHSQKVQTIELK"
FT   CDS             614931..615197
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00610"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H222"
FT                   /protein_id="CBL50057.1"
FT                   /translation="MKRYRPNTKAVIVGIVLMLIGIACWVIKASFIPKGADFLFPIGLL
FT                   VICLGGLTLTITAFIAMRKNDLAMSAYLKKQAAEKKKQEKSNN"
FT   CDS             615269..615925
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00611"
FT                   /product="p-nitrobenzoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00611"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50058"
FT                   /db_xref="GOA:D5H223"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5H223"
FT                   /protein_id="CBL50058.1"
FT                   /translation="MNFKDVYEKEHVTRKFTNRKLQEKTIAGIVKMAQQSPSLLNSQPW
FT                   RAYVLMGDALSKFKAASAKKIDDKEAAHEDFASMLSLDWDTYPSRNMATMGASQSFFFR
FT                   NKLQLFNDANKTMFNAPAIIFLTVPKKSPAWSVFDLGIFAQSIMLLAINRGLGVMPAHS
FT                   MVSYPELVREYAQIPDDEAVGMAIAVGYIDKNAEINDPKFIPKRVPFNEIYKVVE"
FT   CDS             616028..617386
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00612"
FT                   /product="Transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00612"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50059"
FT                   /db_xref="GOA:D5H224"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D5H224"
FT                   /protein_id="CBL50059.1"
FT                   /translation="MSPAQIVTNLVATLLIFIVASFFVAAEFALVQTRPSQLEDMLAKG
FT                   QGNKKKLRRALHMTHNLNEYLSTTQVGTTLVGVVLGWFSADTFATILEDLFHLTPMNES
FT                   LIKSVSAILGVVLLTYLEVVLTEVVPKNIAIDKPVPMMMGIVTPLHIFHTIVYPFVWLL
FT                   NTSSNGILKLMGFTPADEENEVYSQSEIIKLSRNAVHGGSLDKEDLTYMERAFELNDKV
FT                   AKDIMTDRTRLSVLDSTDTIAYALKKYLKEGYSRFPVVRDNDKDDVVGYVYAYDIVQQS
FT                   QIDGNVPVTRIIRTIITVPESMPIQDILHLMISKHTPIVLVVDEYGGTSGIVTDKDIYE
FT                   ELFGSVKDEIDDVSDDYIIKDKDGQVHVSGKTTLYDFERFFHTDLKAFQDSDIITIGGY
FT                   MMEHYPNLKKGESIELEGYKFTLDSIEQGFMRWFIVEPIKDKDQKDDQSKYEN"
FT   CDS             617493..618062
FT                   /transl_table=11
FT                   /gene="hpt1"
FT                   /locus_tag="LCRIS_00613"
FT                   /product="Hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00613"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50060"
FT                   /db_xref="GOA:D5H225"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H225"
FT                   /protein_id="CBL50060.1"
FT                   /translation="MAKGDNIDQIIDHKLFTEDDIHEMCVRLGKQLTEDYAGKKPVVVG
FT                   ALKGAIYFLTDLTRQMDVAHQLDFLDVSSYGDGFESTGKVKIVSDLVTDVKDRDVLIVE
FT                   DIVDTGLTLKFMKEHIMARGAKSVKCCAMLNKEARRTIDVELEYYGSKVGNEFVVGYGL
FT                   DFLNMYRNLPYVGVLKPEVIQHYANK"
FT   CDS             618235..620004
FT                   /transl_table=11
FT                   /gene="frdA1"
FT                   /locus_tag="LCRIS_00614"
FT                   /product="Fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00614"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50061"
FT                   /db_xref="GOA:D5H226"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D5H226"
FT                   /protein_id="CBL50061.1"
FT                   /translation="MTKQTIKAQADGRNGQIDFEIDLENNKISDVKVTKNSETPAIFNQ
FT                   AFGKLKKNIIDNQSFDVDAVSGASLMTQAMLDSGKKALAENNIALDGKKPEVVHEERQL
FT                   NVDVAVIGSGMAGLMAASRALSMGKKVVVLEKNGYLGGATILNGSNVVGTGSKVSAELF
FT                   GETAKKDSPNRLVQDITRECRGTNYPMLSKLLANNIGRAVDFITEFANLTYQKAETQTV
FT                   EHSVNRQIEMSSESSYELVTKVAEAFEKKGGQIILDTRVEKLNKDKAGKLVSLTAEGKH
FT                   QTISVNFKSLVLAAGGWGAREYQAHKTDIPYYGPMTSTGDYFDFAKNMNLVTRNLDWYK
FT                   VYPHGLEVEPGIAKLTTYSTKEATDMGAIFVNTDGKRIVNESAPYTHFRDAIAEQKGKV
FT                   AYIVMDQRTWDRFYELMLKYGFTKEEVQSFFDLDGEKSPVLVKGDLKTVAEKAGIDYQT
FT                   LKETVDNYTEDVKADYDPEFGRDKKFMHEFEGDTYYVIEQKLLFCTTLGGYETTDQMQL
FT                   LDNDMNPVSNFYAAGEIVGGANGHDSMPSMMNSWSYASGFVAGTTAADNTNYNYSTVSN
FT                   EQEADAVSGASEA"
FT   CDS             complement(620084..620251)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00615"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00615"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50062"
FT                   /db_xref="UniProtKB/TrEMBL:D5H227"
FT                   /protein_id="CBL50062.1"
FT                   /translation="MNESLPDIKFVDALVYLISELKELKQTSFEKIDEAINDFINQLPR
FT                   FIQIALKQII"
FT   CDS             complement(620351..620626)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00616"
FT                   /product="Polynucleotidyl transferase, ribonuclease H fold"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00616"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50063"
FT                   /db_xref="GOA:D5H228"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:D5H228"
FT                   /protein_id="CBL50063.1"
FT                   /translation="MAASNIRKKKHYLYSSIVEAQYHGHSFLLKLVFVSNRGNKNKYLV
FT                   LATTQTKLSSEEIIQLYGRRWQIKTYFKTSKQYLALDKSQVQSYDG"
FT   CDS             complement(620604..620915)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00617"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00617"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50064"
FT                   /db_xref="UniProtKB/TrEMBL:D5H229"
FT                   /protein_id="CBL50064.1"
FT                   /translation="MNSIEQIDTENDTKSLISSFINLIGLAKLTKQVNFKRKSTVSLTM
FT                   IISWLMSVHFARLSLFRAKSDKRFSVRTARNVLNDGRINWQKLLCLIAARLIGCFKHP"
FT   CDS             621238..623118
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00618"
FT                   /product="Fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00618"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50065"
FT                   /db_xref="GOA:D5H230"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D5H230"
FT                   /protein_id="CBL50065.1"
FT                   /translation="MKSGKYQVKAKGHGSESMPMEVDIDGDKVTSIKVDSSGETKGVAD
FT                   EVFRRLPKTIVENQTLNVDAVSGATISSHGVIDGVAEAIDEAGGDSTEWKNREKPAATK
FT                   VEDEEITVDVAVVGAGGAGLAAAVRSIQHGERVAVLEKYPQIGGNTSRAGGPMNAAEPE
FT                   WQSKFKALPGEKQTLEDLANTPIEQIDLEYRFDFERLQRQIKEYIDSGTDYLFDSTLLH
FT                   EIQTYLGGKRTDLKGNEIHGKYALVHELVTNALNSVKWLQDLGVKFDNSQVTEPVGGLW
FT                   RRGHKPVEPLGYAFIHVLGDWIREHGVDPYLETRVEKLIIEDGKVRGVIATRADSSTLT
FT                   VHAKAVILTAGGFGANTKMVQKYNTYWPNIADDSTTTNSPAITGDGINLGLEAGADLFG
FT                   MGFIQLMPVADPKTGELFTGVVTPPANYIMVNKKGKRFVNEFAERDVLAKAVIENGGLI
FT                   YQIADDKIKDTAYNTTQESLDAQVKAGTLFRADTLEDLAKQIGMNPAVLVKTIQDYNSY
FT                   VDRGEDPDFHKNVLGLKCEVAPFYATPRKPAIHHTMGGLVIDTKAHVLNKDGQIIDGLY
FT                   SAGENAGGIHAGNRLGGNSLADIFTFGRIAANTAYEDHQENDATSGASQY"
FT   CDS             complement(623170..624471)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00619"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00619"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50066"
FT                   /db_xref="GOA:D5H231"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5H231"
FT                   /protein_id="CBL50066.1"
FT                   /translation="MKRQISFGQALATVVGSVIGAGVFFKIGTITAQTGSTSMTLFVWI
FT                   LAGIISIASGLTISEIAASLKINGAIKYLDYTYGRVWGFLFGWAQMIVYFPAQIGALSS
FT                   IFGVQFVSLFGIKARYSNLIAILLVLFLLGINLIGTKFSSKMQSVITILKIIPIALIII
FT                   WGLFNPAKIPAPIIPLTVGTGHSFPTAISQGLLSALFAFEGWIVVTNLANEVKNPEKDL
FT                   SRAIILGLSAITLIYVLINYTFMTVLPIDQLTNNNNAAFQASMKLFGQFGGKLVTVGIL
FT                   ISVYGAVNAFMLTGMRTPYILAQDNLLPFSNKIGKANIHTGVPVVGAFIVDAIAIVMIL
FT                   LGNFTVLTDMLVFVMWTFNTMLSVAVIILRKREPELKRPFKVPWYPIIPIISVIGGIFI
FT                   VVSTIINQFVLSIIGIGLTLLGLPIYYYMQKKNN"
FT   CDS             624580..625287
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00620"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50067"
FT                   /db_xref="GOA:D5H232"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D5H232"
FT                   /protein_id="CBL50067.1"
FT                   /translation="MKRFQHKYTLPAILTLLILAIAFLLIGFFNFKRQTTLPPDANSSA
FT                   IGIELNQDIDYVDLHKLQSNGVSFIYLKATQGRSYFDENYLSYRDQILGTNLAFGSEIS
FT                   YSNESTPMQHYRYFFKQVGQNTGSLPILIVPAVTTRSARYLRSMGQFAALLQAAGKRVM
FT                   VKVDHKYQHYFNPQTLFMSSDSKAPNKLKYSFWCYTTNGRVRNVSGLESQVTMYAYNGT
FT                   VGQYKQKYGQLTQ"
FT   CDS             625290..626525
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00621"
FT                   /product="ATP-dependent RNA helicase, DEAD-DEAH box"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00621"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50068"
FT                   /db_xref="GOA:D5H233"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H233"
FT                   /protein_id="CBL50068.1"
FT                   /translation="MYQEKIKQVLIREHKDQPTLIQKESYDAIRNGASLVGLAKTGTGK
FT                   TLAYALPSLEKAQPGNANSVVIIAPTTELAVQIRHAINPYIHALGLKGVSLVGAGNRKR
FT                   QEDNLKKKHPEVVVATPGRFFDFFSSGRIKVNQIKTLIIDEADDILEFTKMELLSALGQ
FT                   NLGPDSQILLFGATDSEITRDAEQVFNRHFLLVDVRNEQASATKHYFLQVDNQHKIEFL
FT                   QRMTKLDHFKGILFFDSNKTMMRFAGIFGHTKTKFELLANEFGKERREKALNDLATGKT
FT                   KLLLATDLAARGLDIPGLTYVINFDIPSETNTYMHRAGRTGRMNAEGYVVTLGDDHDFR
FT                   DLKKLLADQLQIERVYFAGYHLTTEKPKLKKEKKQAKEQPIKTSTKKNKTKKRKKRNKN
FT                   KGYHPHYLKGKK"
FT   CDS             626522..627850
FT                   /transl_table=11
FT                   /gene="celB2"
FT                   /locus_tag="LCRIS_00622"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00622"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50069"
FT                   /db_xref="GOA:D5H234"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D5H234"
FT                   /protein_id="CBL50069.1"
FT                   /translation="MIRLVRWLEDYVLPLASRWGQIRWLVALRDAFVSLMPITMAGSLA
FT                   VLIKSLIEAAHDHLGWYAFAFAMQPLVAISNLVWRGTFSLFAFFLALALGYQLAKAFEG
FT                   NRLAASIVALSSFALSIANIAKIKFHGDNVTLHNAFDISQFSTTGLFTAILFGSLGFFI
FT                   YYACYKARIMLHVTSNLPHAEQAAFDSLLPAMIAIFGVGGINYLFQILTGKYFGNWLLT
FT                   TIQTPLVKWGQGFGTVIVITLLVQLFWFFGINGIGVLSPILDSIWMTAQNDNITAISNG
FT                   NIPPYVWVRGSFDVFAWFGGAGGTLMLIVAILMFSKRSDYRTIAKISLAPGIFNIGEPI
FT                   LLGLPVVLNPVYLIPFVLAPLVNVAFSYWVSIMGLVNPVQVAVPSIMPPVIGPFLACNY
FT                   DWRAIVLSILNMIVTLLIWMPFVKAADKIADTNHPKTFFNPQF"
FT   tRNA            627900..627972
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="LCRIS_02085"
FT                   /product="transfer RNA-Arg"
FT   CDS             complement(628043..628231)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00623"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00623"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50070"
FT                   /db_xref="UniProtKB/TrEMBL:D5H235"
FT                   /protein_id="CBL50070.1"
FT                   /translation="MNSSLLLLITTGLIILIGTFCLVFGMDKNRPAKTRKYLLYTALIC
FT                   VFLVWGLITAIMLHPLG"
FT   CDS             628337..629479
FT                   /transl_table=11
FT                   /gene="wecB"
FT                   /locus_tag="LCRIS_00624"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00624"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50071"
FT                   /db_xref="GOA:D5H236"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="UniProtKB/TrEMBL:D5H236"
FT                   /protein_id="CBL50071.1"
FT                   /translation="MRKIKVMTVFGTRPEAIKMAPLVLKLKKDDRFEEVTVVSAQHREM
FT                   LDQVLDIFKIKPDYDFNIMHQNQTLEEITSKVMIDLSKVIKEEKPDIVLVHGDTTTSFA
FT                   ASLATFYQQTTLGHVEAGLRTWNKYSPYPEEMNRQMTDDLADLYFAPTELSKANLLKEN
FT                   HHSDFIFVTGNTAIDALAQTVQQDYHHEVMDAITPGNKVILVTMHRRENQGEPMRRVFK
FT                   VMRQVIDSHPDVEIIYPVHLSPRVQKVANEVLGGDPRIHLIEPLDVVDFHNLAKRSYFI
FT                   MTDSGGVQEEAPSLGKPVLVLRDTTERPEGVKAGTLKLVGTEVDKVREEMLALLENKNE
FT                   YDRMANAKNPYGDGHAADRIMDDIYYYFNQDSESKPKDFE"
FT   CDS             complement(629443..630024)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00625"
FT                   /product="Cell wall teichoic acid glycosylation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00625"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50072"
FT                   /db_xref="GOA:D5H237"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D5H237"
FT                   /protein_id="CBL50072.1"
FT                   /translation="MANNKKDVTAVDQAQIRRLGQKLIKRHRNLWVYMVFGFVAALINT
FT                   LVFMVLHSWWHNVMVISNTIAFIVSNLASFWFNQKAVFINNVDHEHSTWHKLIVFFTYR
FT                   VISLIPDTLIMLVGLSWLHLNALLVKIIDQILVGVFNYLTTRSVFQKQEHTMIERAKMR
FT                   IQEQKIKETAKIKTVSLFFYSKSFGLLSLS"
FT   CDS             complement(630017..630463)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00626"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00626"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50073"
FT                   /db_xref="GOA:D5H238"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5H238"
FT                   /protein_id="CBL50073.1"
FT                   /translation="MKARIVYASMTGNDEDMADILEEDLQDYGFDVETSDVGFTDANDY
FT                   LDSDLCIFITYTYGEGVMTDELADFYGELKDLDLTGKHFAVMGSGDKTYGEHFCENVFD
FT                   YEKAFKDCGATEITKPVTIENAPDDDAVAAIDQAAKEMADKLNG"
FT   CDS             630676..631503
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="LCRIS_00627"
FT                   /product="Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00627"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50074"
FT                   /db_xref="GOA:D5H239"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniProtKB/TrEMBL:D5H239"
FT                   /protein_id="CBL50074.1"
FT                   /translation="MITIKSIRELKGMQASGHLLATMFEGLRDVIKPGISTWEIEEFCQ
FT                   DFVSSRGGRLSEQGFEGYKYGTCISVNDEIAHQTPRKDRILKEGDIVKVDVTCNLNGYE
FT                   SDSCTTYPVGEISEADKKLIEVTKKAMYLGIDQAVLGNRIGDIGAAIQHYVEDENHYGD
FT                   VRELIGHGIQPSIHEDPEVPHWGKAGHGLRLREGMTITCEPMVEAGGDWHIDQRTVDDP
FT                   NDDWVYYATPDGSNAAQFEHTFAITKDGPKILTLQHPYDGLEKYIPHFDEMDD"
FT   CDS             631512..632435
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00628"
FT                   /product="Membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00628"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50075"
FT                   /db_xref="GOA:D5H240"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D5H240"
FT                   /protein_id="CBL50075.1"
FT                   /translation="MKNGKNHFGLKIGQFISTLRTTLSQGEIFASSIIIAYYILFSIFP
FT                   IIIIIGNVLPLFHIDTAPIAEYLNLVFPDQVSKFIMPIINSLLKTTSTGYISFGIVFAV
FT                   WSLSNMVNAIRLGENRLYGVHQVELKLSMLNFLWTRTITFVFTGLMILVFTIATLALVF
FT                   GQQVLNFLGPIFQLPLNEISKIFSYRYPVLILVMMLALWYLNYVLPNIKLKKRVIWPGV
FT                   FVTVVGWLALSFLFSFYLHHFPITWENYGIVGTFIIFMLWLNIAAVLFLFGVGVNAAIV
FT                   RNRVGQVEYSAGRIASYIQKKRRKTK"
FT   CDS             632496..633398
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="LCRIS_00629"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00629"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50076"
FT                   /db_xref="GOA:D5H241"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H241"
FT                   /protein_id="CBL50076.1"
FT                   /translation="MKVRKAVIPSAGLGTRFLPATKALPKEMLPIVDKPTIQFIVEEAK
FT                   KSGIEDILIVIGKNKRPIEDHFDSNPELEQDLEEKGKKELLRLTEGITDLGVNLYYTRQ
FT                   PHPAGLGDAIFRARSFVGDEPFVVMLGDDLMEDKVPLTKQLIDRYNKTHASTIAVMPVP
FT                   HEEVSKYGVIEPENEIMPGLINVKSFVEKPDIDKAPSDYAIIGRYLLTPEIFDILANQK
FT                   PGRGGEIQLTDAIDTMNKTQRVFAHVFKGERHDVGNKEGYLETSIEYGLKHPEIKEQLR
FT                   AYIMQLSKKFEAEGKQNKK"
FT   CDS             633509..634672
FT                   /transl_table=11
FT                   /gene="atoB"
FT                   /locus_tag="LCRIS_00630"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50077"
FT                   /db_xref="GOA:D5H242"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5H242"
FT                   /protein_id="CBL50077.1"
FT                   /translation="MKDIYIVAAKRTPFGKYRGFFKDASAIDLGVMALKGTMKAGNIKP
FT                   ADVQALFMGNVLDTGLGENMARQVALHSGMSEASAAVTINEVCGSSLKALRLAQGQMEL
FT                   GDLDLVAVGGSESMTNAPYFVKKENKNDPADHLVSTMLNDGLMDAFSGKHMGITAENVA
FT                   EKYHVSRQDMDEFALQSHQKAAAAVKSGFFDNEILDVEIDGQSLDHDEPIRPDTTLEAL
FT                   SNLKPVFKADGEVTAGNSSPLTDGASMLVLATKEKMKELGLTPIAKLGEFAEAGFDPAL
FT                   MGYTPYYAVKKLLKKTGRNFDDYDIIELNEAFAAQSVAVARDLQIPTDKLNIMGGAIAL
FT                   GHPLGATGTRLVASAISGLKKRKGRRALVTLCIGGGQAIAYEIENAE"
FT   CDS             634669..635880
FT                   /transl_table=11
FT                   /gene="mvaA"
FT                   /locus_tag="LCRIS_00631"
FT                   /product="Hydroxymethylglutaryl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00631"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50078"
FT                   /db_xref="GOA:D5H243"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="UniProtKB/TrEMBL:D5H243"
FT                   /protein_id="CBL50078.1"
FT                   /translation="MKFYQLEPEARRKLLQDEGIALEQIDDAVLRRLDELSENVVGQLR
FT                   LPLGVVQNLIVNGQKYWVPMAVEEPSVVAAANHGASIFARNGGVTASSDRQGIYGQIVL
FT                   KVNNSFSLIELEKEFPHLVELANQKFSSLVRHGGGTRKITAVQKEDLLYLKVLVDPAEA
FT                   MGANKTNSILEFLAAKLENYAGVDEKLFAILSNYPSQLATAKVKINPQTIGGMQVAQRV
FT                   ALLGKIGLDDPYRAVTNNKGIMNGADAVLIATGNDYRAIEAATAVLANHDGQYRSLSKW
FT                   TMQGSYLVGELTLPMAIGVVGGSIKARHDVQQSFAILGQKITSKTLAEIIVSVALANNL
FT                   AALLAISTVGIQAGHMKLQARNVVTELTDDEHERKQLLAAIISEKNYSESHAKELLAKI
FT                   RKEK"
FT   CDS             635880..637046
FT                   /transl_table=11
FT                   /gene="pksG"
FT                   /locus_tag="LCRIS_00632"
FT                   /product="Hydroxymethylglutaryl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00632"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50079"
FT                   /db_xref="GOA:D5H244"
FT                   /db_xref="InterPro:IPR011554"
FT                   /db_xref="InterPro:IPR013528"
FT                   /db_xref="InterPro:IPR013746"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D5H244"
FT                   /protein_id="CBL50079.1"
FT                   /translation="MQVGIDQIGLFTPDKYVDMVDLANARKQDPNKFLVGIGQREMSVA
FT                   DITQDAVSMGINATLKFIDKIDKNKVGLLIFGTESSIDQSKSASLFVKTALKLKPEVRT
FT                   FEVKEACFGLTAALMMARDFVRVHPEQTAIVIGSDIARYGVNTAGEVTQGAGSVAMLIK
FT                   ADPSILALNNGHSAYSEDINDFWRPNYSRTALVDGKYSTQVYLDFFKKTFTDYKKQKGL
FT                   KTSDFDAITYHLPFTKMGMKANNIAIEGQDQATMIKLERSFAAAKQLSSRVGNIYTASL
FT                   YMSLLSLLENGELPAGSLIGLFSYGSGAMAEFYSGKLVEGYEKQIDPTADQAMLDRRKK
FT                   LTVKQYEDVFNTALLDPEDGLELTSDDEVGTWYFAGTKDHIRQYRVKE"
FT   CDS             complement(637074..637358)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00633"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00633"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50080"
FT                   /db_xref="UniProtKB/TrEMBL:D5H245"
FT                   /protein_id="CBL50080.1"
FT                   /translation="MRLTDLLQLIDDLNLNTKFYLKHDDKLLKWGKLTIAEGKCLLLPG
FT                   QTAMTKQKLIKLVGRMRGRGIPLLMVIDQKEYSIFGLQIREDTGQAILM"
FT   CDS             637452..638372
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00634"
FT                   /product="Hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00634"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50081"
FT                   /db_xref="GOA:D5H246"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D5H246"
FT                   /protein_id="CBL50081.1"
FT                   /translation="MKKKLLLSSALIAGAGLFAASEYFFKMAMTPFNKKADSKELSGKD
FT                   PLYRDKVWFRDFSKKKWTLKTDSGITLFAQYLDQHAKKTAILLHGFMSDGDSMAGFAKM
FT                   FYDFGYNVLVPDARAQGRSEGKYIGYGWVEKDDILRWIYQVIDQTGTNAKIVIMGQSMG
FT                   GATAMMVSGMLLPPQVKAFIEDCGYSTVKGEINYQAQNLFHMKAFPRFPIVDLVSGINR
FT                   VKNGFYLKDASAVAQLNKNTRPFLFIHGGKDHFVPTKMVWQNYAATAAPKQIWLAPLAG
FT                   HALSYPMYPKQYRQQVERFLQKYVG"
FT   CDS             complement(638812..640200)
FT                   /transl_table=11
FT                   /gene="rumA2"
FT                   /locus_tag="LCRIS_00635"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00635"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50082"
FT                   /db_xref="GOA:D5H247"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H247"
FT                   /protein_id="CBL50082.1"
FT                   /translation="MNRKFTHNKPKHEKDVIITIKRLGINGEGIGYYKKKIIFIPGALP
FT                   DEVVVAKIVKSYPHYIQGELVRIKEKSPDRVDFPQGVDPEIGGLELVHLSYDKQLEFKK
FT                   NNMLESLRKYHPRNYNKYKVKNTIAAPDPWHYRNKAQYQIEKDHGQLKLGLFAPNSHRL
FT                   IDLPKMPTQSEDTQKTERKIKVLIEKLHVPVANYRRHLPGIKTVVVRQSEATKEIQVTL
FT                   ITIGHKIKNLIPLAKEIMKLDHVVSVYQNETEWQNPQVWGNKTEKLLGKNQITEEILGK
FT                   KFALSPRAFFQLNPVQTINLYSEALKYLDLTPDQTLIDAYSGVGTLGILAADRVKQVVG
FT                   IETIPEAVKDAQHNVELNHIKNADYIQGSVEKVLPELQNSGVAINALIVDPPRTGLAKS
FT                   LIKTLLRVKPETFVYISCNPSTLAQDLVLLSEAYDVRVIQNVDMLPQTPRCEAIAKLVL
FT                   RKDR"
FT   CDS             640325..641137
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="LCRIS_00636"
FT                   /product="Regulatory protein recX"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00636"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50083"
FT                   /db_xref="GOA:D5H248"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="UniProtKB/TrEMBL:D5H248"
FT                   /protein_id="CBL50083.1"
FT                   /translation="MIITKVSAQKRQGRYNIFIDGKYAFSAGEKTLVEFVLLKGKELND
FT                   EQVEKIRQFDADAKASDLAAHFLSYEPRTIFEVLQYLKKHEISDEAANSAVSQLNELGY
FT                   LDDRQYAKLFIKNDLRVGSDGPKSLLRKLTQKGVDPEISQDKLDEIDEEDWLEVGQRVI
FT                   KSMSHQVGKISQRELERKMRTKLLTHGFDSGISNVIIDAMDLKEDENAQTEALKKQGIK
FT                   AYKRFRNLPEIERNFKIKKYLFSHGFSSGEIDAFLNGEIIDLDELVEY"
FT   CDS             641146..641628
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00637"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00637"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50084"
FT                   /db_xref="UniProtKB/TrEMBL:D5H249"
FT                   /protein_id="CBL50084.1"
FT                   /translation="MKKNIESRLFIGRPFPAGLMNAQKSFMEANQQMENDETFQKFLAD
FT                   HNLENKRSVLVVSGEDSFMYWYGVLADVAKDEVPTGLMKFELPAAEVAEEVEENQTLVF
FT                   FNLPLTSTVPNFAKKVVASGIEVHENLGDSDTPYITWDLDMDTKKLAQVMYLKASK"
FT   CDS             complement(641629..642090)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00638"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00638"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50085"
FT                   /db_xref="UniProtKB/TrEMBL:D5H250"
FT                   /protein_id="CBL50085.1"
FT                   /translation="MKKSHVLLVFTFLLLIPYICSLAIIGIGYNALVLHSAELYRTLIG
FT                   SLVGAIIMFAVKATIQRPVDLLAVQTNDGLLKQLLRFFSIRRRYWLLAANIILDFVLCF
FT                   AATYIIRALLTLDQIVGSSIGFVLLIMFVSTCLGAYVEYDNLSIDPEQH"
FT   CDS             642341..643060
FT                   /transl_table=11
FT                   /gene="tlyC"
FT                   /locus_tag="LCRIS_00639"
FT                   /product="Cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00639"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50086"
FT                   /db_xref="GOA:D5H251"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D5H251"
FT                   /protein_id="CBL50086.1"
FT                   /translation="MLEGILDFQGKTAREVMVPRTDAFMVDREVSFQDNLDEILREPYS
FT                   RIPVYQRDKDKIVGIIHIRTVLRKAKQKGFDNLDYKDVMTEPLFAPETAELGDLLMEMQ
FT                   QTQRQLAILTDEYGGVTGLATIEDLVEEIVGDIDDEVDHTEILFNQIAPNKYIIYGKMP
FT                   LDDFNEQFGTNLQMEDVDTIAGYVINTLKVIPAKEEKLTVDIGDGMTLTTRRMKGSRLL
FT                   TVLLTIDESKKEEDSED"
FT   CDS             643060..644631
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /locus_tag="LCRIS_00640"
FT                   /product="Peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50087"
FT                   /db_xref="GOA:D5H252"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H252"
FT                   /protein_id="CBL50087.1"
FT                   /translation="MDKELADKVKKRRTFAIISHPDAGKTTITEQMLLFGGVIRKAGTV
FT                   KARKTGNFATSDWMEIEKKRGISVTSSVMQFEYQGKRINILDTPGHQDFSEDTYRTLMA
FT                   VDSAVMVIDSAKGIEPQTKKLFKVVKQRGIPIFTFMNKLDRDGRPPLDLIAELEDLLGI
FT                   EGVAMDWPIGSGQTLKGLYDIANNRVELYRKNDQDRFLPLDQDGKLPDSEPLSQDPQFQ
FT                   DTLDEIDLIKEAGNKFDREKIAMGDQTPVFFGSALTNFGVETFLNSFVDLAPAPESHTV
FT                   NGDEELSPEDPEFSGFVFKIQANMNPHHRDRIAFVRVGSGEFKKGLDVTLARTDKPIRL
FT                   NNATEFMSSERVQVSDAVAGDIVGLYDTGNFQIGDSIYAGKRKIVYPPLPEFTPELFMR
FT                   VTAKNVMKQKSFHKGMNQLVQEGAIQLYRNYQTDEYILGAVGQLQFEVFQFRMKNEYNS
FT                   EVEMNSIGHRVARWIDPEQLDPRMSNTRNLLVKDRYGNPLFLFENEFAERFFHDKYPDV
FT                   KLTEKL"
FT   CDS             644646..645455
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00641"
FT                   /product="Transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00641"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50088"
FT                   /db_xref="GOA:D5H253"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5H253"
FT                   /protein_id="CBL50088.1"
FT                   /translation="MGINAALKKARQSRGLTQEQFVAGILSPAHYSKIERGLHDISAKD
FT                   LMAILQKNKISFAEFFKQNMISQADDENSLGDQLQIAYYNQDLNQVRKLVTKIQQLPHH
FT                   DLLKIKAKLIFTLLEGKRKFDVKDKNIILQRLFAGDNWLQDEFSLDLLANFGASIFTHD
FT                   DFTFFFQKIFTTYNDKMSEQTEKMQTTIATICVNYLYTCAENKFVKDNKEPIYLLGQLS
FT                   QTPSLVLYKIIGHFYQCYFAGDTEQVLAIKKLIKASNLENILSILPE"
FT   CDS             645557..647125
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00642"
FT                   /product="ABC transporter, ATPase and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00642"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50089"
FT                   /db_xref="GOA:D5H254"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H254"
FT                   /protein_id="CBL50089.1"
FT                   /translation="MKKFIDLKWFSLSIILSCLSGLSLPFSTWSYSEIFALITGKSIPN
FT                   TVRMIIVITVLQILLVIVEYLNNRVINRNVALFNQEVREYLMQTDFVKTGEKEISNRIS
FT                   FINNDLNLIEEKYFRQLFSLVSTVVKIVGIVTVALINSVVLTLVFVAFASLSSLIPSLF
FT                   SKKTAKQSSNWSKSTGSYVTFMSDLLKNINTVLNYNVLSLFVKKGSKVIKNSVENKRER
FT                   DDTIAKSDFYVDLLAYSLDFLPIGIGIIMVIQGHIALASFVAVQYSSAWIVNSFFSINS
FT                   IRNQIAATKPMTAKLLSFKPLTTKQDEAPVKFKQLNMDNVTFGYQADSPVLNNVSLCVN
FT                   KGDKILLTGKSGEGKSTLLKVLMGKLSPQKGRVLVNDQAVETQIFSEVQQSSQIFNETL
FT                   RFNLTLGKQFDQKQIVAAAQQAGLTNYLQKHGLDTVIEENGHNLSGGERKRIELARAFL
FT                   FQREILVVDEGTASLDPQTAEQIHNVFLNSPLTVIEIDHHISSTTMKKFTHHFDLENGK
FT                   LVNIF"
FT   CDS             647249..647992
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00643"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00643"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50090"
FT                   /db_xref="UniProtKB/TrEMBL:D5H255"
FT                   /protein_id="CBL50090.1"
FT                   /translation="MGHYVSNSLEFEKYRIYIVKEREIALSTYSSIHNSLQVLESGHVL
FT                   GCYNYISTLFDCSFVFKDYDDYNTVTFTNISKLANIYDKFGFVIDKFKHRSSGRYYGML
FT                   SNWNLNRNNYKFNEISNFDIARISKLTDENVQSVIPISYTNHKDSKNYLTDEFIQKEYP
FT                   FLHPTFESVITVLALNLSVCNTHNLEIYLEKIGALAQTICMNNSSNHVVNRPVKQVIPK
FT                   NWEKIDKFKRNKNLLPFYAVITTVV"
FT   CDS             648076..648264
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00644"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00644"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50091"
FT                   /db_xref="UniProtKB/TrEMBL:D5H256"
FT                   /protein_id="CBL50091.1"
FT                   /translation="MLEIETLFSTTSGYNYWKIIEYCPHCNLVRQTEEENLVNWLLDLK
FT                   GFGTRYARNTAAKLKKC"
FT   CDS             648359..648523
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00645"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00645"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50092"
FT                   /db_xref="GOA:D5H257"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D5H257"
FT                   /protein_id="CBL50092.1"
FT                   /translation="MESIPVFAQNMAVRVLAELGDVRRFSNLNKISVFIGIDRERYQSG
FT                   EMNSKFKHY"
FT   CDS             648635..648967
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00646"
FT                   /product="Cassette chromosome recombinase B1"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00646"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50093"
FT                   /db_xref="UniProtKB/TrEMBL:D5H258"
FT                   /protein_id="CBL50093.1"
FT                   /translation="MEDEGLINEGAVFIDGTKIEADANRYTFVWRKAVEKYHEKLKGQA
FT                   VELYDELITKEKEVVKKMEKEKVQTSQGLEKLARETEEEINQLTEEFLLGVTATLRPIM
FT                   TLPLCI"
FT   CDS             648979..649176
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00647"
FT                   /product="transposase (ISCpe5)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00647"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50094"
FT                   /db_xref="UniProtKB/TrEMBL:D5H259"
FT                   /protein_id="CBL50094.1"
FT                   /translation="MKNGQLKPGYNIQAATTDQYVVDYAIFPNPTDFKTLEPVFGHLKN
FT                   VFGMRRTHLRGKKRSKPILA"
FT   CDS             complement(649356..649637)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00648"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00648"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50095"
FT                   /db_xref="InterPro:IPR014959"
FT                   /db_xref="UniProtKB/TrEMBL:D5H260"
FT                   /protein_id="CBL50095.1"
FT                   /translation="MHLIDVTNNYSDLVHSQLNTTDANYVKVYSLGNTSVIYTESKDSI
FT                   GIALENHDRRVREDEIEFVIKRLIKDYDSSYTLTVDKSRHVIEIHVDK"
FT   CDS             complement(649783..651975)
FT                   /transl_table=11
FT                   /gene="clpE1"
FT                   /locus_tag="LCRIS_00649"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00649"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50096"
FT                   /db_xref="GOA:D5H261"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:D5H261"
FT                   /protein_id="CBL50096.1"
FT                   /translation="MLCQNCHERPASIHLFTKVNGQSREIDLCQHCYQELKNQQGNQGK
FT                   MNNNEFFGDFDDLFNALNGNNNNAANNNNEMRNNDPRMQMGGGAGNGGQNGRSLLDQYG
FT                   TDLTALAKKGKIDPVIGRDKEIARVIEILNRRTKNNPVLIGEAGVGKTAVVEGLAQEIV
FT                   DGSVPAKLQNKRIISLNVVSLVQGTGIRGQFEQRMEQLIKELQQNDDIILFIDEIHEIV
FT                   GAGNAEGGMDAGNIIKPALARGELQLVGATTIKEYRDIEKDSALARRFQPVEVKEPSID
FT                   ETIRILKGIQKRYEDYHHVHYTDEAIEAAAKLSARYIQDRFLPDKAIDLLDEAGSRMNL
FT                   TIPYIDKDKMQERINAAEQLKEEALKNEDYEKAAYYRDQIEKYEKVKDQKVDPDKSPVI
FT                   TDKIMDKIVEEKTGIPVGDIQKQEENQLQNLAADLKAHVIGQDKAVEKVARAIRRNRIG
FT                   FNKSGRPIGSFLFVGPTGVGKTELAKQLAKQMFGSEDAMIRFDMSEYMEQYSVSKLIGS
FT                   APGYVGYEEAGQLTEQVRHNPYSLILLDEIEKAHPDVLNLFLQILDDGRLTDSQGRTVS
FT                   FKDTIIIMTSNAGQGIKNASVGFTAENEDEANESARNNMSQFFKPEFLNRLDDVIEFNE
FT                   LTKPDLLKIVDLMLQNTNNMVKDQGLHIDVTAAAKDKLVEDGFNPALGARPLRRTIQEE
FT                   IEDNVADFKLDHAQAKNLKADVVDGKIVISDEANNE"
FT   CDS             652180..652362
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00650"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50097"
FT                   /db_xref="UniProtKB/TrEMBL:D5H262"
FT                   /protein_id="CBL50097.1"
FT                   /translation="MDYQKILDQLVSGEIKEYKVEPKDAFDLQKTIRNYGKRQYITGRA
FT                   ERGGAIVYTATNTDE"
FT   CDS             652475..652741
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="LCRIS_00651"
FT                   /product="Phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00651"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50098"
FT                   /db_xref="GOA:D5H263"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="UniProtKB/TrEMBL:D5H263"
FT                   /protein_id="CBL50098.1"
FT                   /translation="MEKRDFHIIAETGIHARPATLLVQAASKFGSDVNLEYNGKSVNLK
FT                   SIMGVMSLGVGQNADVTITAEGDDEKDALDAIADTMKKEGLAE"
FT   CDS             652741..654474
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="LCRIS_00652"
FT                   /product="Phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00652"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50099"
FT                   /db_xref="GOA:D5H264"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:D5H264"
FT                   /protein_id="CBL50099.1"
FT                   /translation="MTKTLKGIAASDGIAIAPAYLLVEPDLSFSKSSIADVEAEVARYN
FT                   DAIKTSTAEVEKIHDIAKESLGDEEAQVFEAHLMILNDPEFTGAIENEIKDSKINAEAA
FT                   LDETAKKFIAIFEGMTDNPYMQERAADVRDVSKRIMAHLIGKELPNPASIDHEVIVVAH
FT                   DLTPSDTAQLNKKYVKGFVTDIGGRTAHSAIMARSLELPAVVGTDSITKDVKNGDMLIA
FT                   DGLDGDAIIDPSDAQVADYKQKSEAFLKQKAEWAKLKNEPSVTADGKKFIIAANIGTPN
FT                   DMPGVKDNGAEAIGLYRTEFLYMDSSDFPTEEAQFDAYKEVIEGMNGKQTIIRTCDIGG
FT                   DKHLDYWDLPEEMNPFLGVRAIRLSMQYKDIFRTQLRALLRASAYGPLGIMFPMIGTLA
FT                   ELREAKQILAEEKDKLAKEGVKIGDDLQVGMMIEVPAAAVLADQFAKEVDFFSIGTNDL
FT                   IQYTMAADRGNDNVSYLYQPYNPSVLRLIKHTIDGAHENGIWCGMCGEAAGDNTMFPIL
FT                   LSMGLDEYSMSATSILRIRSLMKKLNTADIKELANEACYVSETAEDNEKLVNNLMKKLN
FT                   K"
FT   CDS             654698..655096
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="LCRIS_00653"
FT                   /product="Arsenate reductase related protein, glutaredoxin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00653"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50100"
FT                   /db_xref="GOA:D5H265"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023731"
FT                   /db_xref="UniProtKB/TrEMBL:D5H265"
FT                   /protein_id="CBL50100.1"
FT                   /translation="MVDLYVSPSCTSCRKARAWLEKHNIPFEERNIFSEPLTKKELLKI
FT                   LRMTENGTEEIISTRSRTFQQLRINLDDLSIDQLLDLVEKNPSLLRRPIIMDDRRLQVG
FT                   YNEDEIRRFLPRKVRRLELAEAQKIADL"
FT   CDS             655201..655947
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /locus_tag="LCRIS_00654"
FT                   /product="Negative regulator genetic competence"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00654"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50101"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="UniProtKB/TrEMBL:D5H266"
FT                   /protein_id="CBL50101.1"
FT                   /translation="MQVDHIDKNTIRVRIDKAELARRGMGMLDLLGNRQKIQDFFYKIL
FT                   DEVDEDHEFANGDPVSFQVMPNNGGLDLMITKVKPDDAQNLRKLMGDSFPKDEQSSTNS
FT                   DDSKSFFDLDEESTNSNSAPQGPATHNFFNQDDKNNEPTDWRSRKTQAYYFDDLGSLIE
FT                   LADNLKANDLASSLYYLHGQYFLNLAFLDEEYEELKPADAWTIANEFGFKVDSDKMRVV
FT                   EETGKCLLMQNALGQIRHYFLKAANY"
FT   CDS             656019..656867
FT                   /transl_table=11
FT                   /gene="coiA"
FT                   /locus_tag="LCRIS_00655"
FT                   /product="Competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00655"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50102"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="InterPro:IPR021176"
FT                   /db_xref="UniProtKB/TrEMBL:D5H267"
FT                   /protein_id="CBL50102.1"
FT                   /translation="MYAAMLNKKLVLAVDEACLVNARQKKLNRDNYHCPHCNKKVILVM
FT                   SEQKAAFFKHLVKYSNLMGEKEEHHQSKMLLKSALTAAGFPAEVEIPLAEGQLRADVLA
FT                   TAKLAFEVQCAPLSQQEFNHRHQLYQKIGVKDIWIVGQRHYLKRRLKRTQLIFFRQNKA
FT                   WGNYYLEINPQRNRFCLKYNVLEEPVANKLVYQSKSFVLDELGIKDFWRFKPFKKEYSL
FT                   NIATQRKYLRQQIMQKTKLGLKIGEMLYERKLTLDDLPDKVFATWRNPGERDRVSDFLQ
FT                   K"
FT   CDS             complement(656875..657492)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00656"
FT                   /product="Dithiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00656"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50103"
FT                   /db_xref="GOA:D5H268"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D5H268"
FT                   /protein_id="CBL50103.1"
FT                   /translation="MFEIFLFINPIGIYCYNTEKQIRKTVDELGVDVCYHYIPIANVCL
FT                   INDDAIRRRKDDQKLPDISNFSRATYEALENYHAIRLAYGNKKARQYLYKLQKNLSKDA
FT                   SAYTPELLKRIANKLHIKDADIQAIKQTDYLRTSIEEDQKLANQWNIKATPTTVIFNED
FT                   NEQNGVLLEGPINQQDLVNLMLPDCQKCFSDYLPAEHHLRLI"
FT   CDS             complement(657579..658187)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00657"
FT                   /product="Adenylate cyclase family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00657"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50104"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="UniProtKB/TrEMBL:D5H269"
FT                   /protein_id="CBL50104.1"
FT                   /translation="MSKNREIEAKILLNKSVYDQITAAFPIKSDFTQENYYFDTADDLL
FT                   KNHQISLRIRIYATHAEQTMKVPDPNPVQKNFHEVIEINDELTHAQAKKLVAKKHFKFT
FT                   GNIGAYLDNHFANDQKKLRLFTWSKTRRILMNGPQNCELTLDATSYPDNYQDFELEIEN
FT                   TNPALIQTVLTKLEQEYDFEQTAANTNQSKIARASAHQK"
FT   CDS             658264..658896
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00658"
FT                   /product="GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00658"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50105"
FT                   /db_xref="GOA:D5H270"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:D5H270"
FT                   /protein_id="CBL50105.1"
FT                   /translation="MELDWDNFLWPYNEAVRELKVKFRSLRQGFLTKGEHSPIEFVIGR
FT                   VKTVDSIKEKMKRRVISPDVIETDMQDIAGIRIVTQFVDDIYKVVDLIHARDDMEVVEE
FT                   RDYIQNAKPSGYRSYHMVINYTVYLPEGPKKLIAEVQIRTMAMNFWATVEHTLNYKYQG
FT                   VYPDDISARLKSTAEAAYRLDEEMSSIKDEVQEAQKIFTKNKGKEKL"
FT   CDS             658893..659696
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="LCRIS_00659"
FT                   /product="Inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00659"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50106"
FT                   /db_xref="GOA:D5H271"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D5H271"
FT                   /protein_id="CBL50106.1"
FT                   /translation="MKVTIAHNNYDETLKTVAQLKKLLQEKGFIFDARYPDVVITVGGD
FT                   GTLINAFHRYENQVDSVRFIGIHTGHLGFYTDWRNYDIEKMVDALAVTKGEPAKYPLLE
FT                   IKMLTESGETHYHLAVNESAVKRVSHTLEADVYINDQLFENFRGDGLCVSTPTGSTAYG
FT                   KSLGGAVIHPRLKALQMTEIASINNRVFRTLSSPIVIAPDQWISIVPNADHFVMTVDGA
FT                   RIDVRNAKKIEYRISRHSIQFDQFGHHHFWSRVQNAFIGDNEKND"
FT   CDS             659689..660594
FT                   /transl_table=11
FT                   /gene="rluD1"
FT                   /locus_tag="LCRIS_00660"
FT                   /product="Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50107"
FT                   /db_xref="GOA:D5H272"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D5H272"
FT                   /protein_id="CBL50107.1"
FT                   /translation="MTSLFKLIVQERDPKKLGPFLLKNGFSHQALNNAKHHHGMILVNH
FT                   KRRYTSFNLRAGDEVIFISGEEKKNDFLKPSNNPVSIVLENKNYLVVNKPAGVLSIPSR
FT                   YEDDDAVVNRLLGYFAQKGQKNLKPHVITRLDRDTSGLVLVGKNAISHARFSKIGKEKF
FT                   VKKYHAIVHGNFAPNELTGLIDQPIGKKGSGVKRAVVADGKDAQTAYRVLDQVTGASLV
FT                   ELRLLTGRTHQIRVHMAYLGHPLYGDPLYGIQDGFSRQALNCFYLNFPDPFSQQKCKTI
FT                   ELNDPKDMQELWQKLINKEF"
FT   CDS             660700..662475
FT                   /transl_table=11
FT                   /gene="mycA2"
FT                   /locus_tag="LCRIS_00661"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00661"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50108"
FT                   /db_xref="GOA:D5H273"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniProtKB/TrEMBL:D5H273"
FT                   /protein_id="CBL50108.1"
FT                   /translation="MYYSNGNYEAFADAKKPAGVDKKSAYIIGSGLAGLSAAVFLVRDA
FT                   QMKGENIHILEELPVAGGSLDGAKRPNAGFVVRGGREMENHFECLWDMYRSIPSLEIPG
FT                   ASYLDEYYWLDKEDPNSSNCRLIYNRGDRLPSDGQYGLGKCANEIVKLIMTPEKELQGE
FT                   TIEEFFSDDFFKTNFWTYWATMFAFEKWHSAAEMRRYAMRFIHHIDGLPDFTALKFNKY
FT                   NQYESMVKPLLAYLKDHGVQFEYDCHVDNVVVDHEGKQKVAKKIVMTKNGEQSDIDLTP
FT                   DDIVFVTNGSITESSTYGDQNTPAPITHDKGSSWKLWENLAKQDPDFGHPDVFCENLPE
FT                   RSWFVSATATLENKKIAPYFERLTKRSLYDGKVNTGGIITVVDSNWELSFTIHRQPHFK
FT                   SQNPDQIVVWIYALYSDTEGNYIKKRVVDCTGKEIAEEMLYHLGVPESQISELASEENM
FT                   NTVPVYMPYITSYFMPRHDGDRPDVVPEGSVNIAFIGNFAESPTRDTVFTTEYSVRTAM
FT                   EAVYTLLNVDRGVPEVFDSIYDIRQLLRAMYYMSDKKKLVDQEMPLPEKLALKTGMKKI
FT                   KRTWVEELLEEANLV"
FT   CDS             complement(662510..663055)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00662"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00662"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50109"
FT                   /db_xref="UniProtKB/TrEMBL:D5H274"
FT                   /protein_id="CBL50109.1"
FT                   /translation="MVRSHGIEDLAFLFLLNAICVAIPGLSNGIFCVLNGILYGPAWGF
FT                   IVNWISDILGQIILMELLQKLYDMKKMSNSKVYKLLTGLKSPMLGLIIGYMIPFIPSAT
FT                   VSYVNIMINKGQRKKQLIPIIIGVIPFAYLYAYGGDSILHLDGPRLIKVVISFVVIALI
FT                   AVAILLSLRAIKKRTKKA"
FT   CDS             complement(663314..664342)
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="LCRIS_00663"
FT                   /product="3-carboxymuconate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00663"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50110"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D5H275"
FT                   /protein_id="CBL50110.1"
FT                   /translation="MKVLIGGYTKKTSKGIYELPITGAANDTRLGKAENIISVGGPTYF
FT                   RKDGNLIFTVNNAGDKGGISVFQLSDQGANEVDHYLTPGSSPAYVGINRTKKLIYTANY
FT                   HTAVLSVFRYNDSGKLDLVDTITHKAETLGPRPEQVDGPHPHFFDETPAGNLVSCDLGN
FT                   DTVDFYRLENDQLKHIAQYKCETGFGTRHIVFSKDGNYFYVVGELSSQINVVKFNEDTW
FT                   DFENIATYKTIPADFTDHNGAAALYISQDGKYVYTSNRGHNSIAVFKVNDDHTLSLVQR
FT                   VSTFGDFPRDFNWDKDQRYVVVANQNTDNATLYTRNAGTGSLTPIQKEISVPEGTRVLF
FT                   TK"
FT   CDS             664522..664902
FT                   /transl_table=11
FT                   /gene="srlB"
FT                   /locus_tag="LCRIS_00664"
FT                   /product="PTS system, glucitol/sorbitol-specific IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00664"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50111"
FT                   /db_xref="GOA:D5H276"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="UniProtKB/TrEMBL:D5H276"
FT                   /protein_id="CBL50111.1"
FT                   /translation="MKWIANIKKIGKKAVDNKDGMVILFGEGANKDLEDVSVIQKFSTE
FT                   TPISGFVFKKGDTITVDGQTYVANYVGPMVESNMKALGHATLFFNRPVSKTPLANAIYF
FT                   DPDIDQPLPNFKVDDDIVYEHI"
FT   CDS             664919..666106
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00665"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00665"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50112"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D5H277"
FT                   /protein_id="CBL50112.1"
FT                   /translation="MENNQHRGGTVFKKWFLDNRFSIVLLNVLLFFLIIWVFNKVSFVL
FT                   NPAWIFFSAILPPLLLAVIQYYIMNPVVDWCERKFKIPRVVTIIVLFLLVVVALIWIIN
FT                   ILVPIAQNQINSLIKNWPHIWNDAVNATQNALQDPRLHSFKGSIKGMIDNTQKTLFKSG
FT                   QSTINATIGNISSAVSIITMVAMTLLTAPFILFFMLKDGHQLRPYITKFAPEKWQPSFS
FT                   KLLYDINYAVASYVRGQITVAFWVGVMFSLGYILIGLPYGVALAILAGFMNLIPYFGTP
FT                   LAMIPVIVISIMTSGSMLIKVLIVFAIEQTIESRILSPWVMGNKMEMHPITTILLLIGA
FT                   SAVWGLWGVVFGIPIYAILKIIVSRVYNYYRRESKLFEENAVSSTTGDADHDESE"
FT   CDS             666169..666729
FT                   /transl_table=11
FT                   /gene="cspR"
FT                   /locus_tag="LCRIS_00666"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00666"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50113"
FT                   /db_xref="GOA:D5H278"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5H278"
FT                   /protein_id="CBL50113.1"
FT                   /translation="MTNHVVLYEPLMPANTGNIARTCAGTNTVLDLIEPLGFQIDNKKM
FT                   KRAGLDYWDKVDVRRHDDLNAFLKTLGPNDEMYLISKFSSKNYAQVDYTDPNKNYYFVF
FT                   GKETTGLPETFMREYYDRNLRIPMSDNIRCYNLSNSVAMVLLEALRQQGFPNMETTHHY
FT                   ENDKLKDDYDRPERYERNLGENK"
FT   CDS             666729..667124
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00667"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00667"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50114"
FT                   /db_xref="GOA:D5H279"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR009530"
FT                   /db_xref="UniProtKB/TrEMBL:D5H279"
FT                   /protein_id="CBL50114.1"
FT                   /translation="MDFEKQTDIIVQAFHYDLVDEDTKPISDVRPGIRKLDVSGDDEHS
FT                   EENGSYYDVAIQYDVIPAPAMFEASGLIHQIVQLKDYHGDGSDISNSDWQLLTRPLVEQ
FT                   LETLIYETTQLTLGQPVNLNFKAEFDN"
FT   CDS             667137..669560
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="LCRIS_00668"
FT                   /product="DNA translocase ftsK"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00668"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50115"
FT                   /db_xref="GOA:D5H280"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H280"
FT                   /protein_id="CBL50115.1"
FT                   /translation="MPAKKKQRKAKKSYNKRKANKKQNLNWSICGLVLILIAGLAFVRF
FT                   GILGKQIANLIRMFFGDSYLFAAGLLGLFGLVNLIYNQPIHLTIKRSLGLAIAFLGILL
FT                   IQCNLYFEHELVNSNFLNSFWHAMAAEFGRAGVTESIGGGLIGSLAYQLFYPLLGQIGV
FT                   RVFAILLLPIGILMFFDVKFRTIIEKFQTVSQLFIKKNKEAGVKVKDKYNDVLEKRRQK
FT                   KEEQDEDLVDDDKPIFPNVADFDPADPTDDDVTPTAEDVEVEPETTPDPEPQIQIAPQH
FT                   DDGVKELPKSHSFAEDDQKLKQELADVDHGELKTDAPVNKAYKMPPLSLLDPIKSTDQS
FT                   TDRDLIKKNTQVLQSTFKSFGVKVIIKKAILGPTITRYEVQPAVGVKVSRIVNLADDLA
FT                   LALAAKDIRIEAPIPGKPFIGIEVPNRATSVVSFKDVMEHQDNKAKSDPMDVPLGKDVT
FT                   GSIISANLAKMPHLLIAGSTGSGKSVAINTILASILMKARPEEVKLVLIDPKMVELSVY
FT                   NGVPHLLIPVVTDAKLAANALRKVVKEMERRYKLFAAGGVRNMSEYNQKVAENNRDKTK
FT                   PVMKPIPYILVVVDELSDLMMVGGHDVEGAIVRLGQMARAAGIHMILATQRPSVDVITG
FT                   LIKANVPSRISFAVSSGVDSRTILDQTGAEKLLGRGDMLYMPIGASKPERVQGAYIASD
FT                   EVERVIEWVKKQQEVSYDETMIPKKGENSSNADSKDDEPADEFYEQAVDLVRRQQTASV
FT                   SMLQRRFRIGYNRAARIVDEMEAKGIVGPSEGSKPRQVLVPPIKNEGNSNNAHN"
FT   CDS             669547..670761
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00669"
FT                   /product="Protease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00669"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50116"
FT                   /db_xref="GOA:D5H281"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D5H281"
FT                   /protein_id="CBL50116.1"
FT                   /translation="MLTTNIAIRKNKKFTTAAIGCFLRLPLTKHNLAYASLLARIQMNS
FT                   SLSYPSLALQQKRLAELYDLQLEIMPQVFGKEILLTYYANFVEPIEILDPHYTYEEILN
FT                   VIAQIVNQPNFAEPLVEYAKRQLAEEYQELIEQPSNYALEQFFKLWYQDQPDYAETFIG
FT                   SLDEIKAATSTTMMHYWRNLANVPMQILGMTRDNNLVSKLAQAMFQQTGLTKSFQTASL
FT                   TIPAKRKLIEKEDDQGNVQAQLLMGFGLEQSIDYRGQVMGILLSQYLAGDQSSKLFTQI
FT                   REQLGAAYNVEASCFANNSLFLVSAGLDPSKIAAARKIILSEMGKLVRGEVEDDLFKKA
FT                   KKAILRNMKIGLDGQNWQMGQMLRDELFSGYLDFDRENAIRRATPKQLVAFAQNLFFNE
FT                   SYVLK"
FT   CDS             670758..672002
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00670"
FT                   /product="Protease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50117"
FT                   /db_xref="GOA:D5H282"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D5H282"
FT                   /protein_id="CBL50117.1"
FT                   /translation="MMTPKIIKKEYQSGFKAEIILKPHFYQRFFGIIVDFGSSDPQKVA
FT                   GSAHFLEHKLFAKKDGDLSTQFEDIGADVNAFTSFNETMFYCSGIEHTPKMIDLLFELV
FT                   GQPYFTKENIAQEAPIIEQELAMYQDDPTWSVNNAIMHDMFGDSNLGIEVVGTKESINQ
FT                   VTVKNLTQVYEANYVPEKMQFVACGDFSDNQVQTILRQVGKLQQKYLHGKGKSTAEKQV
FT                   SFRMLHDQVLPARGNSNSFGLGIRFKNFKKVLLSFDLTQILLEIMLESKLSAMGPWFEE
FT                   MRKKQLLMDSLQISVNYTRQGDFATIFGVSPQAQEVIAEIKRVLTEPIKKNSAEYRFIR
FT                   QNFILQKKEWLARTARTSNDLSYLAIELIEENLDHENLTQNIAKLQAMNFDQFYDYCQK
FT                   IMKDSELCSAYLENK"
FT   CDS             672016..672744
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="LCRIS_00671"
FT                   /product="3-oxoacyl-(acyl-carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00671"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50118"
FT                   /db_xref="GOA:D5H283"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D5H283"
FT                   /protein_id="CBL50118.1"
FT                   /translation="MKRAIVFGATGGIGQDICQDLADAGWSLYLHYHSNSQKAENLVQE
FT                   LFAKHPDQDFMSLQLDFATGDAQLTDFVKNLLPVNAVVFAQGITKYGFLGDEKLANITD
FT                   LININLTVPIKLTKLLEPQLMKRDFSRIVYLGSVYGGAGSALESVYSATKGGLTRFAQA
FT                   YAREVASNNLTVNVIAPGAVKTKMNAFFSEDTIQEVKDEIPVGRWANGSDISYWVRTLL
FT                   DRRSSYLTGQTIYVTGGWLL"
FT   CDS             672812..673891
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00672"
FT                   /product="Transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00672"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50119"
FT                   /db_xref="GOA:D5H284"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5H284"
FT                   /protein_id="CBL50119.1"
FT                   /translation="MADIGDKLKSAREAKGLSIADIEKATKIQSRYLEAIEKNEFDKLP
FT                   GDFYVRAFIRQYAQVVGLDGKELLSDYHDDVPEAKPDEYVENSIDNKSEEVRETTDNKK
FT                   NLWKNYLPRIAIGLGVIIVILVVYVLYARLSSGGQKNQADNNDVTVSSQKSSSSSSKKA
FT                   KKVVVNKVKVTKVSDNEYRVTGLNKNRRLVVRAGENQNISAGVQVNGNANSWQSTLLAN
FT                   QKHTMTLPSNAERVVITLGNDNGTSITIAGKKIPYTANNAYRTITLLIGKAKGTTSQNN
FT                   SSSNNTGSTNNNTTNSSSTQSRTTTQSSATHQSSRQQSSTTTQSSQQTQQSSQTQQSST
FT                   TQSSADTNNGNDGGNNNNN"
FT   CDS             673909..674469
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="LCRIS_00673"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00673"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50120"
FT                   /db_xref="GOA:D5H285"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D5H285"
FT                   /protein_id="CBL50120.1"
FT                   /translation="MNLPNKLTVFRIFLIPVFMLIIIFGGNASVQAAGSTVVWSRVIAA
FT                   IVFAVASATDWFDGHIARSRNMVTNFGKFADPLADKMLTMTAFIFLVELKLAPAWVVAI
FT                   IVCRELAVTGLRLILAENEGQVLAAKMPGKIKTTCQMLSIIFLLIGDFFHIGTILLYLA
FT                   LIFTIYSGYDYFHQSWGVFKGSM"
FT   CDS             complement(674482..674667)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00675"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00675"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50121"
FT                   /db_xref="UniProtKB/TrEMBL:D5H286"
FT                   /protein_id="CBL50121.1"
FT                   /translation="MAINVLLFFVPNNYTLTAVQFARETQTNVQRIFYPLLFITQKIAI
FT                   IFLQNKKEANASFNHS"
FT   CDS             674660..675760
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="LCRIS_00674"
FT                   /product="Protein recA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00674"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50122"
FT                   /db_xref="GOA:D5H287"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H287"
FT                   /protein_id="CBL50122.1"
FT                   /translation="MAKDEKQAALDAALKKIEKNFGKGAVMRMGEKADTQISTVPTGSL
FT                   ALDAAIGVGGYPRGRIIEVYGPESSGKTTVALHAVAEVQKRGGTAAYIDAENAMDPAYA
FT                   EALGVDIDSLILSQPNTGEEGLQIADTLISSGAIDIVVVDSVAALVPRAEIEGEMGDAH
FT                   VGLQARLMSQALRKLSGNISKTKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSTIR
FT                   LEVRRAEQIKQSGDVLGNRVKIKVVKNKVAPPFKVAEVDIMYGKGISQSGELLDMAADK
FT                   DIIDKAGSWYSYKSDRIGQGRENAKKYLEEHPDIYQDIQKQVRQAYGIDEKSIADREDP
FT                   EKIKEKREEAKTEKEAATDKKSDQAK"
FT   CDS             675876..677513
FT                   /transl_table=11
FT                   /gene="ymdA"
FT                   /locus_tag="LCRIS_00676"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00676"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50123"
FT                   /db_xref="GOA:D5H288"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="UniProtKB/TrEMBL:D5H288"
FT                   /protein_id="CBL50123.1"
FT                   /translation="MNNMLTIMIPVATAIVSLLVGSVVGYAIRKHSWEQKAQNAQNDAD
FT                   HILADAKAQVAAAQAEVNAQKQAAAAVKQSAENTKKEKILEAQEQIRDFRQKTEDELNS
FT                   KKDNLAREKNRLQQREDTLDHKNSLLDERESGLTQKEDQLKQQYASLKAKLTEAEELVE
FT                   TRRQKLYDVAKLDEEEAKKIVLSQLSDELVKERAEMIRNSNEEVKAKADHYANQVIVDA
FT                   IQSSAADTVAETTVSVVDLPNEEMKGRIIGREGRNIRSFEALTGIDLIIDDTPKVVTLS
FT                   GFDPIRREIAKRAMERLIKDGRIHPARIEEMVDKARKEVNDDIYEAGESALMELGIHRM
FT                   NPELVKTLGRLKYRTSYGQNVLSHSIEVGKLAGTMAAELGLDEKLAVRAGLLHDIGKAI
FT                   DHDIEGSHVEIGVELTRKYHEPDVVVNAIAAHHGDVPKLSFIAELVVAADTISSARPGA
FT                   RSESLENYIRRLTELEKIAKSYQGVKQAYAIQAGREVRVMVEPDEISDDRTVILARDIR
FT                   NQVEKELDYPGNIKITVIREKRVVAIAK"
FT   CDS             677618..678775
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /locus_tag="LCRIS_00677"
FT                   /product="Glycosyl transferase, group 4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00677"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50124"
FT                   /db_xref="GOA:D5H289"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D5H289"
FT                   /protein_id="CBL50124.1"
FT                   /translation="MFKIIVELFLLVIISAAITPFIRRLAFVLGAVDNPNARRVNKKPM
FT                   PTIGGLGIFVTFNIGTFVLLREQFPTHEIFSILLASSVIVLTGLIDDILELKPRQKMFG
FT                   IFIASLIIYFLAGIRMNVLKVPFIAHEVNLGWWSFPITIFWILALTNAVNLIDGLDGLA
FT                   DGVSMISLTTMGIVGYFFLHTHQLYVPIACFMLAACLLGFLPYNFHPAKIFLGDTGALY
FT                   IGFMIAVLSLKGLKNVTFISLLVPIIILGVPITDTVYAMIRRKLNKKPISEADKHHLHH
FT                   QLMRMGLTHRQTVLTIYALSLVFSFISLLFLLSPTWGTWLLILGLLIALEYFVESIGLL
FT                   GEKYHPLMHVIQKIINQKSKTDPTIEVWHLGDEKPDQLKSKKNNK"
FT   CDS             complement(678810..679472)
FT                   /transl_table=11
FT                   /gene="yvyE"
FT                   /locus_tag="LCRIS_00678"
FT                   /product="YvyE"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00678"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50125"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:D5H290"
FT                   /protein_id="CBL50125.1"
FT                   /translation="MSEKENFLTIKENGTGELIIKKSRFIANIARTTTTDAANDFIQKI
FT                   SKKYRDASHNTFAYTIGLNDDQVKESDNGEPSGTAGVPELKALQLMNLKNVTVVVTRYF
FT                   GGIKLGAGGLIRAYSNSVTNVVEKVGVIKRVLQQELIFSVPYNRFDEVDHYLKQQKIFI
FT                   ANTEYGVDVKIHIFVNDDQQAKPKEDLTNLLAGQVTFTNGEKRYNEIPVEANNYHEQ"
FT   CDS             679518..680798
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /locus_tag="LCRIS_00679"
FT                   /product="COMF operon protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00679"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50126"
FT                   /db_xref="GOA:D5H291"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H291"
FT                   /protein_id="CBL50126.1"
FT                   /translation="MEDLTLLSGRQWIVSQEDSSTFEGCRKIPVIEKGKCNRCGSQVNS
FT                   RLPNGKYYCRGCIGLGRANEGDWLIRKDSNNTFSHVKNGGLSWQGKLTPLQQNISDKLV
FT                   QNFEQRKNTLVHAVTGAGKTEMLFQLIAQCMKKGKRACIATPRIDVVNELFPRFSAAFA
FT                   QVEIGKYHGREFKEIGLEQLTICTTHQLMKFYRAFDLLVIDEVDSFPYVGNPQLHFAAK
FT                   NAVKTTGTRMYLTATPTNDLLLEAKTGKLEILRLNRRFHGGLLPVPRERFFIRPFLRKG
FT                   QIHPKLMQEIKKVIQSGHPLLLFVPRIEEIPLYQEALRKKLQNKIKLAGVHAQDPQRLE
FT                   KVQAFRDRKYDLLLTTTILERGVTFKNVWVIIIAADDAIYTAASLVQIAGRVGRAHDDQ
FT                   TGLVLYCYHRYTKNIRQSIKQIKGMNR"
FT   CDS             680795..681490
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /locus_tag="LCRIS_00680"
FT                   /product="Competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50127"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H292"
FT                   /protein_id="CBL50127.1"
FT                   /translation="MRTCLLCEQEFTPPVQFAQLFSFKPARKNKICLQCLKQFEKLADN
FT                   RCSGCDKELSQGFMCSDCRNWQAIYGKNILHNHALYRYNSAFHDLMVAYKRRGDYVLRE
FT                   VLQDLCYDYLCKTNYDFYVPVPTSPEHQSRRQFDTIFAIYADILPLTPLLIKQSGSHAQ
FT                   GEKNKEERLKTPQSFLIDKNIKIKENIVSGKVLILDDIYTTGRTLYHARDCLQQGFPEM
FT                   KIESFSICH"
FT   CDS             681571..682116
FT                   /transl_table=11
FT                   /gene="yfiA"
FT                   /locus_tag="LCRIS_00681"
FT                   /product="Ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00681"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50128"
FT                   /db_xref="GOA:D5H293"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:D5H293"
FT                   /protein_id="CBL50128.1"
FT                   /translation="MLKYNVRGENIEVTDALRSYVEKRLNKLEKYFELNQDVIAHVNLR
FT                   VYRDRSAKVEVTIPLPYLVLRAEETTDDMYRSIDFVSEKLERQIRKYKTRVNRKSREKG
FT                   LQDFFVEQPEEEEKKPSEFDIVRNKRVSLKPMDPEEAILQMDMLEHDFFVFEDAETNGT
FT                   SVVYRRNDGRYGLIETNE"
FT   CDS             682258..684657
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="LCRIS_00682"
FT                   /product="Protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00682"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50129"
FT                   /db_xref="GOA:D5H294"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H294"
FT                   /protein_id="CBL50129.1"
FT                   /translation="MANILKKLYNDDKRELKKFEKIADKVEAHADEMSKLSDEQLQAKT
FT                   PEFRDRLKKGESLDDILPEAFAVAREGAKRVLGLYPFHVQILGGIALHYGNIAEMMTGE
FT                   GKTLTATMPVYLNALEGKGVHVVTVNEYLSSRDEEEMGQLYKWLGLTVGLNLNSMSPDE
FT                   KRAAYNCDVTYSTNSELGFDYLRDNMVVYKEQMVQRPLNYAIIDEVDSILIDEARTPLI
FT                   ISGEAEQANSDYIRADRFVKTLTEDKSDDDADDDEDHGDYKIDWPTKTISLTRTGIEKA
FT                   CQHFGLKNLYDVENQKLVHHIDQALRANYIMLKDIDYVVQDGEVLIVDSFTGRVMEGRR
FT                   YSDGLHQAIEAKEGVKIQEESRTQATITYQNFFRMYKKLSGMTGTAKTEEEEFREIYNM
FT                   QVITIPTNRPIARKDMPDILYPTLDSKFHAVVEEIKKRHANGQPVLVGTVAIESSERLS
FT                   HLLDEAGIPHAVLNAKNHAKEAQIIMNAGQRGAVTIATNMAGRGTDIKLGPGVKELGGL
FT                   AVIGTERHESRRIDNQLRGRSGRQGDPGYTRFYLSLEDDLMKRFGGDRVKDFLDRLSDN
FT                   DDDKVIESRLITRQVESAQKRVEGNNYDTRKQTLQYDDVMRIQREIIYGERMQVIEADK
FT                   SLKNVLIPMIHRTIDHQVAMFTQGERKEWRLDSLRDFISSSLTSDKVTDSIDFKTISVE
FT                   DLKKKLYDIVEQNFEDKEKALGDPSQMLEFEKVVILRVVDDRWTDHIDAMDQLRQSIGL
FT                   RGYGQLNPLVEYQDSGYRMFEEMISNIEFDVTRLFMKAEIRQNLSR"
FT   CDS             684840..685838
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="LCRIS_00683"
FT                   /product="Peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00683"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50130"
FT                   /db_xref="GOA:D5H295"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D5H295"
FT                   /protein_id="CBL50130.1"
FT                   /translation="MAQPDFWNNQEKAQKLISETNRLKEKRDSFLKLQTSYEDETTAVE
FT                   LLREEPDPDLQKEVEADLATLQEDFHNYELDLLLSGKYDSHNALMEIHPGAGGTEAMDW
FT                   GQMLLRMYQRYCDTAGFKFEINDYEPGEEAGLKSVSARIVGKNAYGMLKSENGVHRLVR
FT                   ISPFDAAKRRHTSFASVEVIPEVDDSIQIDIDPKDLRVDVYRSSGAGGQHINKTSSAVR
FT                   ITHLPTGIVTTSQAQRSQLQNRETAMNELRAKLFHLEEEKKRKQKQALKGDQKEIGWGS
FT                   QIRSYVFHPYNLVKDLRTGHETADAQGVMDGKLQPFIYSYLQWLLSQENPD"
FT   CDS             685847..686119
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00684"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00684"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50131"
FT                   /db_xref="UniProtKB/TrEMBL:D5H296"
FT                   /protein_id="CBL50131.1"
FT                   /translation="MSLMGIVTLVLVALIILSLLFVLFKAFILLLPVAVIAILIIWLIY
FT                   RFTGRKNQDNMPSSGSYREWFKATSTSGPRPRKKARNVTTKDIDK"
FT   CDS             686134..687102
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="LCRIS_00685"
FT                   /product="HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00685"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50132"
FT                   /db_xref="GOA:D5H297"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D5H297"
FT                   /protein_id="CBL50132.1"
FT                   /translation="MADEVRLSKLIQDNQSILEVYQGQEYIKDEEIYVSDIYRPGLELT
FT                   GYFDFYPAQRIQLLGRTEISYAARLDHDIRMHVFNKMCTKATPCFLISRSLPVPEELTT
FT                   AAEEHKIPILRTRESTTYISSILTEYLRARLAKRTSIHGVLVEIKGMGVLLTGASGVGK
FT                   SETALGLVQRGHRLIADDRVDAFQKDHNTVVGEAPKILKHLMEIRGIGIIDVMNLFGAG
FT                   AVKNRTEIQLVINLVNWDPKANYDRLGFQENTREICNVPIPQVNIPVKVGRNIEIIIEV
FT                   AAMNFRAKKMGYDATQTFDNNLTSLISEHSKEDTNKVPHND"
FT   CDS             687095..687934
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="LCRIS_00686"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00686"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50133"
FT                   /db_xref="GOA:D5H298"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:D5H298"
FT                   /protein_id="CBL50133.1"
FT                   /translation="MTNLVINPVAFHLGNLSVKWYGIIMAVAIVLACWMAINEGKKRQI
FT                   IPDDFVDLLLWAVPLGYVGARIYYVIFEWGYYSQHPEQIIAIWNGGIAIYGGLIAGLIV
FT                   LLIFCYKRMLPPFLMLDIIAPGVMAAQILGRWGNFVNQEAHGAPTTLHFLQSLHLPQFI
FT                   IEQMKIGGTYYQPTFLYESFFNLIGLILILSLRHKKHLFKQGEVFMTYLLWYSVVRFFV
FT                   EGMRTDSLYIFGIIRVSQALSLILFIATIILWIYRRKVVKPKWYLDGSGLKYPYSRD"
FT   CDS             687975..688994
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="LCRIS_00687"
FT                   /product="Glycerol-3-phosphate dehydrogenase [NAD(P) ]"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00687"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50134"
FT                   /db_xref="GOA:D5H299"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H299"
FT                   /protein_id="CBL50134.1"
FT                   /translation="MIKIAVLGNGSWGSVLGSMLADNGNDVTLYGNIDSVNEEINAHHT
FT                   NSHYMKDWKLNENTKATGDLEAALDGAELVLFVLPTKAVRIVAKNVRKVLDKTGAKPLL
FT                   VTATKGIEPGSKKLISEILTEEIYPDDEDKIVAISGPSHAENVAQKDLTAIACASTNEE
FT                   NAKRVQELFSNDYVRFYTNDDLVGVEVGGAVKNVIAIAAGILVGQGYGDDAKAALMTRG
FT                   LAEITRLGVQYFGAKPMTFSGLSGIGDLIVTCTSVNSRNWRAGKQIGEGKTLDYVLKNM
FT                   GQVVEGATTVKAVHELCEEKGIDMPISEAIYRVLYEDADVDTEIKKMMGREPKPEIRL"
FT   CDS             689076..690014
FT                   /transl_table=11
FT                   /gene="trxB2"
FT                   /locus_tag="LCRIS_00688"
FT                   /product="Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00688"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50135"
FT                   /db_xref="GOA:D5H2A0"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A0"
FT                   /protein_id="CBL50135.1"
FT                   /translation="MADKYDVIIIGAGPGGMTAGLYAARANLKILVLDRGPYGGQMNNT
FT                   DAIDNYPGFSEIKGPELSQKMYDTMMKFEPDYKYGNVQSVELDGEDKLVKTDDGNEYRA
FT                   PIVIIATGSDHKHLNVPGEEEYSGKGVSYCAVCDAAFFKDEDVAVIGGGDSAIEEGIYL
FT                   SQLAKSVTVIHRRDQLRAQPTLQKRAFANKKMHFIWNAQTEEILGDDMKVTGVKYRDKE
FT                   TGAEKEIPVAGVFIYVGVLPQTEPFKDLGILDDHGWIVTDDHMETKVPGIFALGDVRQK
FT                   DLRQIANAVGEGSVAGQAAYNYYQDLQDKKN"
FT   CDS             690181..691905
FT                   /transl_table=11
FT                   /gene="pgm2"
FT                   /locus_tag="LCRIS_00689"
FT                   /product="Phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00689"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50136"
FT                   /db_xref="GOA:D5H2A1"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A1"
FT                   /protein_id="CBL50136.1"
FT                   /translation="MDAKEIYTEWQKATNLPDYLKDQLNTLGKDEKWIEDAFGQDINFG
FT                   TAGMRGRLEPGTNRINLFTVGRVTEGLARLIEENGADAKKRGVAISFDSRYHSREFAEH
FT                   AARVLGAHGIHVYLFDDLRPTPELSYAVRHLHTFAGINITASHNAKQYNGYKVYGEDGA
FT                   QMAPDNADRLFAYAQKVTDIFAVKAAPVKELRANGILQLIGEDVDEDYLNELKQVTVDP
FT                   EMVKANADKLKIIYTPLHGTGKMLYDRAFRQGGFDNVIPVPSQSIIDPEFPTTIKPNPE
FT                   YRDVFEPGFKLANKVNANVIIATDPDADRMGAAVRKTDGDFQVLTGNQIATLMAYYLLA
FT                   HMKENGQLTPDYEIVTSVVSSALPFKIAEDFGIKTKHVLTGFKYIGEEVDRMNKAGDAK
FT                   FLMGFEESYGYLFKPFARDKDAMQGALMFAEVASYYASRGMTVFDGLQEIWQKYGVAYE
FT                   ITRAIEMPGIGGQKKMAELMSKLRNEHLTEIGGSKVLKIQDFLQKETIENGKKTPLEGF
FT                   PESNVLKYFLDDETWVALRPSGTEPVIKAYVGVNKKDIATAEKAAEDYQKALADLLK"
FT   CDS             692008..694053
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="LCRIS_00690"
FT                   /product="UvrABC system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50137"
FT                   /db_xref="GOA:D5H2A2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A2"
FT                   /protein_id="CBL50137.1"
FT                   /translation="MIKRQKNRKFELVSKFKPAGDQEQAIDKLTAGFKKGYKEQILEGA
FT                   TGTGKTFTMANIIAKLNKPTLVITHNKTLVGQLYGEFKSFFPNNAVEYFVSYYDYYQPE
FT                   AYVPQSDTYIEKDSAINDEIDQLRHATTSALMERNDVVVVASVSCIYGLGDPKEYARSV
FT                   LMIHEGEEYDRNTLLRDLVNIQYDRNDIDFQRGRFRVRGDVVEVFPAGNSNHAYRIEFF
FT                   GDEIDRIVEVDSLTGEVIGERDSISLFPATHFMTNDEQLRRALGAISKEMKLQVKKFEG
FT                   EGKLLEAERIKQRTTYDMEMMGEVGYTNGIENYSRHMEGRKAGEPPYTLLDFFPDDFLI
FT                   LIDESHATMPEIRAMYNGDRNRKQTLIDYGFRLPSALDNRPLKLSEFEKHVNQILYVSA
FT                   TPGDYELERTDHKVEQIIRPTGLLDPKIEVRPIEGQIDDLVGEINKRIDRHERVFVTTL
FT                   TKKMAEDLTDYLKDLGIKVRYLHSDIKTLERMQILRDLRLGKFDVLIGINLLREGIDVP
FT                   EVSLVAILDADKEGFLRAYRPLVQTMGRAARNANGEVIMYADTITDSMRAAIKATKRRR
FT                   KIQMEFNKEHGITPKTIIKPIQDVISITKPSSEKEEKSDSFADLNFDELTAKQKKTMIS
FT                   NLQEQMQEAAKKLDFEEAANLRDAIMELQKSSRKPKTRKGKNFNGK"
FT   CDS             694043..696883
FT                   /transl_table=11
FT                   /gene="uvrA1"
FT                   /locus_tag="LCRIS_00691"
FT                   /product="UvrABC system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00691"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50138"
FT                   /db_xref="GOA:D5H2A3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A3"
FT                   /protein_id="CBL50138.1"
FT                   /translation="MANDKIVIRGAREHNLKDINLTIPKDKLVVITGLSGSGKSSLAFD
FT                   TLYAEGRRRYVQSLSSYARQFLGQMDKPDVDSIDGLNPAISIDQKTTSHNPRSTVGTVT
FT                   EINDYLRLLWARVGHPICPNDGTLIQRQSVDQMVDRVMALPERTKIQILAPVIRAKRGE
FT                   HKEVFKRVQRAGYVRVIVDGEMHEIGEDFELAKNKRHSIDIVVDRLIVKDSIKSRLFDS
FT                   VEAALRLSDGYMNVDVIGGEMLNFSEYYACPKCGFTVGEMEPRLFSFNAPFGACPDCDG
FT                   LGMKLAVDEDLVVPDKTKSLAEGALAPWKTSNYYTEMLEQACTALKIPMDKPFNKLTKR
FT                   QRDIILHGSTKPVKFHVTGDFGVNDTVQPFEGVMANVERRYKRPMSKFMRDVMGKYMTE
FT                   LTCSTCHGKRLNEKALAVKVMGKDIAEASELSIDKALDFFKDVKLSEQETMIAKPILKE
FT                   VRDRLSFLDSVGLDYLTLSRSANTLSGGEAQRIRLATQIGSNLSGVMYVLDEPSIGLHQ
FT                   RDNDRLIASLKRMRDLGNSLIVVEHDDETMRQADYLVDMGPGAGVYGGKVMAQGTPKEV
FT                   EQNPDSLTGQYLSGKKIVPVPLKRRKGNGKKITITGAQENNLKNINVDFPLGKFIVVSG
FT                   VSGSGKSTLVNMILKRALAQKLNNNSTKPGKYKSIKGYKNIEKIIDIDQSPIGRTPRSN
FT                   PATYTSVFDDIRTLFAQTNEAKLRGYTKARFSFNVKGGRCEACHGDGIIKIEMNFLPDV
FT                   YVPCEVCHGTRYNSETLEVTYRGKNIAQVLDMTINEATKFFENIPKIQRKLQTIVDVGL
FT                   GYVKLGQSATTLSGGEAQRMKLAAELQKLSTGKNFYILDEPTTGLHTDDIKRLLEVLQR
FT                   LVDEGNTVLIIEHNLDVIKNADWLIDLGPEGGERGGQIVATGTPEEVAKVKESYTGQYL
FT                   KPVLERDTKLTKEAKK"
FT   CDS             696956..697498
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00692"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00692"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50139"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A4"
FT                   /protein_id="CBL50139.1"
FT                   /translation="MDIFSSSRDNRGFDWGAFIAGILMVVVAFVLLRHPAKGLHAFVLI
FT                   FAIVSIVQGIVWLAAYSRFREFFSRSWVAIVSGVLDIIIGILFICSYDIGGLTIAYLFA
FT                   IWFFVDSVVGIAWSWHLRAFSTGYFVFNLILNILSLIIAFFLIINPVIAALSLVWLVAF
FT                   WLLVFGINEIVVAFMHR"
FT   CDS             697592..698473
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00693"
FT                   /product="Uncharacterised P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00693"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50140"
FT                   /db_xref="GOA:D5H2A5"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A5"
FT                   /protein_id="CBL50140.1"
FT                   /translation="MADEKKQLLIVTGMSGAGKTVVAHDLEDMGYFVVDNLPPTLLGSF
FT                   WDLINNSNDFHKVAVVIDLRVKTFYRDLLDEVNSLEDNGNVQATILFLDASDDVLVARY
FT                   KETRRLPPLANNGKGRLLDGIQEERRILMPIKNRSNYIIDTSNLSTKELKQKLINTFSD
FT                   RKRQPFSIEVMSFGFKYGMPIDADIVMDVRFLPNPFYISELRPFTGLDKRVFDYVMNKE
FT                   ETQVFYKKLLDLLETAIPGYIKEGKEKLTIAIGCTGGQHRSVSIAQQLARDLAKKYPVD
FT                   ITHREVSRYIRK"
FT   CDS             698484..699527
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00694"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00694"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50141"
FT                   /db_xref="GOA:D5H2A6"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A6"
FT                   /protein_id="CBL50141.1"
FT                   /translation="MPYGETRIVRVIKGRRPRVVVIGGGTGLPVILNALKDQNAEITAI
FT                   VTVSDDGGSSGSIRNFINVVPPGDIRNVLVSLSDLPQEEKNIFQYRFDSSDSFFSGHAI
FT                   GNLIIAALNEMHGNIFDAVQSLSKMMKIDGHVFPASNEPLTLNAEFVDGTTESGETEIT
FT                   SKDKRIKRVWVTDTDSDEEPRAVLPVLASIMQADAVVLGPGSLFTSILPNLMISNLGEA
FT                   VRETDAEVIYICNIMTQRGETDHFSDAEHVQVINDHLGGNYINTALVNGAKIDMSKFHP
FT                   EDYDAYLEPVKNDFEGLKKQNCRVITDDFIDQRHGLVFHDGEKVGKEIINLAFESMSRK
FT                   RMKENDG"
FT   CDS             699520..700455
FT                   /transl_table=11
FT                   /gene="whiA"
FT                   /locus_tag="LCRIS_00695"
FT                   /product="Sporulation transcription regulator whiA"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00695"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50142"
FT                   /db_xref="GOA:D5H2A7"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A7"
FT                   /protein_id="CBL50142.1"
FT                   /translation="MASYASEVKKELTSLEVHPEHAKAELAAFLRMNGVLNLHDHQFSL
FT                   DITTENPAIARRIFKLIKIAYGIEPLLIVSRKMKLKKNNQYLVRLNQKVQEILENLQIW
FT                   DPEKGLVTRIPQRIMTSREGAMSYLRGAFLAGGSVNNPETSRYHLEIYSTYEDHNEDLC
FT                   KLMNNYFYLNAKATKRRRGYIVYLKEAAKIGDFLHIVGALNAMLNFEDLRIMRDMRNSV
FT                   NRLVNCDTANMKKTASASAKQVEDIQLIEQENGLDDLPEKLQVLARFRLAHPELTLKEV
FT                   ANQIPDGPISKSGVNHRFKKLHELAESLRE"
FT   CDS             complement(700520..701104)
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="LCRIS_00696"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00696"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50143"
FT                   /db_xref="GOA:D5H2A8"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A8"
FT                   /protein_id="CBL50143.1"
FT                   /translation="MLVPTVIEQTARGERAYDIYSRLLKDRIIMLSGEINDQMANSIIA
FT                   QLLFLDAQDNTKDISLYINSPGGVITSGLAIMDTMNFIKSDVSTIAIGMAASMASILLT
FT                   SGTKGKRFALPNSTVLIHQPLGGAQGQQTDIQIAANEILKSRKKINEILHETTGQPLEK
FT                   IQKDTERDNYLTAEEAKEYGLIDEIMVNKKK"
FT   CDS             701299..702927
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00697"
FT                   /product="Conserved protein with bacterial Ig-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00697"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50144"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR025987"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2A9"
FT                   /protein_id="CBL50144.1"
FT                   /translation="MKYSNKILTATSAVALGVGLLIGSTNAVFADNSKTTDSNTDTAKT
FT                   DSSAKKGPAQTSTSYDLMVKVGSNKNYPVYKKISNGKPSGKIADASDYQYAHIQSDQRI
FT                   KTKDATYWRIYVNGRKVGYVNQNYFTRDAIAVPKTISLVQNSHYDFDPTDAVSYVTNYM
FT                   GTVIDTADIKISEDAIDCSTPGTYNVKYSYGKAKATVKVTVRKSTKEGIADADSVQAKP
FT                   FNGDLKSWKTYYGSSANYVTKTDFTPDKNKHAYDSESGKLDFTTRFFQPVLLSVYRDIK
FT                   NDDYINRVGHIPEGITMSNGWLYTSLLSSTLISNGHIVGYNLNHLTNAFNGQYLLDMSQ
FT                   KKFNSYVKNIKVSPYIPIGHGQAMGSTDKYIYVLNNNNKVSYKSNMSEELIQIRKSDMC
FT                   INKIWTIKCWNGSDSDGRYFNNGVVVNDHKLYTTLYNKEKDQTEYWEFNRKGDNWYPTM
FT                   VGATKGGIVANTYTQGFTYDAKNNNFYLAFNDVIAKIATDGEVKDTYQYHTGREIEGIA
FT                   TYNNKLYMNLAQRAELLESKQKLTK"
FT   CDS             703036..703674
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="LCRIS_00698"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00698"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50145"
FT                   /db_xref="GOA:D5H2B0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B0"
FT                   /protein_id="CBL50145.1"
FT                   /translation="MKILELKHIQYSADKKQILQDVSFKVNKGDFLTLIGPSGAGKSTI
FT                   LRLIANLISANSGDILYQEKNISSLNPVQYRREVSYCFQQPSLFGQTVRDNLIFPYEIR
FT                   KVDVNDKQIADLLNQVDLSADFLDKKITALSGGEKQRVALIRNIIFLPEILLLDEVTTG
FT                   LDNQSKDIVHNLIKDVSEKGVTIIQVTHDQSEIDEASNILRVKKGGIIE"
FT   CDS             703671..704429
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="LCRIS_00699"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00699"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50146"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B1"
FT                   /protein_id="CBL50146.1"
FT                   /translation="MKNVVVSNWSLVLAFALVLVSIGISAKEKLGLTKDILISVIRAII
FT                   QLVVIGYVLKFIFHVNALWLTLVSTIVIIFNASWNANQRDPNPGRNIWNSIIAEAVGTY
FT                   VTLGILIFSGVIKPVPMQVIPITGMIAGNEMVAVGLCYKALNDSFNDLHQQVLEKLALG
FT                   SDIKTASMSILRRSIKTAMQPTIDSAKTVGLVNLPGMMSGLIFAGVNPIYAIKYQIMIT
FT                   FMLLSATGLGAVISGYLAYKNYFNDRMQLK"
FT   CDS             complement(704676..705236)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00700"
FT                   /product="Uncharacterized conserved secreted or membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50147"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B2"
FT                   /protein_id="CBL50147.1"
FT                   /translation="MILLILIVAAIMFIYFNIIPGKRHTFIAWLSLIITILCVVGIVEH
FT                   DYNHWGMKTKTTSSTNTLVSSATPRLPILLYQPLGNGTEKVYLYKTGQLQKKPKSIKLD
FT                   KVSTKVKRNSQPKVTIKTTRYTYSNTFNQIMFGVFGHDKELKHREYIFSIPSNWKVMSV
FT                   NDAKQLQKQMMKKQQFLKQKSAQ"
FT   CDS             complement(705237..706709)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00701"
FT                   /product="Drug resistance transporter, EmrB/QacA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00701"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50148"
FT                   /db_xref="GOA:D5H2B3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B3"
FT                   /protein_id="CBL50148.1"
FT                   /translation="MNKQPTDIHGKAYNRNLLVLVLIIGSFCTVLNGTLLSTALPSIMR
FT                   SFNISTATAEWLSTAFLLVNGVMIPISAWLINRFGSRKMYLSAMSIFFIGTVIAAIAPN
FT                   FGTLLAGRIIQGLGVGVTMPLLQTIMLSIFPANKRGAAMGTVGIVIGLAPAIGPTLSGW
FT                   IVDNLSWRYLFSIIAPIAGIVIILAFFLIKDVLPTKKEKIDVWSVTTSTLGFGSLLYGF
FT                   SEAGNKGWTNPEILGFIGFGIIFVILFGIRQLKMDDPFLDITVFKHFEFSLAAALSGIT
FT                   NLAMVGIEMVLPLYIQNLRGVSAFHSGLMLLPGALMIGIMSPITGRLFDKYGARKMAIT
FT                   GMTLLTIGTIPFVFLTEQSSYTMIIILYAIRMVGVALVMMNVTTSGMNSLPLNKISHGT
FT                   AVNNTFRQVLSSIGTAILVSVLTTTTNNNMPGKSLLHALPLEYKTRAISATLDGFHASF
FT                   AMSILFSLIALVLAFFLKKGNRAREHQEKVDG"
FT   CDS             706870..707307
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00702"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00702"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50149"
FT                   /db_xref="GOA:D5H2B4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B4"
FT                   /protein_id="CBL50149.1"
FT                   /translation="MKSKKIMHDIFQNLEIGIGEVSKLTGVSQRQLRYWETKGYIKPIS
FT                   DDQSGVRRYNLATLYLIVFIKEQLDEGFTLSAAFEHSKDIRLKSRIVHQFFRETFDDVK
FT                   VTDSTKGYGEIDLGEFQAEDGSMHHFKGVVDEKGQYVKMDE"
FT   CDS             707391..708176
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00703"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00703"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50150"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B5"
FT                   /protein_id="CBL50150.1"
FT                   /translation="MKKRFLIAGASAVMVTLSLTALNSKPVKAAKNAVDFMTYLSKNKS
FT                   LTKGQRSSARSAVKLLKTGRLGKKPKASWYNEYVDLHSNDDATSAKNIKAVLPYLDSVN
FT                   RVRRNEGVRSLKVSPLLTAASMLNADYQKRGDLKHTHYFKSIGLENIATQSVGLDPVDT
FT                   WFSEKKSWNYDVKKNHSLKPAKYSPTWTATYDAAVKGTNGYKMAGHYLNLINRNYRVMG
FT                   FANVSNTGYGNADSYLGSSKGAGISVAKYKALVNAWANK"
FT   CDS             complement(708243..709676)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00704"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00704"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50151"
FT                   /db_xref="GOA:D5H2B6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B6"
FT                   /protein_id="CBL50151.1"
FT                   /translation="MVESQNNSKKMMWTTLAMMAFSTVWGFGNVVNGYVYFDGTKVVFS
FT                   WIVMFLLYFVPYALMVGELGATFKNAEGGVSSWVNATMGAKWAYYAGWTYWACHVVYIS
FT                   SKGTGGLRAMAWGIFGNTKWYDGLPTAWTQFATLVVFLLFCWVASRGIPVLKGLATIAG
FT                   SSMFIMSILFIIMMFAAPAINPSAGFHSIDFNWKNLMPTFNVKYFTSLSILVFAVGGCE
FT                   KISPYVNKVKDPSKNFPKAMMALAIMVMVSAILGTFAMALMFDPKVVNANLNEYISNGA
FT                   YMAFDKLGEYYHVGGLFMYIYSWCNVIGQFSTLVISIDAPLRMLLGSKEAKEFIPKGLL
FT                   KLNKHGAYINGIWMVVVLSGGLIAIQALVPNAQAVMAQLVKLNSTTMPLRYLWVFAAYV
FT                   ALRKQQQKFNTTYQMTKHQGLAYTAGIWCFVVTAACCILGIYSPDPFTLFLNILTPIVL
FT                   IALGLILPGIKKHQEAKAK"
FT   CDS             709845..711377
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00705"
FT                   /product="Conserved protein with bacterial Ig-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00705"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50152"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B7"
FT                   /protein_id="CBL50152.1"
FT                   /translation="MLKGKKMLLTFVASAALVGGVFAISQSKVDAKSYSKAVTKIAGNG
FT                   NYAIYHNVSKKGPSGAFSNTKYFKHGQIQSKKYVSTKKGNFWYIIVDGRNVGWVSQNFF
FT                   ARNQISVAQDVSLVHNSNYSFPTRDAINYATDGQGTAINPDRVNVSHSSVSSSRAGTTK
FT                   VDYSYGKAKASVNVTVRSDTNEGITSAGASVKSGPKAVHTWNGGSKGSSRNWNQAHGYR
FT                   SETSSNSYSGNGMTLRTRLFQPRFVSLGYGQAADAMGQVGVIPEGVTVNDGIFTASMYT
FT                   SSSDSRGHLVSYNLNAIKSKYAAQNLTTMGWSTFRSYANNIKVSPYIKLGHGQSLGSSS
FT                   SYIYVLANNNKTANSTASEEIMQVRKSDMKINKIWTVKTWNGSSAYPRYFHNATFVGDN
FT                   TMYALFHNGGRHQYEYWKLTRNGDTWTPEEIGATQSNFVTGSPVQGFAYDSNHNQFYIG
FT                   FNDYIFRVAANGTYKGSHHFNTRREIEGLSVSGSTLYTELAQRAELMTTSTK"
FT   tRNA            complement(711472..711543)
FT                   /gene="tRNA-Arg"
FT                   /locus_tag="LCRIS_02097"
FT                   /product="transfer RNA-Arg"
FT   CDS             711791..712822
FT                   /transl_table=11
FT                   /gene="cggR"
FT                   /locus_tag="LCRIS_00706"
FT                   /product="Central glycolytic genes regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00706"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50153"
FT                   /db_xref="GOA:D5H2B8"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B8"
FT                   /protein_id="CBL50153.1"
FT                   /translation="MDSDFSLLEALVPDVLKILRQRYLVLEQISLHAPIGRRSVAQHLG
FT                   LSERNIRTETEYLSQLGLIETKSFGMFLTEKGEKTLKDAGPLLDRLFNAGETEVALAKK
FT                   LGIERTLIVPGNADFQDRVYEEMGEKLSSALNLLLPLGHSIVTILGGAALARSAKYLSP
FT                   DLANNRQLEFVPGRGALGENVETQSNTIVQEMAAKTSGTYKTLYLPEQVSDDAYKSLIR
FT                   ESSIADVLQDISQSDAVIHGIGLAQEMAQRRGYNSIKLSELREKRAVTECFGCFFDEHG
FT                   KVVDRITQVGLQFENLYKIPQIFAFACGARKAQAIKAYMPNAPHQTWLITDEGASNMIL
FT                   KGK"
FT   CDS             712875..713891
FT                   /transl_table=11
FT                   /gene="gapA"
FT                   /locus_tag="LCRIS_00707"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00707"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50154"
FT                   /db_xref="GOA:D5H2B9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2B9"
FT                   /protein_id="CBL50154.1"
FT                   /translation="MTVKIGINGFGRIGRLAFRRIMDLGEKSKDIEVVAINDLTTPAML
FT                   AYLLKYDTTHGTFNHEVSSTEDSIVVDGKSYHVYAEPQAQNIPWVKNDGVDFVLECTGF
FT                   YTSKAKSQAHIDAGAKRVLISAPAGNDLKTIVYSVNEDTLTADDKIVSAASCTTNSLAP
FT                   MANALDKEFGIEVATMTTIHAYTGTQMTLDGPSRSGKEQDARAAAENIIPHTTGSAKAI
FT                   GLVLPNLNGKMNGHAQRVPVPDGSETELVSILSKKVTADEVNEAMKKYESPSFAYNGDH
FT                   IVSSDVLNMTAGSIFDPTQTMVTTAGDKQLVKTVAWYDNEYSFTCQMVRTLLHFATL"
FT   CDS             714006..715217
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="LCRIS_00708"
FT                   /product="Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00708"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50155"
FT                   /db_xref="GOA:D5H2C0"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C0"
FT                   /protein_id="CBL50155.1"
FT                   /translation="MAKLIVDDLDVKGKKVLVRVDFNVPIKDGVIGDDNRIVAALPTIK
FT                   YIIEHGGKAILLSHLGRVKSDADKKELSLKPVAERLSELLKKPVTFVPSNEGKEVEDAI
FT                   NNMKDGDVIVLENTRFQDIDNDFGKRESGNDPKLGEYWASLGDMFVNDAFGTAHRSHAS
FT                   NVGIATAMKEAGKPAAAGYLLEKEIKFLGDAVENPVHPFVTILGGAKVSDKIGVIENLI
FT                   PKSDHILIGGGMAYTFLASQGHSIGKSLFEADKVDLAKELLAKAGDKIVLPVDNVAATE
FT                   FSNDASREVVGDDIPDNMMGLDIGPKTVEKFKEILKDAKTVVWNGPMGAFEMPNFAEGT
FT                   LEVGRALADLKDATTIIGGGDSTAAAKQLGIAPKITHISTGGGASLNYLEGKELPGIAC
FT                   VSDK"
FT   CDS             715242..716000
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="LCRIS_00709"
FT                   /product="Triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00709"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50156"
FT                   /db_xref="GOA:D5H2C1"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C1"
FT                   /protein_id="CBL50156.1"
FT                   /translation="MSRTPIIAGNWKLHMNPEQTTEFVNAVKDKLPDPSKVESLICAPA
FT                   VDLDALRKAAEGSNLHIGAENCYFEDEGAYTGETSPKVLKEMGMDYVIIGHSERRGYFH
FT                   ETDEDINKKAKAIFANGLKPIICCGESLETREANKQEDWVVAQIKAALDGLTAEQVSSL
FT                   VIAYEPIWAIGTGKTASSDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKE
FT                   LMAKPDIDGGLVGGASLVPESFLELVNYQD"
FT   CDS             complement(716487..717002)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00710"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50157"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C2"
FT                   /protein_id="CBL50157.1"
FT                   /translation="MRFWLELNQEKDYGQIPVLNQNGKAEFFIQGNLDNPNHTLYLNNF
FT                   RKQEVGRLFSDGAGLIASFTIDVVNHSLVGVKKLNTPTANIFYLTQLKYIVTGSIKRGT
FT                   YTFRSGIKSVASVQTIMGDRGGVLICDITKPEDVPFILLTSVLFTQWHVTPLKLPSFPP
FT                   IGFEVNPN"
FT   CDS             complement(717022..717897)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00711"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00711"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50158"
FT                   /db_xref="GOA:D5H2C3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C3"
FT                   /protein_id="CBL50158.1"
FT                   /translation="MIKLVACDLDGTLFNSEMAVSAANAKAVKNAQSSGIEFLIATGRA
FT                   PRESRSVLKDADLHTGFINLNGALVFDENEQLMIKHSIPKAKAQQLVHLLHRAGFYFEI
FT                   LTANQVYSENLDQRISNVAHLMVDLNPLLDFRQAVAISAGNKTIMNMKQIHSFDNLLQD
FT                   PKIEVMKIIAFDSRGHEAFTDIKKEIATMGDLVVTSSSSSNIEINEQHAQKGLALLDYA
FT                   KLKGIKPEEIAAIGDNLNDESMIRAAGTGVAMGNAIPAIKKIAQVVTKRNNEDGVAYIL
FT                   NKFIADNNNI"
FT   CDS             717965..718663
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="LCRIS_00712"
FT                   /product="Uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00712"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50159"
FT                   /db_xref="GOA:D5H2C4"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C4"
FT                   /protein_id="CBL50159.1"
FT                   /translation="MAKELIGNDWDQVLDPVFASEKYHELHNFLKEEYSTKQIYPDMYH
FT                   IFTAFKLTPFAKTKVVILGQDPYHNPGQANGMSFSVMPGTTLPPSLKNIYKELYDDVGA
FT                   RPVNHGYLKKWADQGVLLLNAVLTVPYGHANGHQGKGWEDVTDTAIKVLSERGKVVFIL
FT                   WGRFAQNKIPLIDQSKNFIIKSSHPSPFSADRGFFGSRPFSRCNMALKNFDETPIDWQL
FT                   PETISKSDLA"
FT   CDS             718674..719663
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="LCRIS_00713"
FT                   /product="Phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00713"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50160"
FT                   /db_xref="GOA:D5H2C5"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C5"
FT                   /protein_id="CBL50160.1"
FT                   /translation="MSVFSLFKKQVEAAKDKKRIVFPESDDLRILTAIANLKKDGIIEP
FT                   ILIGNPDEIAKLAKENNLDLAGVKIYDLNHYDELDQMAAEFVKARRKDTSIAEAKLKLA
FT                   QGNYFGTMLVKMGKADGMVSGAAHSTANTVLPALQLIHAAKGMHRVSGAFVMEKGDERY
FT                   IFADCAININPDEETLAEIGYQSALTAKMAEIDPKVAFLSFSTKGSAEGPMVDKVHDAA
FT                   AMFQKDHPEIPADGELQFDAAFVPAVSEKKAPNSKVAGHANVFVFPELQSGNIGYKMVQ
FT                   RLGGFTAVGPILQGLAAPVNDLSRGCSEQDIYDLAIVTAAQALAKDEK"
FT   CDS             719663..720142
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00714"
FT                   /product="ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00714"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50161"
FT                   /db_xref="GOA:D5H2C6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C6"
FT                   /protein_id="CBL50161.1"
FT                   /translation="MTKLEINSADGMQKLGASLAKTAQPHDLLLLNGDLGAGKTTMTQG
FT                   LGRALGIHRPVKSPTFTIVREYREAKLPLFHMDFYRLENDDLSSIDLEGYLAEPGLVVI
FT                   EWPQLVMNDLPDEYLQLTITRVDDSWDSTKRVVEFTPHGKRNEEWVKAALTEFNK"
FT   CDS             complement(720180..720713)
FT                   /transl_table=11
FT                   /gene="dnaQ1"
FT                   /locus_tag="LCRIS_00715"
FT                   /product="DNA polymerase III, epsilon subunit related 3'-5'
FT                   exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00715"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50162"
FT                   /db_xref="GOA:D5H2C7"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C7"
FT                   /protein_id="CBL50162.1"
FT                   /translation="MNFIAMDFETANHYPESACSLALVMVRNNKIVDRFYTVINPQMPF
FT                   DARNIQIHQITAEDVKNAPTMAEVWPHIKELYQPGMLVAAHNARFDTNVMRQSLARYGI
FT                   EEPHYLVIDTLASSKLLEPELPDHKLDTVSEALNVELWHHHNALSDSEACAGILIKQEE
FT                   QFGDEAIKNLVYQI"
FT   CDS             720809..721705
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="LCRIS_00716"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00716"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50163"
FT                   /db_xref="GOA:D5H2C8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C8"
FT                   /protein_id="CBL50163.1"
FT                   /translation="MELLDLKEKGIDIKEQIPLSRYTFTKTGGPAEYLAFPKTTDEVEQ
FT                   LVKVTRENEIPLTIIGNASNLIIRDGGIDGLVIILTELKEIKVEDNQVTADAGARIIDT
FT                   AFAAAHHGLSGMEFAAGIPGSIGGGIFMNAGAYGGEMQEVVQSVNVLTRAGEFKTYSNA
FT                   EMNFSYRHSLVQENGDIVLSATFALKSGDKLEILDHMHYLNALRRYKQPLEYPSCGSVF
FT                   KRPTGHFVGPMIIKAGLQGKQIGGAQDSMKHAGFIVNKGGATATDYLNLIHLIQKVIKE
FT                   KFDIDLHTEVRIIGKEK"
FT   CDS             721772..722869
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="LCRIS_00717"
FT                   /product="Spermidine/putrescine ABC transporter,
FT                   ATP-binding protein (PotA)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00717"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50164"
FT                   /db_xref="GOA:D5H2C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2C9"
FT                   /protein_id="CBL50164.1"
FT                   /translation="MDIIKLKHITKKYDDGFVALKDINLTIESGKFYSLLGPSGSGKST
FT                   ILRIIAGFTQPSSGQVLFDGNDITDLDASKRHINTVFQNYALFPHLDVFQNVAFGLKIK
FT                   KRPMSEIKPAVKDALHMVRLDGYANREISELSGGQQQRVAIARAIVNEPKVLLLDESLS
FT                   ALDKRLRKDMQFELRAIQKKLGITFIFVTHDQEEALSMSDEIFVLNDGQIQQSGNPVAI
FT                   YDEPVNDFVARFIGDSNILSGRMIHDYEVEFANNKFKCADGGMKPNEKVEVVIRPEDLD
FT                   IVKPEDGKIVVTAQTQLFLGDHFEIKAIDANENEWLIHSTNGVKLGQRVGLFFDPEDIH
FT                   VMRLNESQHDFDARLEKYEADENEK"
FT   CDS             722859..723671
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="LCRIS_00718"
FT                   /product="Spermidine/putrescine ABC transporter, permease
FT                   protein (PotB)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00718"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50165"
FT                   /db_xref="GOA:D5H2D0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D0"
FT                   /protein_id="CBL50165.1"
FT                   /translation="MKNKKMFFMIPYLLWIILFVILPILLILWYSFTDSNNAFTLRNYV
FT                   EFFKNGSFLKMMLNSFWYAFLITLLTLVISYPAAYFLIKMKNQQLWLLLIILPTWINLL
FT                   LKAYAFIGILGNDGLVNKFLHLFGIGPVNILFTDFAFIFVATYIEIPFMILPIFNAIKE
FT                   INPAVIQASEDLGASKWQTFCYVLWPLSRPGVESGVQAIFIPSLSLFMLTRLIGGNRVI
FT                   TLGTAIEEYFMTTMNWNMGATIGVILIVLMVVVMLITSKKARRKKVDL"
FT   CDS             723668..724483
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="LCRIS_00719"
FT                   /product="Spermidine/putrescine ABC transporter, permease
FT                   protein (PotC)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00719"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50166"
FT                   /db_xref="GOA:D5H2D1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D1"
FT                   /protein_id="CBL50166.1"
FT                   /translation="MRNRHLIAKIYLVFTLILLYVPIFYLIYFSFSSGKNMNKFEHFTW
FT                   AHYQTLFQDNRLLAIFLETILLALLSSLIATIIGTFGAIAIAAMKKESNKKTTLALNNV
FT                   LMVSPDVIIGASFLIFFTALGIGLNFGSVLLSHIAFSIPIVVLMVLPRLNEMDMSLIDA
FT                   ARDLGANSWQVFSDVLIPVIMPGIFSGLFMALTYSLDDFAVTFFVTGNGFSTLSVEIYS
FT                   RARQGIDLEINALSTVMFIFVLLLVGIYYFITTKKGRKKNHRVMGGLVK"
FT   CDS             724480..725553
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="LCRIS_00720"
FT                   /product="Spermidine/putrescine ABC transporter,
FT                   spermidine/putrescine-binding protein (PotD)"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50167"
FT                   /db_xref="GOA:D5H2D2"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D2"
FT                   /protein_id="CBL50167.1"
FT                   /translation="MKKIMMAIAAILIACAGLWGLSHHLEKSSTGKNKQNLIIYNWGDY
FT                   LDPKLIKKFEKQTGYHVVYETFDSNEAMYTKIKQGGTAYDLTIPSEYMVTKMRKAHLLD
FT                   QLDQKQIPNLKYIGKSFLHKSFDQNNDYSVPYFWGTLGIVYNDKFVKPGAIKTWNDLWS
FT                   KKYRRQILLVDSARDAMGMALVSLGYSMNTTSSIKLHLAQTKLNSLGPNIKAIISDEMK
FT                   MYLVQNEAAIGVTWSGEAYEMMEQNPHLHYVVPKQGSNLWFDNFVIPKTVQNKKAALKF
FT                   INFMLEPKNAAQNAEYVGYATPNTAAQKLLPKKVRDDRQFYPTQSTLKNLQVFRDLGPK
FT                   KTQEYNDLFLEFKMYAR"
FT   CDS             725592..726434
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00721"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00721"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50168"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D3"
FT                   /protein_id="CBL50168.1"
FT                   /translation="MHFNISNLFTWNNFSIALDILIIWYLVYRLIMMIRGTKAVQLAKG
FT                   IVFIFIVRIIAGLLQLHAVTYIVDQIVSWAVIGIIVIFQPEIRRGLERLGRTPIFNGRG
FT                   ESAHTQSVKMVQELDKAIQYMSKRRIGALITIQQDTGLDDYIETGIKLDADISGELLIN
FT                   IFIPNTPLHDGAVIINNNRIAVAAAYLPLSDNSMIPKRLGTRHRAAVGISEVTDAVTIV
FT                   VSEETGGVTITRNGRFLVDLSREEYLKYLNAQLVPKEEKKVPWIRRVINKVWKWGADR"
FT   CDS             726431..727390
FT                   /transl_table=11
FT                   /gene="ybbR"
FT                   /locus_tag="LCRIS_00722"
FT                   /product="YbbR"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00722"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50169"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D4"
FT                   /protein_id="CBL50169.1"
FT                   /translation="MKDFWDKRWVIRIISLLFAILLVVYIDSTQTGFVTQGESKKTRQT
FT                   ANETQTISVPLQVSVNTDKYYVVGYPEKVKITLEGSNALVTSTVNTQSFRAYIDLTHKK
FT                   IGKQTVKVEVTGLNSQLSYTINPATVNVDIERRKSRTMPVQIEYNKNAVANGYNIGTAS
FT                   VDPQQVEVTGARSEVNQIDQIVAKLPLPNGINHDYERQVILIAEDKKGRQLNAVINPST
FT                   VKASLPISLFKKKVKLNLKPKNEKNNKVYSVTAKNDEVTLYGQKETLAKIKQLDVDVDL
FT                   KGISYSTVKNYPLVLPKGVARVDPENVQISIKVKNANN"
FT   CDS             727413..728765
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="LCRIS_00723"
FT                   /product="Phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00723"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50170"
FT                   /db_xref="GOA:D5H2D5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D5"
FT                   /protein_id="CBL50170.1"
FT                   /translation="MLKYFGTDGVRGVANQGLTPEMAFKLGRDGGYVLTKNKKDGEQAK
FT                   VLVSRDTRISGQMLEYALISGLLSVGIEVLEVGVITTPGLSYLVRAQGADAGVQISASH
FT                   NPVEDNGIKFFGSDGLKLSDEMEGEIEKLIDAKEDKLPRPSAKGLGTVTDFHEGSAKYL
FT                   QFIENTIPEDLGGIKVVIDGANGASSALISRLFADCGVDFTTIATHPDGLNINDHVGAT
FT                   HTEKLQEEVVKQGAQLGLAFDGDADRCIAVDENGNEVDGDHIMYVLGSYLAEHGRLKKD
FT                   TIVTTVMSNLGFTKALEKEGLKNVRTQVGDRYVSEEMRAHGYNLGGEQSGHVIMSDYHN
FT                   TGDGMLTGLHLMLVMKKTGKLLSELLKDFKDYPQCLVNVPVADKKSWKEHQPILDEIAA
FT                   VEKDMAGNGRVLVRPSGTQDLLRVMAEGPTQEETDAYVDRIVKVVEKEMGK"
FT   CDS             728866..729681
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00724"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00724"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50171"
FT                   /db_xref="GOA:D5H2D6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D6"
FT                   /protein_id="CBL50171.1"
FT                   /translation="MAIKLIAVDLDGTLLSSNNTILPETQRMLRVAVQNGIKVVLATGR
FT                   PLSGVLNFAKQLGIEGDDQYAIVFNGAVIQTISGRVLMSQELNYQDFNNMLRFQRLSHV
FT                   NVHFETTKYFITTDRDLSVQMQINAALTDNIIKVRDRKEIPKDFTFNKVGFTSTEGADQ
FT                   VEKLWNSFPDWAFQTYDIVRSFDSIIELNALGASKGNALMDLASRLKIAQKDVMIFGDQ
FT                   GNDLSMFSNPDFMKVAMGNAISEIKDKADYVTDDNDHNGIAKALKKFVL"
FT   CDS             729712..730152
FT                   /transl_table=11
FT                   /gene="copY"
FT                   /locus_tag="LCRIS_00725"
FT                   /product="Transcriptional repressor CopY"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00725"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50172"
FT                   /db_xref="GOA:D5H2D7"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D7"
FT                   /protein_id="CBL50172.1"
FT                   /translation="MAETKDDRNSITQSEWEVMRIIWTLGEVRTGQVIKELQGKKDWSD
FT                   STIKTLMRRLVQKGLLNTRKEGRCFVYKPTISQRKMMSEVTLHMMQNMCDMHKGEVLIQ
FT                   LLKEAPLSKSDIKAMQQELKLKEKDAPDMVPCNCLPSEKSRC"
FT   CDS             730167..730883
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00726"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00726"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50173"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D8"
FT                   /protein_id="CBL50173.1"
FT                   /translation="MKNIVKIILRLIMVGLAAVSFWLLMTSNVSLKINDTQAMGKEVIN
FT                   RVVNDSDNPNLKAGVELLEASGLEKTLLEQLPPKYQVNLSYADLYRLCEKYNDQGKLTT
FT                   KDLGLTSKSKLEEIINEYLVKQINHKLKEDSEDVNHIITIYEYSIFAVALLFLLAAILI
FT                   LFGRSSASIPLALATIASFVALWLASNEAMTALQSRVYSGILVTLSQEIWVGLTVGIIT
FT                   AIIWPVINRLTKRKKK"
FT   CDS             730883..731338
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="LCRIS_00727"
FT                   /product="Phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00727"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50174"
FT                   /db_xref="GOA:D5H2D9"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2D9"
FT                   /protein_id="CBL50174.1"
FT                   /translation="MKKILFVCHGNICRSPMAEAVMQYLLKENNLADQYTAESKATTQD
FT                   ALGHGIDARAQRELVAKHIPYDRGHRASQMTRSDYDNYEYLICMDEENFADMNRITGGD
FT                   PEHKEHKILEFAGSYADVDDPWYTNDFETAYNEIYRGCEGLIKKLTK"
FT   CDS             complement(731363..732508)
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="LCRIS_00728"
FT                   /product="Glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00728"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50175"
FT                   /db_xref="GOA:D5H2E0"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E0"
FT                   /protein_id="CBL50175.1"
FT                   /translation="MKFVLAPDSFKESMTAKEVCIAMKNGIQKVIPNAQIIAVPMADGG
FT                   EGTTDSLVDATNGRKYQINVTGPLNQKVSAYYGISGDGQTAIIEMAQASGLSYVAKSKR
FT                   TPETILKTTTYGTGELINAALKHHVKKIIIGLGGSSTNDGGAGMAQALGVKFFDQNHHE
FT                   ITQKLAGGALDQIVNIDLSSINPRIKDIQFLLASDVTNPLTGPNGASSVFGPQKGADDT
FT                   TVKTLDQNLSHYAQVIEQTIDKNVAQISGSGAAGGLGAGLIAFTNASIHPGVQLIAQET
FT                   KLEAKIKDADYVFTGEGGTDFQTKFGKTPFGVAKIAQKYHVPVISLAGYLGQGIDQLYD
FT                   EGFTAIFGILAKAEDIEQALKDGPTNVTRTTENVVRLIVQK"
FT   CDS             732717..733550
FT                   /transl_table=11
FT                   /gene="bglG1"
FT                   /locus_tag="LCRIS_00729"
FT                   /product="Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00729"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50176"
FT                   /db_xref="GOA:D5H2E1"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E1"
FT                   /protein_id="CBL50176.1"
FT                   /translation="MKFLKTFNNSAALIENNQGQEEIVLGKGVGFGLKKGDPVDESKIE
FT                   RRFVTKDEVDQVKGFDPKTIEVTNKVLQLVEPLLQIKFNDFQYLALADHIDFAVTRIKD
FT                   HIDIAPANNSWEVQNLFPKEFAAAKKVVNLINQEMQIKLPQSESVLMTYHLVNAKSDVS
FT                   QVQETIQITNLIRGIIDIIQLQYSMQLDTSSFNYSRFVSHLRILLVRFLRNKQKEEASL
FT                   DPAMLGFMKIKYSKAYETAERITTYLHAKMGWDLDSDDEFYLVLHIWRVTSRQDN"
FT   CDS             733678..735699
FT                   /transl_table=11
FT                   /gene="bglF1"
FT                   /locus_tag="LCRIS_00730"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50177"
FT                   /db_xref="GOA:D5H2E2"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E2"
FT                   /protein_id="CBL50177.1"
FT                   /translation="MAKNYDELAKTIIQNVGGKDNVTSVVHCATRLRFKLKDEKKANDD
FT                   VLKDTDGVVTVVKAGGQYQVVIGNEVADVYDAVVKEGGFNGGGQVPDDDVEDNSRFVDK
FT                   AVALISGIFTDILAPLSAGGIIKGLVVLAGAMGWLSTKSGTYQILYAIGDSIFYFLPVF
FT                   LGVTAARRFHMNQFIGLAIGATLTYPTMVQLAASKTVLGTLFKGTAFASEIHTTFFGIP
FT                   VITMNYTSTVLPVLFTVWFASIIEHWAKKWIPSVVQMFLVPVVTMIIALPVAFIVIGPV
FT                   MTWVGDAIGAVMSGVYNFSPIIAGLLMGALWQVLVIFGVHWGIIAVTTADLAALGYDPI
FT                   LGLSCMVCYAQIGVVLAIIRQTKDKKLKETATGAFFSGLFGVTEPAIYGITLPRKTPFV
FT                   LSCIAGAVSGAIIGAFHSVLYIMPSMGFFAIPAYINPKGGSMTTIVGVIIAGIVAFIAG
FT                   FALQMLFGKKSVDAEYNKKQAQKVADAANEAANITKSAPVQAILSEEKENPSTKLVSPL
FT                   NGEVKPLSEIKDEVFSSGAMGEGVAIEPSEGVLHAPADGKIALVFPTGHAVGLNTTDGA
FT                   EVLMHIGMDTVNLQGKGFKTLVEKGQEVKAGDPLVKFNIKEIKAAGYEVTTPVVVTNSK
FT                   KYESVQQVAQGEVKVGQEILSLQGSNAEVKTTGQVQTN"
FT   CDS             735741..737216
FT                   /transl_table=11
FT                   /gene="bglA1"
FT                   /locus_tag="LCRIS_00731"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00731"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50178"
FT                   /db_xref="GOA:D5H2E3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E3"
FT                   /protein_id="CBL50178.1"
FT                   /translation="MSFPKNFLWGGATAANQIEGAYDEDGKGLSVTDITTAGSLDAPRM
FT                   LTYKLNGKLEKTPGVPGAGLPEGAVGAIDPNEYYPNHVAIDFYHHYKDDIKMFADMGFK
FT                   TFRLSIAWTRIFPKGDEEKPNQAGLDFYRRVFEECKKYDIEPLVTISHYEDPLYLSEKY
FT                   HDWGDREMIDMYVKYAKTLFEEYKGLVKYWLTFNEINSTLLMLSAFGNNVTDDKVYQHA
FT                   YQKLHYQFVASARAVKLAHEIDPDYVVGNMICGIVDYPLTPDPKDILANRHMWEQNIFY
FT                   CGDAQCKGKYPTFAKRLWKEHNVHLDITEQDKKDMLEGKVDMYTFSYYMSNVITTHEVK
FT                   DKVGGNFAAGAKNPYLKYSEWGWATDPDGLQYYLEVMYDRYEIPMMVVENGLGAVDKIS
FT                   DDGKIHDDYRIDYLRMHIKAMNRAIEDGVDVRAYTTWGCIDEVSAGTGQMSKRYGFIYV
FT                   DRDDEGKGTLDRMPKDSYYWYKKVIASNGADLD"
FT   CDS             737388..738338
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00732"
FT                   /product="Hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00732"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50179"
FT                   /db_xref="GOA:D5H2E4"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E4"
FT                   /protein_id="CBL50179.1"
FT                   /translation="MNRKHRRKFWVTIGIIVAVLVAFIGVGEAYFFNVAFVPGKKAVLN
FT                   KYSSKNKKDPLAEKKRWYEDAKKQRWYIKSNTGDYRLDANYIPKKNSDKAVVLLHGFTN
FT                   NKDTMGPYAAMFHQMGYNVLMPDARAHGQSQGKYIGYGWPEKYDVRKWVRKLIAEEGKK
FT                   QKIVIFGVSMGGATTMMASGIKMPSQVKAYIEDCGYTSVKDEFLHEAKDIYHLPGPVGQ
FT                   FFVNGLSVIAKANLGFYLGDASAVNSVEKNNKPMLFIHGGKDPFVPTKMVYANYKAAKG
FT                   PKQLWIAKKAKHARSFETYPREYQRRVSEFLKKYV"
FT   CDS             complement(738383..740008)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00733"
FT                   /product="Amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00733"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50180"
FT                   /db_xref="GOA:D5H2E5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E5"
FT                   /protein_id="CBL50180.1"
FT                   /translation="MDDLTSTNKMKTITWPVLTLMALCTVIGLDDIMYNFQNQGMPVIT
FT                   SWIIMCLLYVTPYSLMVGQLGSTFDKEGGGLSSWVRGTDGEFLGYFTAWTYWAASIPYA
FT                   VDSANEIIVDLGWAVTGTKDFQDKIPTSLFAILTFVVFIVFIIVEHHFSNSMEFLSTIG
FT                   GGLMIIMVILFVILAFFGLVKSGGHMATKNFGFHSIVPNFNLHYWSTVGMLIYAMNGCE
FT                   LVAPYVTKMKKPKTDFPKAMIALAVMTAFLTILGSFALGIYFDANHIPNDLKMNGAYYL
FT                   FDMLGKQFGMGHFLLYFWAWTSLFFNCALVAVLLDAMTRMLISDTGDKYMPKFLRKKDK
FT                   NGLPVNGYILTVALSSFIMILGIFLPDMNDIFNWLLNLNSIISPGVTCWIFYSFMRIRK
FT                   NSKKFPSQYVYIKNDKLAWLVGLLLLLVTAAATILGFAPQDVKQGTGLWWYELIINIVA
FT                   VVVLIGLGAILPGIRRREVEYGVAFDKAQWIWMGILIIGSIILDIWLGSTKLPMRIALI
FT                   VIEAVVALILTWLVGRRKPANATK"
FT   CDS             740384..740569
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="LCRIS_00734"
FT                   /product="30S ribosomal protein S14 type Z"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00734"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50181"
FT                   /db_xref="GOA:D5H2E6"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E6"
FT                   /protein_id="CBL50181.1"
FT                   /translation="MAKTSQIIRNKQKAKYSTREYTRCERCGRLHSVYRKFGLCRECMR
FT                   ELAHQGQLPGVKKASW"
FT   CDS             740547..741173
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00735"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00735"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50182"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E7"
FT                   /protein_id="CBL50182.1"
FT                   /translation="MLRRLVGKAVIKRLVDEGYDVIAAARRENAVEVVDPEHVTVQHLD
FT                   FHDSLAKIEDEIGHPDAVIFVAGSRGKDLLQTDLNGAVKLMKAAEANGVKRYVQLSSAF
FT                   ALDQDKWAEIPSLASIIDYDIAKYFSDEWLIHNTNLDYTIIQPGNLMEKPATGKTSFTP
FT                   EGGENSIDDVAQVLVDSLKYDNTIHQVIIMHDGDTPIDEALSKVK"
FT   CDS             741245..741766
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00736"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00736"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50183"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E8"
FT                   /protein_id="CBL50183.1"
FT                   /translation="MDKFHFTKREKIFLLLALLVLVALFISSSMTYQQQEIHDNKINRY
FT                   FGWLENIVAGWDFTYGGRIHNVQVDGRAGLAQFVLRKMAHFGSYFLLGGFGYLGLRRIF
FT                   KIKWVAPVLTWFMAIAFAAFDEYHQFLTGDRTPSVHDVMLDGAGALTAILLIMLVLFIK
FT                   HRFFDQKKQV"
FT   CDS             741851..742579
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00737"
FT                   /product="UPF0082 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00737"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50184"
FT                   /db_xref="GOA:D5H2E9"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026563"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2E9"
FT                   /protein_id="CBL50184.1"
FT                   /translation="MSGHSKWHNIQGRKNAQDAKRGKIFQKLSREIYMAAKSGGPDPDG
FT                   NPTLRMVIDKARSNNMPKDNIKRAIKKAEGGSEEHYDEITYEGYAPGGVAVFVEALTDN
FT                   KNRTASDVRVAFTRNGGSLGATGSVAYMFDRKGYIVIDRSTTDADEDQVLLDVMDAGGD
FT                   DLQTSDDAYEIYTDPKQFAGVRDALIKDGYKLADAELTMIPQNTTPVPADKKEQFEHLV
FT                   DALEDSDDVQNVYTAAADEE"
FT   CDS             742777..743751
FT                   /transl_table=11
FT                   /gene="comGA"
FT                   /locus_tag="LCRIS_00738"
FT                   /product="Competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00738"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50185"
FT                   /db_xref="GOA:D5H2F0"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F0"
FT                   /protein_id="CBL50185.1"
FT                   /translation="MKIKEIVSELLIEAIKVKASDIFFFPKKENLMVKFRTGKGLIEYA
FT                   GFTLETGKEIINFFKYSAQMDIAEHRRPQVGAMAYENEGHEYFLRLSSLGDFSDQESLV
FT                   IRVIYGIDHSQYFIPEQLGTIEKLAKSRGLIITSGPTGSGKTTTMYEIAKKMSQNKVVM
FT                   TIEDPVEIHESSFLQAQVNNEAGIDYQNLLKAALRHRPDILIIGEIRDQGTARLAVDAA
FT                   LSGHLVFATVHAKSTLQTISRLEGLGIRCDELTNCLTAVSYQRLLVSQGKLKCLMDIAA
FT                   DSLLKKELGKSVRGEFVNWQENLERLWKGGEINHEVYWQFQKG"
FT   CDS             743720..744721
FT                   /transl_table=11
FT                   /gene="comGB"
FT                   /locus_tag="LCRIS_00739"
FT                   /product="Competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00739"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50186"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F1"
FT                   /protein_id="CBL50186.1"
FT                   /translation="MKYIGNSKKDKLNGEEQLAFLDYLKHSLDNGFSLLNSIELMPALW
FT                   PKRRQLMERMASRMKEGASFSTELLKLGFSKTTVTQVNLALQQGTLVECLQHLATLNRL
FT                   KQEQMKKLRAELSYPLVLAIMMVILLVFMQSFISTQFSDSSDHSGDMVMIGLIIIVLLG
FT                   LYFFAKIVTLLNKQDYSSMKKLSKYPLIGQVVMLYIHYLLVYDIGLLLASGFSLQRMCE
FT                   YAADQEKGSLQQALGQKIGHDLAEGKNLEEIINAEDFLPNSLLVLLQTGSERKSLSKRC
FT                   LLLGRSLFLDLTEKIEKLVVNVQPACFILIGLCIIGMYLKLLLPMYSMMQGL"
FT   CDS             744781..745122
FT                   /transl_table=11
FT                   /gene="comGC"
FT                   /locus_tag="LCRIS_00740"
FT                   /product="Competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50187"
FT                   /db_xref="GOA:D5H2F2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F2"
FT                   /protein_id="CBL50187.1"
FT                   /translation="MKEKMKKYLANIMAKRRKQEGFTLIEMVVVIAIIVILILLIVPNL
FT                   INQKKNAETKTADAFRTTVQTQVELYKDKYGEPKDFEDLKKDDYLTGDQITKAKKNFTL
FT                   DSGEVVEKK"
FT   CDS             745109..745522
FT                   /transl_table=11
FT                   /gene="comGD"
FT                   /locus_tag="LCRIS_00741"
FT                   /product="Prepilin-type cleavage/methylation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00741"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F3"
FT                   /protein_id="CBL50188.1"
FT                   /translation="MKRNKLAGFSLLEVIITLGVCCGILLIGSLQLKRYQEKLIFDNTV
FT                   KRVTTALDQTSRYSTIKEVTIGVSYLARSNQILFSGGKYHKSIPVDQNIKITGLDHFKF
FT                   NLTGYSKPGTVTFSGYGMEKSLKYQMLWGRVAE"
FT   CDS             745519..745788
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00742"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00742"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50189"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F4"
FT                   /protein_id="CBL50189.1"
FT                   /translation="MIKVKGFLVIESFIAIIIAVIAVSCFYITVAENQKNGREMELKTD
FT                   RAYAYHILTKTDLEQVTVHDRIYQKAGRNHVWDATTKQTFAVKE"
FT   CDS             745796..746269
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00743"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00743"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50190"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F5"
FT                   /protein_id="CBL50190.1"
FT                   /translation="MLAEAMFSLFITMMVLLILQNLLLSVKKANLNQNQHVNEVAYAYV
FT                   QLENFMRADKIKAVYPVTKLAISNSASFKCIDQKGDATTYRIEYYKKNVLKVSGAGKGY
FT                   MPLLFNVEKAAFKTTKDSIIIRVTEKNKGASDLVFQLDEEQEKKNAKTKEKDA"
FT   CDS             746241..746405
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00744"
FT                   /product="putative protein without homology"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00744"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50191"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F6"
FT                   /protein_id="CBL50191.1"
FT                   /translation="MLKPKKKTHNVKGSALLSSVLVLMTTLLFIKMYQDIYHASMENNR
FT                   LIIECLTDD"
FT   CDS             746464..747465
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00745"
FT                   /product="Adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00745"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50192"
FT                   /db_xref="GOA:D5H2F7"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F7"
FT                   /protein_id="CBL50192.1"
FT                   /translation="MENFEKLFNQFLDCVQTLQTALNVSFTEALVETFDNLESGKIKVE
FT                   NGAPDEKTVAELSQKYQAIDYDEISQKEKAQVFTFLTLKAVNDDGFDVNQMPTPPAIAT
FT                   VVAMLMHKLLKDQKMEIVDPAVGTGNLLFSIISQLKALNHSKDNYQLVGIDNDEDMLSL
FT                   TDVAAHLNNIDIELYHQDALMPWMCPNADAIVSDLPVGYYPVDENAKNFENQAKKGHSF
FT                   AHLLLIEQIINNLKPNGYAFLVVPKSILSGKIGADFMPWLTKKVYLKAIVELPDDMFKN
FT                   KFNQKSVLVFQNHGDEAKASEVLLTKLGSLKKEEALIQFNVKLNEWYAKINH"
FT   CDS             747509..748693
FT                   /transl_table=11
FT                   /gene="ackA1"
FT                   /locus_tag="LCRIS_00746"
FT                   /product="Acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00746"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50193"
FT                   /db_xref="GOA:D5H2F8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F8"
FT                   /protein_id="CBL50193.1"
FT                   /translation="MKKVLAINSGSSSFKYKLFSLPDEKVLAKGMADRVGLEDSSFEIK
FT                   LADGTKHVEKTEIPDQEAAVSLLIKFLKGYHVVEELTEIVGVGHRVVNGGEYFKDSTII
FT                   TKENLPKIYELSDYAPLHNPAEARGIEAFMNVLPNVPEVAVFDTTYHRNLDPVHYLYSL
FT                   PYEYYEKYGVRKYGAHGTSIRYTAPRAAKILGKDLKDLKLVICHLGSGASITAVKDGKS
FT                   YDTSMGFSPIAGITMATRTGDIDPSLVQHLMKVEHKSMDEMIYIMNNKSGLLGLSGISP
FT                   DMRDVRESDSERAKLARKIFINRIIRYVGAYIAEMGGVDAIIFTAGIGEHDTGVRKAVL
FT                   DAFAYMGVVVDNEANESVSEGLITKTDSKVAGMVIPTNEELMIERDVVRLTNID"
FT   CDS             749501..750214
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00747"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00747"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50194"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR022208"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2F9"
FT                   /protein_id="CBL50194.1"
FT                   /translation="MKVENTTFETMSRSGIWYTKNISIKNSALQAPKLFRRTSHIILDN
FT                   VHFANAEETMWTCNDIKITNSQINGDYFGKDSQNIYLDHVSVVGNYVFDGAENIEVHNS
FT                   TFISKDAFWNCNNVTIYDSIIDGEYLAWNTNNITLINCKIESDQGLNYIDHLEIKNGSL
FT                   IHTDLAFEYVSNLDVELNTKIDSIKNPISGKITVPEIGTLIIDPDKVDPSKTELDCPKI
FT                   GTKIVHSDTNQTPKD"
FT   CDS             750223..751386
FT                   /transl_table=11
FT                   /gene="patB"
FT                   /locus_tag="LCRIS_00748"
FT                   /product="Aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00748"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50195"
FT                   /db_xref="GOA:D5H2G0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2G0"
FT                   /protein_id="CBL50195.1"
FT                   /translation="MQYDFENAPDRSKTDSVKWDVKSDELPMWIADMDFKTAPEIIEAM
FT                   QQKLTLGAFGYEFPQADYFNAVADWYETEHNHRPQTNWMIFTTGVVPAISSIVRRISHI
FT                   GDNVLVQEPVYNIFYNSILNNGRHVLSSDLAFDGKSYSINWADLEQKLAEPLTTLMIFC
FT                   NPHNPVGKVWTSEEVQKIADLCHQYHVTLLSDEIHGDLVRQGPDYTPAFSVTGEAQNSV
FT                   ISLVSPSKTFNVAALHAATAIVPNENLRNMVNRGLNSDEVAEPNLLAIPATIAAYEQGH
FT                   DWLNALKKQLKQNFAYVQNFIEKNIPEVQIISGNATYLMWIDVQKISTDSQELAEFIRQ
FT                   ETGLIISAGSVYRGNGHDFIRINLACPLTMVKDGMQRLATGIRKYNK"
FT   CDS             751479..752441
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="LCRIS_00749"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00749"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50196"
FT                   /db_xref="GOA:D5H2G1"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2G1"
FT                   /protein_id="CBL50196.1"
FT                   /translation="MEPLFLTPYFRPKIWGGRKLDDIFHYDIPEGKVGEAWIISGYKDD
FT                   ASTVTDGPLKGMSLRDVYLKHPELFGNPKAKEFPLLVKFLDANDNLSVQVHPDDDYARK
FT                   VENDSGKTESWYVMQADPGAYIIYGHHAKSREELADMIHKGEWDKLLRKVPVKAGDFFY
FT                   VPAGTIHALTKGCLVIETQQSSDVTYRLYDYDRVDKDGKKRELHTQKSIDVTTVPHVDP
FT                   KLDVKTSQDQDAEIKTLVEPPLSPHFYLWQIDLDGTWKTGLKDHPYLLVSVIKGEGKLK
FT                   ADGKSYDLKMGTNLIIPNEMKNFTFTGKMRIVMSAPGEE"
FT   CDS             752477..752866
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00750"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50197"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2G2"
FT                   /protein_id="CBL50197.1"
FT                   /translation="MIYVACGLVMVAVGLIWLITPAKRPNQIYGYLSYLAQVNQDSFKF
FT                   AQKRASWYCILFGFIQALLGVIIHYLNWDRYFLIWLLTFYLFILLPIVYTEKSLKTFLS
FT                   KRHELPHDYVDPDQVKHKRTKGFRD"
FT   CDS             752869..753591
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00751"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00751"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50198"
FT                   /db_xref="GOA:D5H2G3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2G3"
FT                   /protein_id="CBL50198.1"
FT                   /translation="MSLRILMVEDDTSVAEMMGMFFKKEGWQQDIAVDGVEAVDMFKKN
FT                   ADKYDLITLDLNLPKKDGIQVAKEVRAISPTVPIIMLTARGSESDQVLGLGIGADEYVT
FT                   KPFSPIALIARIKALHRRVMMEEEPAHTQEDNQDYEITTDHLKISKNRREVLFDNQPVM
FT                   GLTPKEFDLLYTMAQKPRQVFSRDQLLELVWGYEYYGEERTVDAHIKKLRQKLEKVGAK
FT                   VIQTVWGVGYKFDDSQVK"
FT   CDS             753591..755045
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00752"
FT                   /product="Sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00752"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50199"
FT                   /db_xref="GOA:D5H2G4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2G4"
FT                   /protein_id="CBL50199.1"
FT                   /translation="MKLIYQNMLSFLLIIVTTISIIGYSEIGYARNQAYTQNYQRMESY
FT                   ANSLGNLAEADSQNGTTLLSNNFLNQLEYVLRGDDAHLRIFNDKNEQIYPKTKARIQLS
FT                   QEVFTTLKNGQEIRIQNNHNENSPISSTKDAYTGVLVPWMNGKNLVGIVWIGSRVKHVE
FT                   RPILMAKRNLLRALLITVAVGLLLSFIISYYSTKRIKRLSRATQKVASGNFNVQIEHKD
FT                   SDEIDQLAENFNKMVQALKQSNEEVKAQEERRDQFMADAAHEMRTPLTTINGILEGLQY
FT                   DAIPEDSKPKSIALMQRETKRLIRLVNENLDYEKIRNNQIMLVKTNFNATIILHDLKSQ
FT                   LKQNATKANDELVVEAPDQLPIYADRDRFTQVMVNLVQNAIQFTHDGKIIISGKRIEHG
FT                   TQLSVKDNGIGMSKNQTKYIFERFFKADPSRARMGTGESGLGLAIVSSLIKQHGGKVEV
FT                   FSTPGRGSTFTVTFYDKGYEQFVAKN"
FT   CDS             complement(755089..757041)
FT                   /transl_table=11
FT                   /locus_tag="LCRIS_00753"
FT                   /product="Sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:LCRIS_00753"
FT                   /db_xref="EnsemblGenomes-Tr:CBL50200"
FT                   /db_xref="GOA:D5H2G5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D5H2G5"
FT                   /protein_id="CBL50200.1"
FT                   /translation="MLILDFANTALLFANIIYYRQFSDFLTIKTMSNVGKVSQGLGKST
FT                   VALLHPTDIIIWIDLIVIVTLLIIHKIKIDQRSYGLSTPFAITSVGAFILTLNIFLAET
FT                   SRPRLLRNTFDRSYVVKYLGIDTFTAYDCFKSAQNVQVTKNANAADLNQILTFTKKQNA
FT                   APSSSYFGIEKNRNVIIIHLESFQQFLINLKVNGKEVTPFLNSLYQNKHTLSFNNFYHQ
FT                   VGLGRTSDAENMLETSTYGIPDGSLFTSLGSENTFQAAPQILRQDGYTSAVFHGNVGSF
FT                   WNRNDVYKNMGYNYFFDKNYYSSQSKDASGYGLKDKLLFAESVKYLEQMQQPFYAKFIT
FT                   VTNHIPFNLDKEDKDPNFKTTNTADQTINNYFETAHYLDEALREFFHYLKSSGLYKNSM
FT                   VVIYGDHYGLSNSENETLAPIIGESSDTWNTYNNVQMQRVPFMIHANNLKGKINHEIAG
FT                   EIDVLPTLMHLLGINNKNYVQFGSDMLSPKRQNWIVFRNGTIVSSRYIIVGAKGIKGTV
FT                   YDRVSGKQIINFTPQEKKEISELAQKAKASLHYSDLLNNHNLLRFYTPTDFVPTDPTQF
FT                   DYSVNYQKMIAIRNELAGNSTSLYSRHRGTTTNLYRTDAAE