spacer

EBI Dbfetch

ID   FN691481; SV 1; linear; genomic DNA; STD; HUM; 885 BP.
XX
AC   FN691481;
XX
DT   26-MAR-2010 (Rel. 104, Created)
DT   26-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, allele
DE   HLA-DPB1*new, isolate 200120, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-885
RA   Witter K.;
RT   ;
RL   Submitted (25-MAR-2010) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "A new HLA-DPB1 allele, DPB1*XXX:XX revealed in a family typed for bone
RT   marrow transplantation";
RL   Unpublished.
XX
DR   MD5; b1517f0363abaf52fd77b52d28346675.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..885
FT                   /organism="Homo sapiens"
FT                   /isolate="200120"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<29..292,468..>749)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:D4IIJ3"
FT                   /db_xref="IMGT/HLA:DPB1*126:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D4IIJ3"
FT                   /protein_id="CBL43006.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSMDSPVTVEW"
FT   exon            29..292
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   intron          293..467
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   gap             319..418
FT                   /estimated_length=unknown
FT   exon            468..749
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=3
XX
SQ   Sequence 885 BP; 168 A; 227 C; 226 G; 164 T; 100 other;
     tccgctcatg tccgccccct ccccgcagag aattaccttt tccagggacg gcaggaatgc        60
     tacgcgttta atgggacaca gcgcttcctg gagagataca tctacaaccg ggaggagttc       120
     gcgcgcttcg acagcgacgt gggggagttc cgggcggtga cggagctggg gcggcctgct       180
     gcggagtact ggaacagcca gaaggacatc ctggaggaga agcgggcagt gccggacagg       240
     atgtgcagac acaactacga gctgggcggg cccatgaccc tgcagcgccg aggtgagtga       300
     gggctttggg gccggcggnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnga       420
     aggacaatct caaattctat ttcattattt ttcttccacg ctcctagtcc agcctagggt       480
     gaatgtttcc ccctccaaga aggggccctt gcagcaccac aacctgcttg tctgccacgt       540
     gacggatttc tacccaggca gcattcaagt ccgatggttc ctgaatggac aggaggaaac       600
     agctggggtc gtgtccacca acctgatccg taatggagac tggaccttcc agatcctggt       660
     gatgctggaa atgacccccc agcagggaga tgtctacacc tgccaagtgg agcacaccag       720
     catggatagt cctgtcaccg tggagtggag tgagtctctg atgaccctct agaccccacc       780
     tctgaagagc aggggactct ctggctctgg ggtccactca tcttatcttc tgcatctata       840
     ccctggggcc atgtccaaac cccatctttc ttctatacca gctcc                       885
//


spacer
spacer