Dbfetch

ID   FN673682; SV 1; linear; genomic DNA; STD; HUM; 2994 BP.
XX
AC   FN673682;
XX
DT   26-FEB-2010 (Rel. 103, Created)
DT   26-FEB-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele
DE   HLA-Cw*15new, exons 1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2994
RA   Hedlund A.;
RT   ;
RL   Submitted (23-FEB-2010) to the INSDC.
RL   Hedlund A., R & D, Olerup SSP AB, Hasselstigen 1, 133 33 Saltsjobaden,
RL   SWEDEN.
XX
RN   [2]
RA   Hedlund A.;
RT   "Identification of a new HLA-Cw*15 allele a with previously known sequence
RT   motif in exon 6";
RL   Unpublished.
XX
DR   MD5; b9d62ae009fb2e8c099c9fff2920fbcf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2994
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Thailand"
FT                   /sex="male"
FT                   /cell_line="ECACC 94082291"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..25,156..425,672..947,1535..1810,1932..2051,
FT                   2491..2523,2631..2678,2843..2847)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D3VN25"
FT                   /db_xref="IMGT/HLA:C*15:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D3VN25"
FT                   /protein_id="CBK13146.1"
FT                   /translation="LALTETWACSHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFD
FT                   SDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQTDRVNLRKLRGYYNQSEAGSHIIQ
FT                   RMYGCDLGPDGRLLRGHDQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQ
FT                   LRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEIT
FT                   LTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLR
FT                   WEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGGKGGSYSQAASSNSAQG
FT                   SDESLIACKA"
FT   exon            <1..25
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=1
FT   intron          26..155
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=1
FT   exon            156..425
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=2
FT   intron          426..671
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=2
FT   exon            672..947
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=3
FT   intron          948..1534
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=3
FT   exon            1535..1810
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=4
FT   intron          1811..1931
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=4
FT   exon            1932..2051
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=5
FT   intron          2052..2490
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=5
FT   exon            2491..2523
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=6
FT   intron          2524..2630
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=6
FT   exon            2631..2678
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=7
FT   intron          2679..2842
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=7
FT   exon            2843..>2847
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*15new"
FT                   /number=8
XX
SQ   Sequence 2994 BP; 570 A; 849 C; 950 G; 625 T; 0 other;
     ctggccctga ccgagacctg ggcctgtgag tgcggggttg ggagggaaac ggcctctgcg        60
     gagaggagcg aggggcccgc ccggcgaggg cgcaggaccc ggggagccgc gcagggagga       120
     gggtcgggcg ggtctcagcc cctcctcgcc cccaggctcc cactccatga ggtatttcta       180
     caccgctgtg tcccggcccg gccgcggaga gccccacttc atcgcagtgg gctacgtgga       240
     cgacacgcag ttcgtgcggt tcgacagcga cgccgcgagt ccaagagggg agccgcgggc       300
     gccgtgggtg gagcaggagg ggccggagta ttgggaccgg gagacacaga actacaagcg       360
     ccaggcacag actgaccgag tgaacctgcg gaaactgcgc ggctactaca accagagcga       420
     ggccggtgag tgaccccggc ccggggcgca ggtcacgacc cctccccatc ccccacggac       480
     ggcccgggtc gccccgagtc tcccggtctg agatccaccc cgaggctgcg gaacccgccc       540
     agaccctcga ccggagagag ccccagtcac ctttacccgg tttcattttc agtttaggcc       600
     aaaatccccg cgggttggtc ggggctgggg cggggctcgg gggacggggc tgaccacggg       660
     ggcggggcca gggtctcaca tcatccagag gatgtatggc tgcgacctgg ggcccgacgg       720
     gcgcctcctc cgcgggcatg accagttcgc ctacgacggc aaggattaca tcgccctgaa       780
     cgaggacctg cgctcctgga ccgccgcgga cacggcggct cagatcaccc agcgcaagtg       840
     ggaggcggcc cgtgaggcgg agcagctgag agcctacctg gagggcacgt gcgtggagtg       900
     gctccgcaga tacctggaga acgggaagga gacgctgcag cgcgcgggta ccaggggcag       960
     tggggagcct tccctatctc ctgtagatct cccgggatgg ccttccacga ggaggggagg      1020
     aaaatgggat cagcgctaga atatcgccct cccttgaatg gagaatggga tgagttttcc      1080
     tgagtttcct ctgagggccc cctctgctct ctaggacaat taagggatga agtccttgag      1140
     gaaatggagg ggaagacagt ccctggaata ctgatcaggg gtcccctttg accactttga      1200
     ccactgcagc agctgtggtc aggctgctga cctttctctc aggccttgtt ctctgcctca      1260
     cgctcaatgt gtttgaaggt ttgattccag cttttctgag tccttcggcc tccactcagg      1320
     tcaggaccag aagtcgctgt tcctccctca gagactagaa ctttccaatg aataggagat      1380
     tatcccaggt gcctgtgtcc aggctggcgt ctgggttctg tgcccccttc cccaccccag      1440
     gtgtcctgtc cattctcagg atggtcacat gggcgctgtt ggagtgtcgc aagagagata      1500
     caaagtgtct gaattttctg actcttcccg tcagaacacc caaagacaca cgtgacccac      1560
     catcccgtct ctgaccatga ggccaccctg aggtgctggg ccctgggctt ctaccctgcg      1620
     gagatcacac tgacctggca gcgggatggc gaggaccaaa ctcaggacac cgagcttgtg      1680
     gagaccaggc cagcaggaga tggaaccttc cagaagtggg cagctgtggt ggtgccttct      1740
     ggagaagagc agagatacac gtgccatgtg cagcacgagg ggctgccgga gcccctcacc      1800
     ctgagatggg gtaaggaggg ggatgagggg tcatgtgtct tctcagggaa agcagaagtc      1860
     ctggagccct tcagccgggt cagggctgag gcttgggggt cagggcccct caccttcccc      1920
     tcctttccca gagccatctt cccagcccac catccccatc gtgggcatcg ttgctggcct      1980
     ggctgtcctg gctgtcctag ctgtcctagg agctgtgatg gctgttgtga tgtgtaggag      2040
     gaagagctca ggtagggaag gggtgaggag tggggtctgg gttttcttgt cccactggga      2100
     gtttcaagcc ccaggtagaa gtgtgcccca cctcgttact ggaagcacca tccacacatg      2160
     ggccatccca gcctgggacc ctgtgtgcca gcacttactc tgttgtgaag cacatgacaa      2220
     tgaaggacag atgtatcacc ttgatgatta tggtgttggg gtccttgatt ccagcattca      2280
     tgagtcaggg gaaggtccct gctaaggaca gaccttagga gggcagttgc tccagaaccc      2340
     acagctgctt tccccgtgtt tcctgatcct gccctgggtc tgcagtcata gttctggaaa      2400
     cttctcttgg gtccaagact aggaggttcc cctaagatcg catggccctg cctcctccct      2460
     gtcccctcac agggcatttt cttcccacag gtggaaaagg agggagctac tctcaggctg      2520
     cgtgtaagtg atggcggtgg gcgtgtggag gagcttaccc accccataat tcctcttgtc      2580
     ccacatctcc tgcgggctct gaccaggtct ttttttttgt tctaccccag ccagcaacag      2640
     tgcccagggc tctgatgagt ctctcatcgc ttgtaaaggt gagattctgg ggagctgaag      2700
     tggtcggggg tggggcagag ggaaaaggcc taggtaatgg ggatcctttg attgggacgt      2760
     ttcgaatgtg tggtgagctg ttcagagtgt catcacttac catgactgac ctgaatttgt      2820
     tcatgactat tgtgttctgt agcctgagac agctgcctgt gtgggactga gatgcaggat      2880
     ttcttcacac ctctcctttg tgacttcaag agcctctggc atctctttct gcaaaggcat      2940
     ctgaatgtgt ctgcgttcct gttagcataa tgtgaggagg tggagagaca gccc            2994
//