spacer

EBI Dbfetch

ID   FN667788; SV 1; circular; genomic DNA; STD; PHG; 177534 BP.
XX
AC   FN667788;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Campylobacter phage CP220, complete genome
XX
KW   complete genome.
XX
OS   Campylobacter phage CP220
OC   Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae.
XX
RN   [1]
RP   1-177534
RA   Aslett M.A.;
RT   ;
RL   Submitted (03-FEB-2010) to the INSDC.
RL   Aslett M.A., Pathogen Sequencing Unit, Wellcome Trust Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge, Cambridgeshire. CB10 1SA,
RL   UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-11-214.
RX   PUBMED; 20353581.
RA   Timms A.R., Cambray-Young J., Scott A.E., Petty N.K., Connerton P.L.,
RA   Clarke L., Seeger K., Quail M., Cummings N., Maskell D.J., Thomson N.R.,
RA   Connerton I.F.;
RT   "Evidence for a lineage of virulent bacteriophages that target
RT   Campylobacter";
RL   BMC Genomics 11:214-214(2010).
XX
DR   EuropePMC; PMC2853527; 20353581.
DR   EuropePMC; PMC2993671; 21029436.
DR   EuropePMC; PMC3322345; 22284308.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..177534
FT                   /organism="Campylobacter phage CP220"
FT                   /host="Campylobacter sp."
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="Gallus gallus"
FT                   /db_xref="taxon:722417"
FT   CDS             78..2312
FT                   /transl_table=11
FT                   /locus_tag="CPT_0001"
FT                   /product="putative phage DNA packaging protein (terminase)"
FT                   /db_xref="GOA:D5GUZ3"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="UniProtKB/TrEMBL:D5GUZ3"
FT                   /protein_id="CBJ93810.1"
FT                   /translation="MLSKEEIKYFQTHKNEITDELLETIRAQGKLGKAQALEILDLPKD
FT                   SDNYYLDAYNTRISYNGSRGLKKAYTKLNLSPIHISELEKCANDPLYFLRNYVRMTTPK
FT                   GFDFVDSRPYQDEFIQLLSDDSIENVISMQPRQCIEANTKINVNGNETTIMRLFINQES
FT                   NKRLYFNSSKFIESYECKDKYVETPIGKVKILEVHKTIKYNIFEIETENGFKLQASELH
FT                   VLIDENDNELYVRDCLNKVIKTKSGPSKIISKTFIKYDHCYDLTLEHHHLYYTNGVLSH
FT                   NSSKSTTTSVKLAHLYCFKKDINIGIVAYSGNSAREFLDKTKKMLIGLPIWMQPGTVTW
FT                   NKGSIECENNIKILTDVPSSDAFRGTSTNIIVVDECAYLDPAGWIDFTDGVLPSQAGLA
FT                   FKKLVILSTPKGKNHFYDIWQGAGDTLETSINGFVRHRVDWRLVPRFKSDGTKYDPEEF
FT                   KQQQIKTGGLVVWNSAYECKFEGSAMTLIPSEILDTYKPQEPIEVDNIKDSKILIYEEP
FT                   IPGHKYVMGVDTAKEGADFTGVQIFDTTDLNFRQVASAKLKIDYMLLPELLNEYGLRFN
FT                   QALIIVENNEGSGQVVADILKRDYEYENLYYDVNKQKQRLKYPGFRTTKLSRDVILQTV
FT                   ATLAQANKLLLVDKETIKEFGVFTLNDNGKYQAAVGYHDDLVMSCCLCFGIFTNVKNFE
FT                   DMKEIVDSLKSSEGKSFEYLTFGAFADGLGTEPDSNTDNKDLNLSNLEYY"
FT   misc_feature    267..332
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1141.000, SD 3.07 at aa 64-85, sequence
FT                   RGLKKAYTKLNLSPIHISELEK"
FT   misc_feature    489..932
FT                   /note="superfamily hit to SSF51294, Hedgehog/intein (Hint)
FT                   domain, score 1.5e-11"
FT                   /inference="protein motif:superfamily:SSF51294"
FT   misc_feature    858..926
FT                   /note="ProfileScan hit to PS50818, INTEIN_C_TER, score
FT                   8.279. HMMTigr hit to TIGR01443, intein_Cterm: intein
FT                   C-terminal splicing, score 7.4e-06"
FT                   /inference="protein motif:ProfileScan:PS50818"
FT   misc_feature    903..926
FT                   /note="PS00881 Protein splicing signature."
FT                   /inference="protein motif:Prosite:PS00881"
FT   CDS             2328..3062
FT                   /transl_table=11
FT                   /locus_tag="CPT_0002"
FT                   /product="Putative base plate hub assembly catalyst"
FT                   /db_xref="UniProtKB/TrEMBL:D5GUZ4"
FT                   /protein_id="CBJ93811.1"
FT                   /translation="MKEYIKYNDRKFILTAYKVKTERDLLLTASSDDTTYSKDLNDLNL
FT                   DIYLRILEPYIDSNINIYDLYPEEKLFLLYRLRATSVSDQLSLNTRCDCGCTFKSNIDL
FT                   GKIGELHSIDTNIYPDLKDVYSPNLADIYGDSYLESNIMDCDSELDTYLEANTTKFNFI
FT                   KVVKCYNCKKDLEIDLTNPEIYKNIFSENPIGEFYKSLTRLSFLGKFTIDGILNDLYPF
FT                   EREIFISLINDEVEEQNKALKK"
FT   CDS             complement(3095..3511)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0003c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GUZ5"
FT                   /protein_id="CBJ93812.1"
FT                   /translation="MKNLKYFVVALSALFVIGCGSDYSSDKTGKEVRGTSDSRINQVCV
FT                   DGVLYLSTGNCVTPQQDLNGSLIGCSKKPEVIIDQLKEKQKNKDLAKLVENIKNDIKDD
FT                   VKSEIKSEVKNDLKSEITVEINESIKSRLDKKNI"
FT   misc_feature    complement(3440..3511)
FT                   /note="Signal peptide predicted for CPT_0003 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.994 between residues 24 and 25"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS             3627..3815
FT                   /transl_table=11
FT                   /locus_tag="CPT_0004"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GUZ6"
FT                   /protein_id="CBJ93813.1"
FT                   /translation="MKEFFYNLIAQIKGLKIHKNEKDTWYLKWDLNTGYYIEGLNTKRR
FT                   LYCGGYSDSLNKIKYLY"
FT   CDS             3896..5407
FT                   /transl_table=11
FT                   /locus_tag="CPT_0005"
FT                   /product="Putative phage DNA topoisomerase (large subunit)"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="GOA:D5GUZ7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5GUZ7"
FT                   /protein_id="CBJ93814.1"
FT                   /translation="MIKKLTDREHILKRPSMYIGAIDSTNTEDFIIESGKIKYTTLNYV
FT                   PGLIKIINEIIDNSVDAAIRSKFKSGLNISVKISNDTVSIEDDGTGIPVIKSGDHYMPE
FT                   LAWNHAKAGSNFDDDANRVTIGTNGVGSYCTNVWSINFKGITDDGKNRYIFKSKNNAET
FT                   YSENIEASKKSGTLVEFKPDLERFNLKEIDETHKNIIYQRLLNLAICYPEINFKFNSKK
FT                   IDFKSFKNYLNMFSSDFELYENQNIKIGIIPNELDDFKQFSFVNGLKIPDGGVHIDTIM
FT                   SNVVQGIRDKLVKKYKSIKPGDIKNKLMIVCFINGMPNLKFNSQSKEKITNSVKEFNDF
FT                   SNIDYNFINKILKNKSIIDPIIDIYKVKEALNADKALKSVEKSKKLKSEKYFRATKSQK
FT                   YLCICEGFSAYGGISQVLGNEHTSFYVLKGKPLNSWDVTNQKFAANRELSELYQILSEN
FT                   AEFEDLKDGKFYEIKIDGKTYIMNENDTIEINNIKYNFEDLQKGL"
FT   misc_feature    3896..4585
FT                   /note="superfamily hit to SSF55874, ATPase domain of HSP90
FT                   chaperone/DNA topoisomerase II/histidine kinase, score
FT                   2e-22"
FT                   /inference="protein motif:superfamily:SSF55874"
FT   misc_feature    4022..4450
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP, score 0.00024"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    4034..5374
FT                   /note="HMMSmart hit to SM00433, topoisomerase domain,score
FT                   8.7e-14"
FT                   /inference="protein motif:SMART:SM00433"
FT   misc_feature    4034..4081
FT                   /note="FPrintScan hit to PR00418, TPI2FAMILY topoisomerase
FT                   domain, score 3.8e-17"
FT                   /inference="protein motif:FPrintScan:PR00418"
FT   misc_feature    4268..4312
FT                   /note="FPrintScan hit to PR00418, topoisomerase
FT                   domain,score 3.8e-17"
FT                   /inference="protein motif:FPrintScan:PR00418"
FT   misc_feature    4586..5044
FT                   /note="HMMPfam hit to PF00204, DNA gyrase B, score 2.6e-06"
FT                   /inference="protein motif:PFAM:PF00204"
FT   misc_feature    4586..5029
FT                   /note="superfamily hit to SSF54211, Ribosomal protein S5
FT                   domain 2-like, score 8.7e-20"
FT                   /inference="protein motif:superfamily:SSF54211"
FT   misc_feature    4682..4723
FT                   /note="FPrintScan hit to PR00418, topoisomerase
FT                   domain,score 3.8e-17"
FT                   /inference="protein motif:FPrintScan:PR00418"
FT   misc_feature    5030..5260
FT                   /note="superfamily hit to SSF56719, Type II DNA
FT                   topoisomerase, score 1.4e-08"
FT                   /inference="protein motif:superfamily:SSF56719"
FT   misc_feature    5096..5140
FT                   /note="FPrintScan hit to PR00418, topoisomerase
FT                   domain,score 3.8e-17"
FT                   /inference="protein motif:FPrintScan:PR00418"
FT   CDS             5407..5940
FT                   /transl_table=11
FT                   /locus_tag="CPT_0006"
FT                   /product="hypothetical phage protein"
FT                   /note="nucleoside triphosphate hydrolase motif"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GUZ8"
FT                   /protein_id="CBJ93815.1"
FT                   /translation="MRPIRIAISGAQCSGKTTLINLMKKHSYFKNFDFIESFSNKIAKT
FT                   NKKHSENTNLVTQLQMLYYSISALKSISIPTVHDRCILDVIVYTGINKDIDLRLFTDSL
FT                   IKYYKQFDFIFVLDSENIPLESNGIRSIDPEFRSKINNIFKKVDLENVVHLDSKLDPDS
FT                   RILKIIEAIKSKTN"
FT   misc_feature    5407..5928
FT                   /note="superfamily hit to SSF52540, P-loop containing
FT                   nucleoside triphosphate hydrolases, score 3.6e-07"
FT                   /inference="protein motif:superfamily:SSF52540"
FT   CDS             5952..6410
FT                   /transl_table=11
FT                   /locus_tag="CPT_0007"
FT                   /product="hypothetical phage protein (possible dUTP
FT                   pyrophosphatase)"
FT                   /db_xref="GOA:D5GUZ9"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="UniProtKB/TrEMBL:D5GUZ9"
FT                   /protein_id="CBJ93816.1"
FT                   /translation="MDLNLYIHKTNEDAVIPEIAYNGTSAAFDITCAETTEIKPGESKV
FT                   VPNGLRISIDEKDPFYMTVHLRSSLGFKKDLIPHIGIIDAGYTGDFGVKINNIGKEPIV
FT                   IEKGSRYAQVLIHRKYSFKFVELNDAEFKDFEAKQERGSKGFGSSGKS"
FT   misc_feature    5976..6344
FT                   /note="superfamily hit to SSF51283, dUTPase-like, score
FT                   7.8e-22"
FT                   /inference="protein motif:superfamily:SSF51283"
FT   misc_feature    5985..6401
FT                   /note="HMMPfam hit to PF00692, dUTPase, score 1.9e-17"
FT                   /inference="protein motif:PFAM:PF00692"
FT   CDS             6452..6694
FT                   /transl_table=11
FT                   /locus_tag="CPT_0008"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV00"
FT                   /protein_id="CBJ93817.1"
FT                   /translation="MNTIKFYHRQKEYVVQSQNINQHTFNKNYNKVLALLNENEIKSIN
FT                   ECELIPAGKTDILKLSTMGSDGLIQEFELRLENVY"
FT   CDS             6707..7750
FT                   /transl_table=11
FT                   /locus_tag="CPT_0009"
FT                   /product="Putative DNA primase subunit"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV01"
FT                   /protein_id="CBJ93818.1"
FT                   /translation="MLDFVDIKYFKLAVPGPYKESSLDIAVKCPICGDSKYKKSVKRLH
FT                   LYEKQGVTLVHCFNGDCVLNTQMGLSNFLKIYKPELLLPYKSENFKLKINSIDTSNNIE
FT                   SNNEIETMKSCFDSSASNTSIESIASSTSIDSSNNGFKYINLTSVLDTNTSKQIEFLKS
FT                   RGFNDDTINFLDFYNGTKSFNLNGVYYGIKDYLVIPFSKDSNYYGFYARSLTEKRFINF
FT                   TLNQNYGVWNLFNVDLNKPVFIFEAILDALSFRQIYRTNQIIALNTSTIAKNVLDLIKY
FT                   PFFCLDNDKVGIEKMIKYNSIQNSHFICYPNDLTQKDFNEMLQNNIKIELVFKKGFNAL
FT                   LHLKSLL"
FT   misc_feature    7136..7690
FT                   /note="superfamily hit to SSF56731, DNA primase core,score
FT                   5.1e-16"
FT                   /inference="protein motif:superfamily:SSF56731"
FT   CDS             7810..8724
FT                   /transl_table=11
FT                   /locus_tag="CPT_0010"
FT                   /product="Putative DNA polymerase accessory factor (sliding
FT                   clamp loader)"
FT                   /db_xref="GOA:D5GV02"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV02"
FT                   /protein_id="CBJ93819.1"
FT                   /translation="MTVDLKHDIWVEKYRPQKIDDLILPNVYLDKFRKYIEKPSNILLS
FT                   SVNPGTGKTSTAQAIIKEGNFESLYINASLESGIDTMRSKILQFASTESFDGKPKIVLA
FT                   DEFDYFGQNGQAAARALIEEVAANCRFILTCNYVSNIMPPIVNRFEVFDFDVVHASNKQ
FT                   ELAQKAFNLLKEILDNEKVSYVNEDLVNIIKNYYPSIRGMIACLQKCNFNNKLILDIQK
FT                   DSDFEGLINLIRSRDFDNLMKVIYGLTNPDAFYEYAFKKLDIQNSNKPQAIIILAKYQY
FT                   QSAFSRDRNLNLAACIMELAPLL"
FT   misc_feature    7843..8376
FT                   /note="superfamily hit to SSF52540, P-loop containing
FT                   nucleoside triphosphate hydrolases, score 2.1e-18"
FT                   /inference="protein motif:superfamily:SSF52540"
FT   misc_feature    7921..8295
FT                   /note="HMMSmart hit to SM00382, AAA ATPase, score 1.4e-06"
FT                   /inference="protein motif:SMART:SM00382"
FT   misc_feature    8467..8712
FT                   /note="superfamily hit to SSF48019, DNA polymerase III
FT                   clamp loader subunits, C-terminal domain, score 0.00064"
FT                   /inference="protein motif:superfamily:SSF48019"
FT   CDS             8734..9792
FT                   /transl_table=11
FT                   /locus_tag="CPT_0011"
FT                   /product="Putative phage RNase H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="GOA:D5GV03"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV03"
FT                   /protein_id="CBJ93820.1"
FT                   /translation="MILYDLSSLIHRALHTSIKQMNPHKKDGKYITEEFISGTIFRIIE
FT                   ELLENYRLYRVKYNTMVICIDDHSVPYWRKSLYPDYKAQRKTQREESEVNFKEVYKHIN
FT                   ILIRILNDYTPFKAIGVPGAEADDIIGVLTRKFCKAESILILSPDKDFKQLHKLGDIKQ
FT                   YSAITNKWVVNDDPEGWERIHCCLGDAADNVPRVVDFSEFTPEFKAYYQGTELDFYKLD
FT                   ENLKLGIINNFNEVYPDVEVYKKQRFGEAALNKKIKEFGSLDAFLDSNEIYRLNYNRNY
FT                   KLVMDSEIPIDIELEILKKYTESSTDFNMENLNKYFSFYNITTCSQWFSQLWNEMSKPI
FT                   EMTPWNVDFSKI"
FT   misc_feature    8734..9630
FT                   /note="HMMSmart hit to SM00475, 5'-3' exonuclease
FT                   domain,score 1.8e-06"
FT                   /inference="protein motif:SMART:SM00475"
FT   misc_feature    8734..9285
FT                   /note="superfamily hit to SSF88723, PIN domain-like, score
FT                   8.1e-22"
FT                   /inference="protein motif:superfamily:SSF88723"
FT   misc_feature    8737..9261
FT                   /note="HMMPfam hit to PF02739, 5'-3' exonuclease,N-terminal
FT                   resolvase-, score 7.9e-09"
FT                   /inference="protein motif:PFAM:PF02739"
FT   CDS             9852..10400
FT                   /transl_table=11
FT                   /locus_tag="CPT_0012"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV04"
FT                   /protein_id="CBJ93821.1"
FT                   /translation="MIFLTGGNGYLANLLCNYTSHIDYVAIFGCPSSIKDIDSDPKKLA
FT                   STLDTIVLAKEFKHKIIFASSVGSNYPGLPGTQGYYNRYKNVAEHYITNMYDNYLIYKI
FT                   PRVYGPNKVKGIFKTLKDGTYDGSLETKIDYINEDDFVTWFMENLSSNNKIIEYNKDFR
FT                   SIKVKDLKDLILNNTLYLL"
FT   CDS             10445..11077
FT                   /transl_table=11
FT                   /locus_tag="CPT_0013"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV05"
FT                   /protein_id="CBJ93822.1"
FT                   /translation="MNVRLRIINNQQVPELPSFTDSKEDNLTTDVKLDVLTHQEVDRNF
FT                   ANIITWLKTVSDKIVEQSTVLKQLDPENMEKLLKAAEQIQTISDDIKSLETKYNQVNND
FT                   LTNYKTSNDLALSRKLDSVKTINGIDITGSGNADINITRTQFTNHLTNIGINEIGSIAI
FT                   LDSKTTLVFNNLYAGSSLSTDTYAYMQGTWKCTGKLSDNKGLFIRVS"
FT   CDS             11137..11814
FT                   /transl_table=11
FT                   /locus_tag="CPT_0014"
FT                   /product="Putative base plate hub subunit protein"
FT                   /db_xref="InterPro:IPR024364"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV06"
FT                   /protein_id="CBJ93823.1"
FT                   /translation="MVLEYNPIKLGSRSIKVRNWKVKDRELYKGKLKNISSAEDELKAR
FT                   YECFVTNILETPTALNNDELEYLFLLLRIINLGDDLNYHWWCRSCEKTTDSKIKLSKLF
FT                   TTKSGKIQDIDIGDIKIELQDVQNVELYNNKLRTSDSPSTDDLIFHIKSINGDNTKGFQ
FT                   DIKNYFDELDINTMDKISEAFEKMIFKIESREHTVTCSHCGANSTFNFDEIPDIMPPKW
FT                   LKR"
FT   CDS             11829..12527
FT                   /transl_table=11
FT                   /locus_tag="CPT_0015"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV07"
FT                   /protein_id="CBJ93824.1"
FT                   /translation="MSMYITYIDQGAYNMIVSAQRDNAFLLPGSSTLEVFDSKLFTAVL
FT                   EALADKKTCKFYKDVDVLTLENLEIDESANLVKNSYIFQLTSAMGQIFTRIPQYTYFRF
FT                   QYLNNIFASQGYFITDDNREEMYIKILETDNDKLIASLEEYLKIVNQLNQYEKMYQEFL
FT                   NGLDEMEMTDDEATLDQILQEALNYFTNAQKNFVTMDYKGWFSTIKADYENRQNSAQPS
FT                   NQASNQTANS"
FT   CDS             12660..12866
FT                   /transl_table=11
FT                   /locus_tag="CPT_0016"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV08"
FT                   /protein_id="CBJ93825.1"
FT                   /translation="MNKQNMKDVLEAEANISKFLDPWVLTTFEHQVLVRFLTNEFIGAN
FT                   FDDPETLKYLENRAKFYIEEFIK"
FT   CDS             12969..13763
FT                   /transl_table=11
FT                   /locus_tag="CPT_0017"
FT                   /product="hypothetical phage protein"
FT                   /note="note the Radical SAM family domain"
FT                   /db_xref="GOA:D5GV09"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV09"
FT                   /protein_id="CBJ93826.1"
FT                   /translation="MIFKTRTKKVPFYEFFGDTIQGEGPRLKSAVFVRVAGCNNTCKGF
FT                   GCSAVAPDGSAVTGCDTIRAVSPKFKSQWKYFDNFKDLTSIIDPLVAFKNSEIKHTKDI
FT                   ILTGGEPLLYWNTNVIQDFLAYYISRKHQITIETNASLDIEFFKEYQKEIMFSMSVKLS
FT                   CSGEPKKKRINIKTISKILENCPKSYLKFVVNPETWDTDYAEIKEILYDLPIYTEVYLM
FT                   PMGETRELQIKNTPFVFEKCAEHGFSFSPRAHILAFDTKEGI"
FT   misc_feature    13062..13598
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 0.0061"
FT                   /inference="protein motif:PFAM:PF04055"
FT   CDS             13763..14023
FT                   /transl_table=11
FT                   /locus_tag="CPT_0018"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV10"
FT                   /protein_id="CBJ93827.1"
FT                   /translation="MLSNCVQYNILETTGLIIIKFLLLLVELGFYVSALFLVVLGIVSV
FT                   FKIPGVFYKLFIFIILGLIAFACLSLGYTIGLTNIEFIFKI"
FT   misc_feature    join(13823..13891,13925..13993)
FT                   /note="2 probable transmembrane helices predicted for
FT                   CPT_0024 by TMHMM2.0 at aa 21-43 and 55-77"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS             14033..14803
FT                   /transl_table=11
FT                   /locus_tag="CPT_0019"
FT                   /product="hypothetical phage protein"
FT                   /note="note the sugar dehydrogenase domain"
FT                   /db_xref="GOA:D5GV11"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV11"
FT                   /protein_id="CBJ93828.1"
FT                   /translation="MNLIIGFGVVGQSLGNYFDSKGIEYNIIDPRFNDKDLNEIGLNCY
FT                   SKIFICINVLNDVVSEGQDTKTLYEILNTIESKDFRGLVVIRSTLLPSNVDFIESEYNL
FT                   KFVAWPEFLTEVESLKRAKYHIIGANNIMYAKEIAELIDTPYDFCSLREAMEVKYARNA
FT                   LGALKVLFFHELNEAGFNVRKIELLLNEFEDFDSQGLMAKLCVDGKKGFGGKCFPKDIQ
FT                   ALMFESNKQSKQAGDFFRNILEANNQLRYCCKKS"
FT   misc_feature    14033..14503
FT                   /note="superfamily hit to SSF51735, NAD(P)-binding
FT                   Rossmann-fold domains, score 2.4e-06"
FT                   /inference="protein motif:superfamily:SSF51735"
FT   misc_feature    14504..14791
FT                   /note="superfamily hit to SSF48179, 6-phosphogluconate
FT                   dehydrogenase C-terminal domain-like, score 3.8e-08"
FT                   /inference="protein motif:superfamily:SSF48179"
FT   CDS             14828..15205
FT                   /transl_table=11
FT                   /locus_tag="CPT_0020"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV12"
FT                   /protein_id="CBJ93829.1"
FT                   /translation="MNMNVQNPKFSFTEDQTKQVLMTAYHLSQASEYIQETNGMMSLMF
FT                   NSMAIELLDQAGLSQAFLDELGYTKTTEPKIQLNKKEQAEVDSLFDEILNGSKSTTKVE
FT                   TEVKDLKCDHESCGCKDSKGI"
FT   CDS             15205..16143
FT                   /transl_table=11
FT                   /locus_tag="CPT_0021"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV13"
FT                   /protein_id="CBJ93830.1"
FT                   /translation="MVQQELRKIIFILFDEHLLSQVVEMFEKYEYIIENNPEGIETKTA
FT                   YLISKIYTTGDKSKVLDYLKQLGELEATDIFPDIKMLQCKLAMNCYENNLIEYSKLIAT
FT                   FDKNDLDYAQVNNPVVYNTPALYRVSINGKDFDDNINNINKCLTYLGDKVVFRQTIDKV
FT                   DRPSYKNYLKIRHSLELGDYDYGFDAVKALQELFYQEGLDAKINSVNYKELLSDYIIIM
FT                   DFMSAFQLLGYKFTDKPEYNKLKQMFKDIIIELSVDSLLILETSQENVLKTLAETKKRL
FT                   INDVKYDASEVDAYLGPILQRIKDSGKRFNR"
FT   CDS             16121..16345
FT                   /transl_table=11
FT                   /locus_tag="CPT_0022"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV14"
FT                   /protein_id="CBJ93831.1"
FT                   /translation="MVKDLIDKNQAEVQLKIQDLQDIRVGIKYALRCAKKINLNSESNS
FT                   SLDSDLSQEELNFLACLTCLPKTKTKNKG"
FT   CDS             16347..17450
FT                   /transl_table=11
FT                   /locus_tag="CPT_0023"
FT                   /product="hypothetical phage protein"
FT                   /note="note the Radical SAM family domain"
FT                   /db_xref="GOA:D5GV15"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV15"
FT                   /protein_id="CBJ93832.1"
FT                   /translation="MAGKLIVEFSLDTKCNLACKYCYSAHTPPNPMSIDTAMKFFDRIN
FT                   YMLDYYDKDSYHISYFGGEPLLNWEVIEATLPKFQEDPRCTSYVVITNGALLDPKKVQF
FT                   LKAHNCGISLSFDGLWQNTNRPVVEGTFEGTLDYFKQNKALIHSITDTCKVMIQPKNFT
FT                   TMTENFEFFVNDYEFLRPDFCLVRDNIYTKSQIETFAIEVERLAHKVLEYQHKGIPASV
FT                   GLFDLYALDILAGARFGKRDHGCFVGNNGCLYAVDGKFWPCERYRSTNKMVLYSPESGL
FT                   NLKNLKFMSKYADPRKFKKCMKCEIREYCNVGCTHQEMREAKFEGREPIDSVCHLFKYS
FT                   FKWAMFVFKNSTKEYKDYLYRRLEVGS"
FT   misc_feature    16371..16853
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 1.9e-05"
FT                   /inference="protein motif:PFAM:PF04055"
FT   CDS             17532..17864
FT                   /transl_table=11
FT                   /locus_tag="CPT_0024"
FT                   /product="hypothetical phage protein"
FT                   /note="Possible phage clamp loader subunit"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV16"
FT                   /protein_id="CBJ93833.1"
FT                   /translation="MANIFEQFTNCLKDKDYNESLGFNSFMFCRFLGSSPSTLQLANVI
FT                   NILYKSLPDEAQYNLVRYAKNKPKFIRFTKALAESESIKEIQLKYKVNKEVAKLYASIL
FT                   DSIHRS"
FT   CDS             complement(17892..18497)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0025"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV17"
FT                   /protein_id="CBJ93834.1"
FT                   /translation="MNFKEAQKTPARGYFCIESLDANGNVIDKFEQKNLITNVARAEFA
FT                   KLIAGINESNAINRFVMGTKGHQGSDILTPKDETTGFTASVTNIFSGQEQGDINRTWNQ
FT                   VIFTPSGNMVNTAATNVQDGANNNSTVDITVTGIEQAEPVVTYTINIAQDAFNCANDGV
FT                   VYTEAGLYSDTNLIAMRTFKGKVKESTVAFRIQWSVMF"
FT   CDS             18561..20072
FT                   /transl_table=11
FT                   /locus_tag="CPT_0026"
FT                   /product="hypothetical phage protein"
FT                   /note="note the nucleotidylyl transferase domain"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV18"
FT                   /protein_id="CBJ93835.1"
FT                   /translation="MQKDQIDISILNANKYLTSQARKEAFIYDKVKVEEKYDGIKVTIV
FT                   HIDKTGDYKQDFIVSYKSNIIYPDEFEYAVKSKIRPESINNSQFTFIFDILKKCDSKSL
FT                   PLNYEFFVEFLMKKPTLQHKYKKMGAILLAYSPCTYEVKFGRLFTKPKGFYTDSRETYA
FT                   KKLGFDYPRTIFEGNFANFERGIKSQELNDIFRTYKNILKIENIDLYIQQISEMFLKME
FT                   SKYGGKPEGYVLTYPGFLLKIQQPYQVDPKARAETRSQYQGDPDTENAYWANVRLAALN
FT                   IIGASNIKGSLNEILQRYGEALKKYKLNFTHPKKTQFQIKDDIQGNIKMIVIKRLKGNN
FT                   NFLFLGKFRILTKAHYNIIKNGLKKYDNGAVCLVTSKDTKEFEDLRLEMLKSCFPEIEI
FT                   IQHSTGNIISIMNKSKMNINAVLCGSDRYNDYVNQLRANPDIQVVETPRDTGAISATAV
FT                   IENLNSEIFFKRNTPSEIHSMYNKILKRFKSLGLVSDLSKEPENK"
FT   misc_feature    19575..19946
FT                   /note="superfamily hit to SSF52374, Nucleotidylyl
FT                   transferase, score 5.7e-06"
FT                   /inference="protein motif:superfamily:SSF52374"
FT   misc_feature    19587..19943
FT                   /note="HMMPfam hit to PF01467, Cytidylyltransferase, score
FT                   0.0053"
FT                   /inference="protein motif:PFAM:PF01467"
FT   CDS             20098..21285
FT                   /transl_table=11
FT                   /locus_tag="CPT_0027"
FT                   /product="possible virion structural protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV19"
FT                   /protein_id="CBJ93836.1"
FT                   /translation="MTELRLNVDSKDTIEAGDYKSTQRGMLTFSKNAVYLGDGNKANKI
FT                   IDAESLKTEIEKVQNNVNNTITQQIQNVNNTITQVQNAPAVQFLNICDNATDLATLKSS
FT                   VTLKNVFDNWVRHSIMNSASGPKLDDDAGQAEAAKWSYIEAEDAIASNINSSYYNMFLS
FT                   NDVKDTYSVQISAVGQDGDDDVLSIVVAAKMINGKLYTLSALRSLQLNALPGGTSWGLF
FT                   FNYCGNNEEPYTTYRLLASKGDITNNYPKTTWRAGRHLLKVTRTKNRVQCWTSDLNKAL
FT                   DNNSLIDYTLPTTKPSVLSNNEFNVLKELLNSPCQMGFGNWSQNIKFYFDSQSGVYDDT
FT                   IIDISKNQKWTYNSSNKTWVASALDNSIIPENVLISSKKTKKLFYNNGIEISSLN"
FT   CDS             21329..21505
FT                   /transl_table=11
FT                   /locus_tag="CPT_0028"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV20"
FT                   /protein_id="CBJ93837.1"
FT                   /translation="MAIAVSVGIICFLIDFYMHRTLSWKMFIIFCIITIYYDIKLIRDV
FT                   VNESSDTNIKHKI"
FT   misc_feature    21389..21445
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0028 by TMHMM2.0 at aa 21-39"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS             21515..22051
FT                   /transl_table=11
FT                   /locus_tag="CPT_0029"
FT                   /product="Possible EndoVII packaging and recombination
FT                   endonuclease"
FT                   /db_xref="GOA:D5GV21"
FT                   /db_xref="InterPro:IPR004211"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV21"
FT                   /protein_id="CBJ93838.1"
FT                   /translation="MQDLKPQELKTYEIGELIVLNTKTAKELRDSMVESNPVCPLCGSK
FT                   IFNPVLDHKHSKKQEILGVQGAGLVRNVICSTCNIFLGKMENNYKRYRIQNLADFLRNA
FT                   ANYLETDTTPYVYPSEAKKLKEIFPKSLYNKLIKTIHLETKKDINYIKKKIKYTKYLSQ
FT                   KTKDLLISYDLYPGS"
FT   misc_feature    21563..21862
FT                   /note="superfamily hit to SSF54060, His-Me finger
FT                   endonucleases, score 9.6e-12"
FT                   /inference="protein motif:superfamily:SSF54060"
FT   CDS             22100..23809
FT                   /transl_table=11
FT                   /locus_tag="CPT_0030"
FT                   /product="Possible phage prohead assembley initiator
FT                   protein / portal protein"
FT                   /db_xref="InterPro:IPR010823"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV22"
FT                   /protein_id="CBJ93839.1"
FT                   /translation="MGLLESIKNSIIGEKIDRPFLEQPINKIDTTVPFGRVINTLSDDE
FT                   PLRFQTFFDNVNDITYVDNLQKASEQAQKIDIYRQTAKIAECWSGLTEIVDEVAYCRDF
FT                   KDPIKLEVDTSNKKIDIAISNAFEKIMKLFGTQKYLHSFIRQSYIDGQMNILIKYHDDK
FT                   KKGIKELYYLDPRYLWYDLTDSKYKYIDINSSVALKNNFLGNQRYININGKTPVRIDQA
FT                   ALEYDIEEIVHQNFGLFSDSGICLSELEASVKTANQLKTLEDLLIPLRFSRSISRRVFN
FT                   IDLSELPNSKAEAYMRDLTNKFKYKKQYNPETGEVTNNQHIVTMVEDYWIGNKAGAKGM
FT                   QVDILDETGNLGELGDIMFFYKLLYRSMGIPVNRIYLDDQSQQPLFDLQADAITNEDIK
FT                   FFQKITRIRQVYTEFFMQILKRELICTKVCTEKQFQELKDSINIYFSEENQFIERMNLT
FT                   LFMKRVDAFSTAKDFGGTVLPVDTLYKEIFRFNDVEIKKNLKAIQKESKNPLYKQFYRD
FT                   FESGDEFSSDSDYDSDSGDEPKYDDSNNNVNNTDTEEEYDKTGLSIKKDSLI"
FT   misc_feature    22100..23614
FT                   /note="HMMPfam hit to PF07230, Bacteriophage T4-like capsid
FT                   assembly p, score 1.1e-21"
FT                   /inference="protein motif:PFAM:PF07230"
FT   CDS             23882..24175
FT                   /transl_table=11
FT                   /locus_tag="CPT_0031"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV23"
FT                   /protein_id="CBJ93840.1"
FT                   /translation="MNKIAKDPNNYAHNVMNDLIDRVRNEKLIFTFNGKKYFLDHVDSY
FT                   QHGEDFGLFFRGLDSESDRCCMEVLGCELFIFNKKDYINLDSFEVYEGWLSF"
FT   CDS             24206..24577
FT                   /transl_table=11
FT                   /locus_tag="CPT_0032"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR016133"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV24"
FT                   /protein_id="CBJ93841.1"
FT                   /translation="MKLIDGYYVDSNNNKWSASRYTEEQAIKVSESLVNCKNCINCSNC
FT                   KNCFDCEDCINCSNCKNCIKCEDCVGCKNCVKCLDCESCDYCYNCVICENCGECEDCDH
FT                   CNNCDDCFGCYGILKQENV"
FT   CDS             24629..25918
FT                   /transl_table=11
FT                   /locus_tag="CPT_0033"
FT                   /product="Possible phage DNA ligase"
FT                   /EC_number="6.5.1.1"
FT                   /db_xref="GOA:D5GV25"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV25"
FT                   /protein_id="CBJ93842.1"
FT                   /translation="MQIITDFLNELNASNSSNYKLEVLKKYNNEIIKEFLSLVYDKVKY
FT                   SYGIKKVPEFQNNNETIDFNVIKNTFIALHNRDFTGNKAISVVQSLLNNKTPEITRIIT
FT                   CILDRDIHSGISTKQINKVHKKLITEFPYMRCSLMDKFKNIRFPAMIQIKADGTYRTFI
FT                   KKGDSVQAFSRSGESYDHPKVYSALLNLPDGAYIGELICNEVEGTNSTEIRYKSNGLLN
FT                   SLTPPENVTFYMWDYLTLEEFENGNSKTPYKERFEFVWRLTESLESNTLTVVRTRVIDN
FT                   IEAANEYLNTWLKEGEEGAILKNCDAVFKNGTSTEQIKLKPEIEVEVRCIDFTEGNGKF
FT                   KDTFGAIVFKTDDELIQGKVSGISDTERVEIFKNSSKYLNKVFTVKATALTKSEDSEIY
FT                   ALMHPRFNGFREDKDYTDTLDRVKNMGLKF"
FT   misc_feature    25004..25567
FT                   /note="superfamily hit to SSF56091, DNA ligase/mRNA capping
FT                   enzyme, catalytic domain, score 7e-22"
FT                   /inference="protein motif:superfamily:SSF56091"
FT   misc_feature    25040..25591
FT                   /note="HMMPfam hit to PF01068, ATP dependent DNA ligase
FT                   domain, score 1.1e-07"
FT                   /inference="protein motif:PFAM:PF01068"
FT   misc_feature    25313..25717
FT                   /note="ProfileScan hit to PS50160, DNA_LIGASE_A3, score
FT                   10.990"
FT                   /inference="protein motif:ProfileScan:PS50160"
FT   misc_feature    25568..25858
FT                   /note="superfamily hit to SSF50249, Nucleic acid-binding
FT                   proteins, score 1.4e-14"
FT                   /inference="protein motif:superfamily:SSF50249"
FT   CDS             complement(25935..27485)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0034c"
FT                   /product="Probable phage tail sheath protein"
FT                   /db_xref="InterPro:IPR007067"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV26"
FT                   /protein_id="CBJ93843.1"
FT                   /translation="MPVPSVRFIDSDTSSTSNYSQPRRVFYAGYFDKGSPDTLTPVYSI
FT                   LDFKTKFGKPNKNNINDWFQIYNYFLYDNNEIVISRSIGENSVNASISYPFNDFDVRID
FT                   NLDDFRNKPIISENNFLRIIARNPGEWGNDLTVCIFTQYEVLNNMLIHSNYLAKDIQNS
FT                   MSSNQYCICVFLKDTLMEKYILKESEDMVDTINENSNYIFIIFDPKKYKLYDGNINYVD
FT                   GLNRLADGNEPNSDKTVFYGSNSLKLSNGYASLPSTTQIDETYKSVGESNDYVFDFIIA
FT                   NTQSPNSAINLADTRGDCCAFIGIPRGIKPEEYIKQLQISNNAVVYYGSKLQLNPFNNQ
FT                   NIYVNCIGDIVGLRTRLINSQELSVSHCKTIYSFLNTIDLDIYLTESQIKDLYDLNINI
FT                   VKKGYSGIYALSENTLKGSKLTNRIIYFNLVRECENVALYYVFENNNEYTRNDLASKIK
FT                   EICRSYVADNNIEDFKIVCDISNNPTQDNNIYVDVYYKPKYLIEEVVFRIQAASELPS"
FT   misc_feature    complement(25947..26627)
FT                   /note="HMMPfam hit to PF04984, Phage_sheath_1, Phage tail
FT                   sheath protein domain, score 1e-13"
FT                   /inference="protein motif:PFAM:PF04984"
FT   repeat_region   complement(27509..28820)
FT                   /note="IS200/IS605 family insertion sequence element
FT                   ISCaje1 (TnpB component only). 97% DNA ID to ISCaje1
FT                   element in CPt10 in non-synonymous location"
FT   CDS             complement(27555..28799)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0035c"
FT                   /product="ISCaje1 transposase"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV27"
FT                   /protein_id="CBJ93844.1"
FT                   /translation="MLSRKIRIDNFISDKEKEEIYQYSKSLSAIYNECLDLLKENLNFK
FT                   DLSKITKGGSKATGLHSKHIQNTSREVINAVKSYLVKKKNDKSARFPKLHREYSPIIMV
FT                   ANLSSKTEEIVNSRTGEAILEKKYYPGGGFKLEGKKINFTSIGFELDLSKCPYYDIELI
FT                   NYETLKQIVIKIDENKRIDCIFVFSEKKQEKAPNQNFLSIDLGISSIASCYSNKIDCLK
FT                   IQTKRFKGLERTINELKSKRDKKKKDSRAYKKLNKTIRRKQAKLTNKRKDYLHKASKTV
FT                   VDLCILNGIDNIICGDIKTKKLKKDYKTSLNKSTQNEGLLSRFKGFLKYKAENKGLNFL
FT                   LVNEAYTSQTNCLTGKRELDSNLSIREVELSPGFKVDRDINSAVNIAKICGDLWLSHIF
FT                   EKNRLLKIQKMNITL"
FT   misc_feature    complement(27633..27839)
FT                   /note="HMMPfam hit to PF07282, Putative DNA-binding domain,
FT                   score 2.3e-10"
FT                   /inference="protein motif:PFAM:PF07282"
FT   misc_feature    complement(27756..28004)
FT                   /note="HMMTigr hit to TIGR01766, transposase, IS605
FT                   Orf,score 1.8e-15"
FT   misc_feature    complement(27882..28787)
FT                   /note="HMMPfam hit to PF01385, Probable transposase, score
FT                   8.6e-05"
FT                   /inference="protein motif:PFAM:PF01385"
FT   CDS             complement(29116..30318)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0036c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV28"
FT                   /protein_id="CBJ93845.1"
FT                   /translation="MSDFRYQGYNFNLTSFREFVQEFNIMDNQRASADALNKSVNKLKR
FT                   EVNQLIGQFKILTSKESIRWDASIIYEAGEIVSYITEDNPDIETIKNSYYLALPSDIEN
FT                   QGYYPDTNSDMWKKVTLNELYPWLDVDNYPTKTDNDKDWPIIDDYDVINLKYLKWALEQ
FT                   FKDFLDGYLAGIYIKQDNKIDLEISKPTHVTTKKYVDNLIDEVKQSITNIDDLLADYVF
FT                   VDSKSKQLQTRKSKKEAWLTTEAGLLPGLNLVSTIGSTTQQFKAMYAQDFIGTALKAKY
FT                   ADLAEVYETGKEFEVGAVLGINENSEIEYFDIYKHNRPLGVVSDKPGFILNKDCKGVLI
FT                   ALKGQTPVIVKGSVRAGDELYAEYDGYACVNPSKKEEKYFIGIALESKESELVGLVNTK
FT                   V"
FT   CDS             complement(30382..30744)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0037c"
FT                   /product="Possible outer wedge baseplate protein and
FT                   lysozyme"
FT                   /EC_number="3.2.1.17"
FT                   /db_xref="GOA:D5GV29"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV29"
FT                   /protein_id="CBJ93846.1"
FT                   /translation="MATYKDFHNDSLNNVVIDKQAIEQSIFNILTTRKGSLAGKPEFGC
FT                   NLYAYLFEMIDHITINSMQTEITRCLKVYEPRIKVQSVDIYSQPEFNRVILSINYNFTG
FT                   VETSSFETYTITLKTN"
FT   misc_feature    complement(30394..30690)
FT                   /note="HMMPfam hit to PF04965, baseplate wedge protein and
FT                   lysozyme domain, score 3.8e-15"
FT                   /inference="protein motif:PFAM:PF04965"
FT   CDS             complement(30797..31219)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0038c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV30"
FT                   /protein_id="CBJ93847.1"
FT                   /translation="MALEHITVDPVKVDINGSIYEKSQAEVKAIIAERTEANLADNEVS
FT                   APSVETTLSLNPATKQTIEKGQTKDITVTTNASDFTVESNNTNATVKKGSGKFTITAAT
FT                   KGTSEITVKATAQGGSEKVVKLSVEVTEAAAGAGQG"
FT   misc_feature    complement(30845..31075)
FT                   /note="HMMPfam hit to PF02368, Ig-like domain /
FT                   intimin,score 0.074"
FT                   /inference="protein motif:PFAM:PF02368"
FT   CDS             complement(31363..31689)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0039c"
FT                   /product="hypothetical phage exported protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV31"
FT                   /protein_id="CBJ93848.1"
FT                   /translation="MNFYDALFGSLPILFIGAVIGAVQFLHIDKTAKHETNFLTRFKLF
FT                   FKTSTTSGILALSSFLITDNFDLTYSSRIGVSIFIAFAGYEKIQSIIDRLLDNISPKDK
FT                   DSKL"
FT   misc_feature    complement(31606..31674)
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0039c by TMHMM2.0 at aa 6-28"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    complement(31627..31689)
FT                   /note="Signal peptide predicted for CPT_0039c by SignalP
FT                   2.0 HMM (Signal peptide probability 0.670) with cleavage
FT                   site probability 0.639 between residues 21 and 22"
FT                   /inference="protein motif:SignalP 2.0"
FT   CDS             complement(31750..31962)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0040c"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV32"
FT                   /protein_id="CBJ93849.1"
FT                   /translation="MGEQAKDLKKRLRYYWFVFRWFLIGRYHCTDSEPYTISLRTVWKI
FT                   CNRTIWGVITFSLIYAIASFFDYVG"
FT   misc_feature    complement(31756..31815)
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0040c by TMHMM2.0 at aa 50-69"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS             32212..35856
FT                   /transl_table=11
FT                   /locus_tag="CPT_0041"
FT                   /product="Possible phage baseplate wedge protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV33"
FT                   /protein_id="CBJ93850.1"
FT                   /translation="MAIIKETLPFTYDEIYQDIAKRLIEKGWDGGAYEGSNGAILASVL
FT                   SYIVSSLNFNTAVNVNENVLTLATKRKNVIQDARVLSYEPSHKKSTILEITLSFTRTGY
FT                   FKIPKYSTFTINGFTYNYLGDDLEFNIDKIGATTTIQVKEGTLIKNEEYPDILTYKIDE
FT                   KFEYIDIPWNDVEDDGVECYVTYYDTFGNLLDNATFVKSSFNLIDIKDSTNNKFFRKDD
FT                   VDTGNARIYFQLGTAGTKLPSNTRVYINVLRTSGKDAYYERCDSASVNGDLGSFCKILT
FT                   SGKDVPVLVSQAQDEESIESIKTNAPMFYNSASRTVTIHDYNSVIKTHSSVKNVVTWGG
FT                   EDEYPVAPGNLYFSAEPRRKEPEFTIFKKVQQSDGTYTYKKENSTLANGELLNTTEIST
FT                   NQYYIKESYNDPDTLYLNDGEVVSAEKDANGYKNPGIFDLVDTYNLPALKNNLKNPTYV
FT                   NIDLQVLIKQYPFGTPKSDIRKKIYAKIREKMAEIEKFEGEFIHSNLVRHLDNELGLGN
FT                   GIEVKPYFSLLLSEENCVKQFKENKDFSKVNCFYAKSYDKLSKNLVLSVYFSLLASVGD
FT                   KLEVYFNKESLPFILDNTDHYTYELTDTDVNQSYKSFYFKDVGFDEESLNVRIVSYDGL
FT                   TTYGGNDINLYNLKNKTVFFNVNIGNELSVIKIALPRFVSVGDSFKVYGLYGSRKAEQL
FT                   IYDFYITEEMLSQGYLQCDDLQRGKYAGFVGASDYKVVYTCNKESLKPSDDEEPDSNGL
FT                   KSNQLLGTASGSWESAVNQTESQDNVFGDIETSNLYYNWYEDSDGQIDIRVWIPSSVKA
FT                   NDTLLIDYVQKTTSIVITDAMIAQRQFDTKIDGILLDITKISFGSTDGSIGIYPTYVER
FT                   QNELTPVEDDRIQFVAKQFENITEYTPTTTFDREVQLKSNEKITFYVNYNNKFDVRNLI
FT                   ANHDDSLDSYTVSILEDSPLKYEAPYIVLNNYRKTGTFNFNLDVQVKRGDLLYQNQIVY
FT                   VKEAAVDLSVDEGPGGAYVYLDLPIEGIYDAKGQIIPENIPVIEWALFTKANPTEGEDN
FT                   ELICFEEIQEPSKTHKVIPADLTDYVAEQKIVVDYVIDEESVKTMLPFYTTVEEYINLD
FT                   LSKVAYIRIPIKLVNRSATTPEEGEQIVGSYTIFNSRIPYIRVKLQTKIFQPGYNYEFM
FT                   LNYPSYNFKLIRNSIFRLRSVVFDDLLDYQEVRDSLRAGDIDMSAMSV"
FT   CDS             35925..36599
FT                   /transl_table=11
FT                   /locus_tag="CPT_0042"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV34"
FT                   /protein_id="CBJ93851.1"
FT                   /translation="MKFSDFLEEQAIAKSGDYDFGNLDYLYTGITGYVSKKVTNVLYKF
FT                   DFVINGKNTELFIIECKSNHPKQKYYCIAKEELDTTSEPHTMRFKPLAAMLLEYTTKYR
FT                   GLGYGPFRIVKGVETLQSYWGKGIGKKLYTILVDDFKWVLMGDEEQYEGARNLWTSLSK
FT                   SPGFNVDIVELATGKIIAKNVKLKDALDPRIWTDEDLFLTGTKEERIRGRFNRLVLTKV
FT                   TN"
FT   CDS             36610..37275
FT                   /transl_table=11
FT                   /locus_tag="CPT_0043"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV35"
FT                   /protein_id="CBJ93852.1"
FT                   /translation="MKFSDFLEEQAIAKSGDYDFGNLNYINKYGLTSIEYTFDKSPFVY
FT                   KVYYNGKEYYFYRRESYHILATKVPEDYPTKDNPNGTKDRFSPIAMIRLLPTDKIKRMG
FT                   YKNVYTVSAVEVDRDHRGIRLGKLLYYLSTVVLKYTLLGDSEQYENARRIYYSFSNNPG
FT                   FTVDVIKLGQGILAKNVNLNDHNDERVWSTTPDKVGTLHRVVLKSVHMESKVEVEKLK"
FT   CDS             37329..41489
FT                   /transl_table=11
FT                   /locus_tag="CPT_0044"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV36"
FT                   /protein_id="CBJ93853.1"
FT                   /translation="MFKSIAKNLVPENYKSNKFIMDALDVFVDYIYDNSSLAIDINNLY
FT                   NSKNEVLYEEIIKTYAANFYKTITDGSKNHKLAEAVRKAHEKYGFDFSETQLDINVIHL
FT                   LSQEQLELFKNFQQSKGTLRSIEFIYRIIEQLNIESFVLETDGQLTIEPGENIFEYRVY
FT                   GSMLPEIFEAFVKPLAHPVGWTYLFTRTYVLKFEDYFLCKEVYDVNVFRVTCEDSDCED
FT                   NFKTNTGYLFETDINNNIIYENNKPKMYKADGNPVFNVTRFGVNYPELTLESELKLVKD
FT                   PTIRTIEKSSIKGNDKLIVYFESGERLEQNSNPKNLILYYYKGINSLNQEIKKDYTDFL
FT                   SKCALELNYIRRVVTTVKDKYQFQVDFGLASTTGKFAAIGAGNMYLGSDTWILGKNRIN
FT                   TNTPVTYGTRVRNKVLQTSDFKALYKKNDNSIRQVFDKVYSGFDDHVKSSTCNFILESD
FT                   NLYHYRLYNPNAIFFELINTYGYRVRAKIKYNEDSLEVIAEDELKNTQLLYIDKTLFSK
FT                   YNSQVYKDFKESMNNPLGQYYTVLKKGVNYLNIVDSNGHIVKGNYRLVDSEYRLYLNIK
FT                   DPVTIQFIDDTYEYDSRPFQIIDVELSYNKDSKLYEYTTPEKEYYFVNVANRVSNVDLD
FT                   ITYIAGLQKGFKITSSTAQKIRVYVIDNTSKRFPITILSATAEVIQAKENSIFLGLINA
FT                   DNQYVEGQIVYDSEGKLATLDCNAKTNNLSLLYLDYSASTQNPITIKSTTFDIAGNFSE
FT                   INNKRGKFLYNFRIENIMIVNIFDKNNQRIQLDYDIENTGVSFYTDSNEAITIQYFDNI
FT                   DEGIPRTYAIDAEFKLDTSYINYNAKIFKYKDILLNIDTSTNKYVYKHNEMKTYPLVVM
FT                   DTDGNVLDVEMDILNTGFKISYSEGIKVRIYYLDDTKNRANVTYNKAENPDITKLLYAV
FT                   KNGVIIKQDIDTVSTENFYSFSGLKTLKIKKADLKAVESNDPDSKLGKYKFIKNIEYGL
FT                   PVMAGFNNDLKFKVNEDSITIYTGTKKDINIRYVEKVNEESFLYTYSIRKDDDLFIDAQ
FT                   KDSIKYLIDYQYDYLNNRIIFTKEDDDIVKLFFLKNKHNKKTILSINNANFEDIDFPIK
FT                   IYLNDDFVEFENKESMQLDINPLNLKFNQDIKNRNSTIRAINKNLEVLEQIDFNLAPQY
FT                   TFKALGDYLYEIDFNKIKFKENKLNEESLWYRESSVYHNHYVGYFAANNVQPTQVFTGT
FT                   SNKLDYELRETNPWGLTAIDTFELTGTAASDGFDVNFEFIDSWPEITEVYKNDYTGFYQ
FT                   NKWGWQSGYVDVYQTTRDLERFNEKYERLEHASVYQMDDYIVIGSNDITKDYMFKWYPT
FT                   SKSDDFSDSFLRNGQVSEPVTPNKIYTGKYDREPDNIINKTNT"
FT   CDS             41505..42263
FT                   /transl_table=11
FT                   /locus_tag="CPT_0045"
FT                   /product="Possible phage tail tube protein"
FT                   /db_xref="GOA:D5GV37"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV37"
FT                   /protein_id="CBJ93854.1"
FT                   /translation="MADIIQNKMNQVLGDLARPTKFKCQIFPPKEIKCELSILNEGDSA
FT                   TSSTSEISQYLDYFCHATSFPGLTVETIDFKYRGRTLPVKSVQTYQQKWSATFYNDEKH
FT                   AVRKLFLDWMTYDQAHQFEDKTKGNFEGILPSISIYQLDFEMSKDCVVYTMMNVFPTNV
FT                   GEISVQYDGLNQIETFTVEFAYTHFEINTISREGLTSSEVTSLIKNTIQNTINNVTNTL
FT                   KDAVFGALDDLVSPVLDSVSDSFENFISTK"
FT   misc_feature    41619..42068
FT                   /note="HMMPfam hit to PF06841, T4-like virus tail tube
FT                   protein gp19, score 2.6e-08"
FT                   /inference="protein motif:PFAM:PF06841"
FT   repeat_region   42322..42358
FT                   /note="Repetitive Region 1.1"
FT   repeat_region   42359..42430
FT                   /note="Repetitive Region 1.2"
FT   repeat_region   42431..42502
FT                   /note="Repetitive Region 1.3"
FT   repeat_region   42503..42574
FT                   /note="Repetitive Region 1.4"
FT   repeat_region   42575..42646
FT                   /note="Repetitive Region 1.5"
FT   repeat_region   42647..42718
FT                   /note="Repetitive Region 1.6"
FT   repeat_region   42719..42790
FT                   /note="Repetitive Region 1.7"
FT   repeat_region   42791..42862
FT                   /note="Repetitive Region 1.8"
FT   repeat_region   42863..42936
FT                   /note="Repetitive region 1.9"
FT   repeat_region   42937..43001
FT                   /note="Repetitive Region 1.10"
FT   CDS             43063..43488
FT                   /transl_table=11
FT                   /locus_tag="CPT_0046"
FT                   /product="Possible phage head completion protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV38"
FT                   /protein_id="CBJ93855.1"
FT                   /translation="MKFKQGIYIPKNPEKYIHSYTKMNEHTEYPVYRSSWELSFFKFCD
FT                   YSHSITKWSSEPVGIKYFNPVKKHQSTYYPDAMIIRNGITFLIEIKPKSQLPGSNSKSS
FT                   YDKLSAAVNEAKYNAAKSYCEANNMQFIILSDSFFKS"
FT   repeat_region   43718..43790
FT                   /note="Repetitive region 2.1"
FT   repeat_region   43791..43863
FT                   /note="Repetitive region 2.2"
FT   repeat_region   43864..43936
FT                   /note="Repetitive region 2.3"
FT   repeat_region   43937..43972
FT                   /note="Repetitive region 2.4"
FT   CDS             44088..44747
FT                   /transl_table=11
FT                   /locus_tag="CPT_0047"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV39"
FT                   /protein_id="CBJ93856.1"
FT                   /translation="MRLTYKHKLYTKHQDIINTYLRLKVEFNLFKLDYKRLRYSSMFTQ
FT                   NTRLKTQKQIEELETKLTKKGLNTQKLRKLYTKIVNKKPFNTFEQIIINNFAENGKKAP
FT                   QLFKHERKFDDRFTGLLLERKKRRAKAAKEVYARRPLSPEKQKAQQLVPYIFQFIKLRT
FT                   MEKFGYNEDLAVEITGRIFGPGCEEALDIYLKEFRDLYGNTDQALEHFKKVELLAN"
FT   CDS             44805..45572
FT                   /transl_table=11
FT                   /locus_tag="CPT_0048"
FT                   /product="hypothetical phage protein"
FT                   /note="note weak similarities to T4 late transcription
FT                   factor"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV40"
FT                   /protein_id="CBJ93857.1"
FT                   /translation="MSETRMKHDYTNELELKSLAIREKNLKLNLGSEDPDGSINEDLDI
FT                   KIKEYVKTKDPDLKDYIISVSEGVKISPKSHEYFGSIVILMIKKILTKPNFSGYTWQDD
FT                   FYSDACYRVFKYIHNFDHTLKSKITNQSVSCFSYISQIIHNSILAIINEKNKKDKELEN
FT                   LACMYNSEYDIHNESRNVSTLDIINESSVDYTIPNFNLKMIENILETTENKYKNVNIKY
FT                   NEGFISFDDYAEFKNVLSNYKHFNVNLTKGDSK"
FT   CDS             45569..45823
FT                   /transl_table=11
FT                   /locus_tag="CPT_0049"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV41"
FT                   /protein_id="CBJ93858.1"
FT                   /translation="MNISQDLIAKEIKTLNKFYKFLREHKNECAMEIMQDFCDLNDIPL
FT                   EELGFLISEDAYLKDYIEANLIKYKFYKSPKKTVFSDDF"
FT   CDS             45994..46713
FT                   /transl_table=11
FT                   /locus_tag="CPT_0050"
FT                   /product="Possible prohead core scaffold protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV42"
FT                   /protein_id="CBJ93859.1"
FT                   /translation="MLDKVLSNDSFKDVLTESVKSEIESVFNEAVEIKAVEIANEQIEL
FT                   EKIKLVEEFKEAKKELESKITKNIDSFINEELSKFKDEVLEKLDAVVESEKAATLVSIF
FT                   DNLVDVAGSNILENYTNKDSELRDQFDKLVVENRELKAELEILQESKKIDELAANLNLV
FT                   ESEKFKKLASLVERGEGFESKLEALFEACKKANEDDSDADSDSKDSDDSDSDSKDSKDI
FT                   KESSKNKAGAGINWANY"
FT   CDS             46785..48119
FT                   /transl_table=11
FT                   /locus_tag="CPT_0051"
FT                   /product="Possible phage major capsid protein"
FT                   /db_xref="InterPro:IPR010762"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV43"
FT                   /protein_id="CBJ93860.1"
FT                   /translation="MDKNVSLNEKVESYIKDSRYAALNESEAVLMSTLLSNTALASQGA
FT                   LVGESVISSDIAQFTPILMPIVRRVYPALVANQLLGIQPLTMPTGYIYALVNRYTGNKK
FT                   DGAVSPVGKAQILVFEANVTKGDTVTGTTSTATGKIIHVEKDGKTALVQLTNDKKFQNE
FT                   EANKGTRIVNVYSNEATFHKILETYSGPYSTADGEKLAEDMNTVGFGIEKDTVEAKTRK
FT                   LKAEYTLEMYEDLKNQHGVLADEHLANLIAAEMQTEIDREIINFVNNTATVVADTLSPG
FT                   HEHKEAGRWEIERYRCNAIKIDLEARNIGLMTRRGSGNTLLVSPKVATMLDQIGTFKFA
FT                   SSSSNIATDVFTGNVGTYDGRYNVIVDQYAKSDYITVLYKGSTAQDSLGFFCPYVPLSF
FT                   QKVMNQESGQPGMIARTRYGLATNPLEPENYARTFGVDLTGTILA"
FT   misc_feature    46785..48101
FT                   /note="HMMPfam hit to PF07068, Major capsid protein
FT                   Gp23,score 7.1e-11"
FT                   /inference="protein motif:PFAM:PF07068"
FT   CDS             48293..49909
FT                   /transl_table=11
FT                   /locus_tag="CPT_0052"
FT                   /product="Possible tail sheath protein"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR017868"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV44"
FT                   /protein_id="CBJ93861.1"
FT                   /translation="MWFERLFVISNHIKRIKMANLLSPGIQVSEVDQSQITPVEGDSAA
FT                   VFGGDFEKGPVGVHTLISSVQELRDNYGMPNTKNYNDYYQVQNFLAYSGAIYVSRAADL
FT                   NGTPTKLDGLQFEENAYKTNVNATKVEGVKVIEADSVDVKFEKTDKFQVGQVLKFNDSN
FT                   KEYKIKYVRNEVKQIPNPDYQPLTQLVVDPSQASAYVDEVVSYVVTTNAESYTVETDRP
FT                   DVVLVNKSNKSLTALKVGTAIVTFRATKEGSRPNTFEFVLNVQEKEQTKLVVTPETVNI
FT                   LEGQTAMLNIDTDAETYSIVSKNLAIATIAEDKKTINGLRIGSCLAEVSAQANNKTETT
FT                   KIINVNVITGVETDLTVSPEGPVTLHKNEEQIFEITSSGASILETASEADKEFVTVDKT
FT                   AKKVTAIKEGNAVVRVRAKALGADEVIKRIQIIILPEKISATVEPTEISINTDAGDQTL
FT                   TVTTEATNISARVIDTSVANVSTQEKIITVTPLAAGNTEIEITVSSEGYSNNVITVPLT
FT                   VTAVNADPSGSTNQKSKAKKG"
FT   misc_feature    48812..49030
FT                   /note="superfamily hit to SSF49373, Invasin/intimin
FT                   cell-adhesion fragments, score 0.00057"
FT                   /inference="protein motif:superfamily:SSF49373"
FT   misc_feature    48845..49069
FT                   /note="HMMSmart hit to SM00635, surface domain /
FT                   intimin,score 0.82"
FT                   /inference="protein motif:SMART:SM00635"
FT   misc_feature    48845..49066
FT                   /note="HMMPfam hit to PF02368, Bacterial Ig-like domain
FT                   (group 2), score 0.034"
FT                   /inference="protein motif:PFAM:PF02368"
FT   misc_feature    49061..49330
FT                   /note="superfamily hit to SSF49373, Invasin/intimin
FT                   cell-adhesion fragments, score 0.011"
FT                   /inference="protein motif:superfamily:SSF49373"
FT   misc_feature    49094..49318
FT                   /note="HMMPfam hit to PF02368, Bacterial Ig-like domain
FT                   (group 2), score 0.074"
FT                   /inference="protein motif:PFAM:PF02368"
FT   misc_feature    49094..49315
FT                   /note="HMMSmart hit to SM00635, surface domain /
FT                   intimin,score 1.6"
FT                   /inference="protein motif:SMART:SM00635"
FT   misc_feature    49343..49579
FT                   /note="HMMPfam hit to PF02368, Bacterial Ig-like domain
FT                   (group 2), score 0.26"
FT                   /inference="protein motif:PFAM:PF02368"
FT   misc_feature    49343..49573
FT                   /note="HMMSmart hit to SM00635, no description, score 1.2"
FT                   /inference="protein motif:SMART:SM00635"
FT   misc_feature    49511..49852
FT                   /note="ProfileScan hit to PS50194, FILAMIN_REPEAT, score
FT                   9.198"
FT                   /inference="protein motif:ProfileScan:PS50194"
FT   CDS             49913..51649
FT                   /transl_table=11
FT                   /locus_tag="CPT_0053"
FT                   /product="Possible phage tail sheath protein"
FT                   /db_xref="InterPro:IPR007067"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV45"
FT                   /protein_id="CBJ93862.1"
FT                   /translation="MADIYDIPEFITQEVTIVTLDKEPGELNADTSVYLLEGESQPDSN
FT                   YILSLRGANTELKRGDIIAFSDVLTDPRFRILAISDSIVNGEAFTNITYEGTEDSEAIV
FT                   EATKGFPVYLVKSTKSACVEVPVEGSETKYDSSEYELYDHTISNFNTFDEDKLSKPFVY
FT                   KDAKLKIFAKTPGTWGNKIDVAIAHPDDFNKGKYITDGIPLDSQFDYIPYGDQFAVIVI
FT                   YANEIQESFIVSLGLTDKNEKNEFTYIETMINGKSSYILVSVNEAVQGKPKTCLGEDLL
FT                   KLENGMDSAPGIDDIIDAYTIFDNKEEIDVDILICNETYPKAATDIAITRGDCIAFMGA
FT                   PKSCSVGYKSTIANQKTLDFRKSLNIDSKYVTLCSNYKYQYCAELGGYRWVNLAADIAG
FT                   LKAQTNYNQANWYAAAGLNRGLIKNCEALSYSPTGAMRDTLYKNGINPVVMFPNTGAVL
FT                   WGQKTLQTKASSFDRVNVVSLFNHLERSLGRMSKYSLFEFNDSFTRNYLVSIIKPFLAQ
FT                   VKAGRGISDYLVICDASNNPASVISANQLVIDVYIKPTYVAEFIHLRFVNVGTNDFSVV
FT                   VS"
FT   misc_feature    50072..51625
FT                   /note="HMMPfam hit to PF04984, Phage tail sheath
FT                   protein,score 3.7e-14"
FT                   /inference="protein motif:PFAM:PF04984"
FT   CDS             complement(51684..53408)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0054c"
FT                   /product="Possible homing endonuclease"
FT                   /db_xref="GOA:D5GV46"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV46"
FT                   /protein_id="CBJ93863.1"
FT                   /translation="MKVTYKNITIDLNKTFKEILIELKQYPLYRKQIIDILLKDPKYNE
FT                   EFHSIYKDYKDLQNNPNFCVICGTKTKTQYCKECLKSSEYDKIRVAKIKSTKLERYGDA
FT                   NYNNIDKHKETIKEKYNVENVSQIPEVNDKIRNTKANTDYTEINNKRKETNLSKYNTEY
FT                   ATQSEVVKNKTIETNLKKYGVICNSQTKEFKEAVSKTWASKSARELAELSEKRKQTNLE
FT                   IYGNECGASHITKWNDLNKAFIEENFISDSLFDKEAFMCYFNISHVTAAKYKKKFNISA
FT                   PDKSCRSQIQSKIVKSIEVDNLVVNSRSIISPYELDIFLPDYNLAIEYDGLFFHSRGLH
FT                   KHKMFNTPDYDKKYHLKKTEMCEALGIQLFHIFESDDLDIWFSMINNKLGLNKKIYARK
FT                   CIIKELNYNEVVDFLNENHLQKSTVSKINLGLFYNNELVEVMTFGKPRFNKNYEYELIR
FT                   LCTLKYCSVIGGASKLFKYFLDNYKPKSIVSYANRRFSKGSIYKTLGFKFVENTEPNYF
FT                   YFKDLKLLARHQFQKHKLKEKLEIFDPSLSESANMMLNSYRIIYDCGNMKFQWIQGS"
FT   misc_feature    complement(52239..52478)
FT                   /note="superfamily hit to SSF52980, Restriction
FT                   endonuclease-like, score 3.2e-08"
FT                   /inference="protein motif:superfamily:SSF52980"
FT   CDS             53542..54573
FT                   /transl_table=11
FT                   /locus_tag="CPT_0055"
FT                   /product="hypothetical phage protein"
FT                   /note="note the phosphohydrolase domain"
FT                   /db_xref="GOA:D5GV47"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV47"
FT                   /protein_id="CBJ93864.1"
FT                   /translation="MLGLKNLKDLNHEYIDALYRCLNGTENTPNKYHLEPNVGVHTEMV
FT                   MAKVNELYKDDPDYKVLILGAALHDIGKIITRTPSKNNPEKIHFLNHENAGVFFALDVL
FT                   HDLDLNLSKQEIIDIIKIVAHHDIYKFDLETLKKRYVYRDLKLLSKFSVADALGRITEV
FT                   PKELPDLNIEAYDRSNVDNKPVLEVLVGLPCSGKSTYVYMNDKVAISRDDILMRYGFKK
FT                   YNQVEYSDIWRNLTDSDQKEIDSLFNDKFLRALQKNQNILIDKTNTSVKSRRRLFATSS
FT                   LVRNYHKKAVVFLTPYTMILNRLEKRNSTGKVINKSVVDTMLKSFAMPTYEEFDSIEFR
FT                   LWF"
FT   misc_feature    53653..54021
FT                   /note="HMMPfam hit to PF01966, HD domain, score 1.8e-07"
FT                   /inference="protein motif:PFAM:PF01966"
FT   misc_feature    54088..54540
FT                   /note="superfamily hit to SSF52540, P-loop containing
FT                   nucleoside triphosphate hydrolases, score 0.00029"
FT                   /inference="protein motif:superfamily:SSF52540"
FT   misc_feature    54112..54135
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             54675..55451
FT                   /transl_table=11
FT                   /locus_tag="CPT_0056"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV48"
FT                   /protein_id="CBJ93865.1"
FT                   /translation="MLVSHEVPLSLLEKSRSFNDYDYALVHLFEIYPAYKQFYIDSLKK
FT                   RRIVYLDNSLFELGTLYDHDKFAKEATELGSINPSNFYYIVPDALGDTNATIQSFKDFS
FT                   KFSIPGKKIGVVQGNTLEELTDCFKFMKENADMIAICFSGDYFYEYEGDTKEAKLTQAR
FT                   IDFIKHLDKLNLLKDSKIHLLGCQVPQEFKNYKNIPEIVSLDTSNPIVHGIYNVRYSRD
FT                   GLRTKIRTKLVDLIDYKGSVNTILLNIMDFRTINGL"
FT   CDS             55493..56035
FT                   /transl_table=11
FT                   /locus_tag="CPT_0057"
FT                   /product="hypothetical phage protein"
FT                   /note="note the nucleoside triphosphate hydrolase domain"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV49"
FT                   /protein_id="CBJ93866.1"
FT                   /translation="MKIGFTGVSGSGKSTIAKLLKEQYNLAIIPGPGRKLKDLNFNINE
FT                   DGDIETQKAALKIHIEDLNKDGIFERTILDAVVYTKYLVEIKKAIPDVFLDLTEIVSIE
FT                   LMKKYDIVFYIRPEFDLVSDGVRSTDLEFRNICSNYYDYYIDTYGINVVNLSGSIDERF
FT                   KAATKIINKRFGNLRNF"
FT   misc_feature    55493..56011
FT                   /note="superfamily hit to SSF52540, P-loop containing
FT                   nucleoside triphosphate hydrolases, score 1.5e-10"
FT                   /inference="protein motif:superfamily:SSF52540"
FT   misc_feature    55511..55534
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             56719..57309
FT                   /transl_table=11
FT                   /locus_tag="CPT_0058"
FT                   /product="Possible phage tail tube protein"
FT                   /db_xref="GOA:D5GV50"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV50"
FT                   /protein_id="CBJ93867.1"
FT                   /translation="MSNKIEEIKTALKSGAKATKYRVKLSFPTEVQHKMELQSLNCLAK
FT                   ATSFPGVTIGQIEVFNQGRKLPIPGDTSYDTQWTVTFYMDNAHQTRKDFLSWMKACDNF
FT                   QANTHSGNPGGLFTEVSVCQLDSLENEVAEYTLRNCWPSGVGEISVGADQLDTLQECDI
FT                   TFSFSDWIISNGSEFNMPQDGKSAATNVVSVDQ"
FT   misc_feature    56731..57228
FT                   /note="HMMPfam hit to PF06841, T4-like virus tail tube
FT                   protein gp19, score 5.5e-10"
FT                   /inference="protein motif:PFAM:PF06841"
FT   CDS             57361..57861
FT                   /transl_table=11
FT                   /locus_tag="CPT_0059"
FT                   /product="hypothetical phage protein"
FT                   /note="note the weak similarities to phage DNA end
FT                   protector proteins"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV51"
FT                   /protein_id="CBJ93868.1"
FT                   /translation="MDSLKLVKNLIKTKSVEKGQILKPGNLVIFKYNPKDTSVKYDRTP
FT                   LCLVLRKSKSYTLGINFHWCPIPMRKMLLNAIFRLNKKNIKENKPLDIDWYRIKPMLKK
FT                   FGFFPIIRLYINSRIYRRAVKIPNENMKQIIETKTETFIGVSAEVLYKKALKDSKVSSK
FT                   SKK"
FT   CDS             57972..59423
FT                   /transl_table=11
FT                   /locus_tag="CPT_0060"
FT                   /product="hypothetical phage protein"
FT                   /note="note the nucleotide binding domain"
FT                   /db_xref="GOA:D5GV52"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV52"
FT                   /protein_id="CBJ93869.1"
FT                   /translation="MKTYVVDTNIILDDVNNLSRLYDSENRIIIPETVIDELDAKKSLF
FT                   DEVGYQARNFARLLSNLDVIELNKFNDYTETTLGDSLLKVTITSKKEYKHADEPINILN
FT                   DRKIIEVAKLYPDCIFITYDSMCKIRAISEGIKTETFGLKKDFNESPEFFKVLDVEELP
FT                   ENLSSILSIDPDYKHENYNYLIQSKDGNKKLARIQNLRINYIDEKHLEKQDVKPINIRQ
FT                   KYFVDAMLDTNVDLQVVSAVSGSGKSLLAIATGIRLVKEKQYSKIVYIRNSIESLDKGE
FT                   DIGYLAGNDEKFAVFNHPLYDSLEYIVRKRLERSNDNKSKKTKIDNLKIQEGIKELIEL
FT                   AGIETMWIGALRGRTISDAFVIVDESQNFSSKSMSVVLTRIDKDCKVVIIGSNTQIDNQ
FT                   YINKYNNALTVLQNAVKNPSIINTWGGELINVVRGPITEFAEQIFNKDSIQEPETVKSF
FT                   VDSGISALEVNANTENLETKLDSAS"
FT   misc_feature    57972..58394
FT                   /note="superfamily hit to SSF88723, PIN domain-like, score
FT                   2.5e-14"
FT                   /inference="protein motif:superfamily:SSF88723"
FT   misc_feature    57975..58358
FT                   /note="HMMSmart hit to SM00670, no description, score
FT                   2.1e-09"
FT                   /inference="protein motif:SMART:SM00670"
FT   misc_feature    58545..59141
FT                   /note="superfamily hit to SSF52540, P-loop containing
FT                   nucleoside triphosphate hydrolases, score 1e-07"
FT                   /inference="protein motif:superfamily:SSF52540"
FT   misc_feature    58611..59306
FT                   /note="HMMPfam hit to PF02562, PhoH-like protein, score
FT                   4.1e-14"
FT                   /inference="protein motif:PFAM:PF02562"
FT   misc_feature    58692..58715
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             59622..60116
FT                   /transl_table=11
FT                   /locus_tag="CPT_0061"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV53"
FT                   /protein_id="CBJ93870.1"
FT                   /translation="MTFTEFINEAIVDDMLSVVKVANSKTGLDFKNDYKTVESCGKKAL
FT                   KILRKLADGTHSNKQYYKLYNDLLNEVWNINQYLLYYKDKMPWYREELQSQKLKTYKEN
FT                   IRDYIDDIRQAMKELKSDYASVSHISNKNLETNIESIIDEYKRLYKIVEKIAKQANKAN
FT                   K"
FT   CDS             60411..60683
FT                   /transl_table=11
FT                   /locus_tag="CPT_0062"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV54"
FT                   /protein_id="CBJ93871.1"
FT                   /translation="MKLVENKLLELIKQNGNIVSESDFIMLEQRLDIDDKDLKFAFKEL
FT                   IKQNKIMSVWVNPSTHLCVNKKDFEHYEIGYSVIYPKYDLESLLA"
FT   CDS             60754..60915
FT                   /transl_table=11
FT                   /locus_tag="CPT_0063"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV55"
FT                   /protein_id="CBJ93872.1"
FT                   /translation="MNKNKKFCDKQYNNCTLNDNCHCTYSECQFGIEYVIVMTTVMAVV
FT                   LVIEYFSR"
FT   misc_feature    60841..60909
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0070 by TMHMM2.0 at aa 30-52"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS             60928..61302
FT                   /transl_table=11
FT                   /locus_tag="CPT_0064"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV56"
FT                   /protein_id="CBJ93873.1"
FT                   /translation="MVKASGVAIVPDGIEFSEETNEFWDEITNKFLEEYPTKYSKQERM
FT                   NFLRACGIRVDLECDNENKERFAMDVKKLKESLEGKDQGKYFCEIFNNNVDILVIDGGM
FT                   KKHEAIVQVLEDVKILYKND"
FT   CDS             61404..61904
FT                   /transl_table=11
FT                   /locus_tag="CPT_0065"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV57"
FT                   /protein_id="CBJ93874.1"
FT                   /translation="MKSYLEDYLESIYENEDKIPKYNVNQYFRSSEEIESLDIDYETIL
FT                   IAKDILRNPDAYTEEEIDLVLNGVFYIANNLNKICEIINTSETNYLLDTEHLIDMLMLG
FT                   ENRLQKLDDVTLKFALNAIVGATIDLVDSLLFGLETLASIKAESKTKPKIESKTKTKTK
FT                   TKN"
FT   CDS             61960..62946
FT                   /transl_table=11
FT                   /locus_tag="CPT_0066"
FT                   /product="hypothetical phage protein"
FT                   /note="note the ATPase domain"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV58"
FT                   /protein_id="CBJ93875.1"
FT                   /translation="MKTEKVILGVDIGYSFVKVCVGTGDGQIIKKFKFPSVIGQTKKLE
FT                   GVQNDNIVHYNERYYMVGEDAKHLPSSNIIDLDTYKNLEYFGPLLLNHAVKIAKLSKVD
FT                   LIVSGLSIAEIKQSGYFQNVLSHFVVDGTEYNYNVMLLPQGAGAKLSYEKFGNDFPNLQ
FT                   KEYLGDSTYCIVDIGFNTLDLVLVNKGVTSPELFEGISQHGLMKIASQVAKLVNEKHNR
FT                   SISLPEAREILDTGVYKLRGQKYDYAKEIEGIKKEYLREILALVNERYSNILDKLDFLV
FT                   VLGGGAHIFKSSSDGYIRCVIKDTEYYNAIGEFIFGTNNIDSIETND"
FT   misc_feature    61960..62022
FT                   /note="superfamily hit to SSF53067, Actin-like ATPase
FT                   domain, score 0.00053"
FT                   /inference="protein motif:superfamily:SSF53067"
FT   misc_feature    62023..62475
FT                   /note="superfamily hit to SSF53067, Actin-like ATPase
FT                   domain, score 0.0034"
FT                   /inference="protein motif:superfamily:SSF53067"
FT   misc_feature    62476..62826
FT                   /note="superfamily hit to SSF53067, Actin-like ATPase
FT                   domain, score 1.6e-06"
FT                   /inference="protein motif:superfamily:SSF53067"
FT   CDS             63031..63219
FT                   /transl_table=11
FT                   /locus_tag="CPT_0067"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV59"
FT                   /protein_id="CBJ93876.1"
FT                   /translation="MNNLDFEEFKLKYNFIDQADEVFKSYVYEVTSNIDNKKYIGFRTS
FT                   KQTDLIFGFLELRFFKL"
FT   CDS             63331..64290
FT                   /transl_table=11
FT                   /locus_tag="CPT_0068"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV60"
FT                   /protein_id="CBJ93877.1"
FT                   /translation="MVINDDYFNRANSECECGYADVTGTVSVVVKNTGERKRVNLSEYY
FT                   NNLDKYITYTSGYVTVRFKSKKNFFNVTKEEFYKNRELYFTTNEGIYFIKDGDGFRKIK
FT                   DYEYDSTEHILLSTSTTCVLCRRRNSDDLWIKLPKDLYNKIDFETPREVVNRQENKNKL
FT                   GVETLDGKFVYIKLEEWDAEKHKPLKLNNVKRLDENKRIVEKQNIIKRKRVNVCNRKLE
FT                   IYESIFNDSLENYHEIINESLIKCMLDGKILKLPSSIYKKFKEQKRNIEYLGAPKGVVP
FT                   VFDTLTNKNTRIHKDIFYANRDRYIALSSKKMRNLNRN"
FT   CDS             64331..64936
FT                   /transl_table=11
FT                   /locus_tag="CPT_0069"
FT                   /product="hypothetical phage protein"
FT                   /note="note the tetrahyrobiopterin synthase domain"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV61"
FT                   /protein_id="CBJ93878.1"
FT                   /translation="MKTFKWTIDKQFDFCMGHRVWTQTLDPKYSIDSICACRHHHSHSG
FT                   VIKLFLGSDELINNMVLDFKFLNCYKKLVDEVIDHKFVWDFNDPGHIHELPELYSESLD
FT                   GLDPQYFDTQEYGYKTIKQSVIDEIKSKYSQTKHKNAIQEKLEGFVFVDFCPTSENLCK
FT                   WWLEIAEKMLKDLDVNVVAVEYWETPKSHCRFLNPKFS"
FT   misc_feature    64334..64924
FT                   /note="superfamily hit to SSF55620, Tetrahydrobiopterin
FT                   biosynthesis enzymes-like, score 1.5e-20"
FT                   /inference="protein motif:superfamily:SSF55620"
FT   CDS             65165..65761
FT                   /transl_table=11
FT                   /locus_tag="CPT_0070"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV62"
FT                   /protein_id="CBJ93879.1"
FT                   /translation="MISAIELSNITVNPSIQIIRFFKDFEETSPGKFELSDDFDLSTEL
FT                   FFIDTKESIDNIIKLIILDPELTQSVKFGSIKYDFIINNKNLYRKIVINSGSIIDKFST
FT                   IPFEYGYEEPSKDTLKEFNEFIELTTRNYLFNTKNPKGIIITNTKDLKFDELNDFLRNS
FT                   GSQTFFNTDTRDFDILRRESTMVTPDNIFFNRGVN"
FT   CDS             65899..66264
FT                   /transl_table=11
FT                   /locus_tag="CPT_0071"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV63"
FT                   /protein_id="CBJ93880.1"
FT                   /translation="MAQILSQEEIDALLDDAEVPTFKYISDILDVKNRNISEEISVLRS
FT                   QASKIRSLNILLKTDLFTTSDYVGIVRDLLEILESKVEKSEMISEISYNGELSKKDILK
FT                   EIKSLKSSLDIAYIKMT"
FT   CDS             66304..66882
FT                   /transl_table=11
FT                   /locus_tag="CPT_0072"
FT                   /product="hypothetical phage protein"
FT                   /note="note the thiamin diphosphate binding domain"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV64"
FT                   /protein_id="CBJ93881.1"
FT                   /translation="MYEAAINNFLTLNPGIRKETHLESAKSIYPWFKDLWNLVKDFDYK
FT                   LIGKPYGCTPMLEAMGITNYDRPGIEHDFIDCIDYADYTLGNALGIGIGMKLAKPEAKI
FT                   FVLISDAQLYMGNVLEALILFKEFDFKDFLICIDYNNKGSKEYNSFEFNNLNLFKITEC
FT                   KLDLEPNDINNKIIVFKHYNHKILKYILN"
FT   misc_feature    66553..66723
FT                   /note="superfamily hit to SSF52518, Thiamin
FT                   diphosphate-binding fold (THDP-binding), score 1.5e-05"
FT                   /inference="protein motif:superfamily:SSF52518"
FT   CDS             66941..67825
FT                   /transl_table=11
FT                   /locus_tag="CPT_0073"
FT                   /product="Possible base plate lysozyme"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV65"
FT                   /protein_id="CBJ93882.1"
FT                   /translation="MNKSEFRIYRGIVVNNDDPKKGGRVQVRIFELHGMSENATPGQYP
FT                   VTSGEKDTKYNQIQESDLPWAEVMQSIDYIGYYPAPSDGSDEYANNIDGKGSKSGYKTI
FT                   TRSGKYPGFGYNVILTPGTWVFCVLDNNNPNLPIVIGCIAADNEIHKNTKPKNTRVYDS
FT                   ITGHYEEWSDEDGNIIFHHRTGTTITMNKGGEMTINTVKNKKEYTQENNLLHVDGEQNE
FT                   YVKKDVNEKYDANHNLNVKSNEKLEVGSDRTRKVGGNENVTISGNQNINVSGSETISAG
FT                   PSITMTAGVIKLN"
FT   misc_feature    67337..67810
FT                   /note="superfamily hit to SSF69349, Phage fibre
FT                   proteins,score 2.7e-16"
FT                   /inference="protein motif:superfamily:SSF69349"
FT   misc_feature    67712..67783
FT                   /note="HMMPfam hit to PF06715, Gp5 C-terminal repeat (3
FT                   copies), score 0.00048"
FT                   /inference="protein motif:PFAM:PF06715"
FT   CDS             67864..68295
FT                   /transl_table=11
FT                   /locus_tag="CPT_0074"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV66"
FT                   /protein_id="CBJ93883.1"
FT                   /translation="MKIFKNIKFLFYVMLVIAIICDAVSLITAGKVTVEPATYALILVA
FT                   ICIEEVIYTRNKIIEEIKGIGVHIKLNDYLISASNAKTRYLNTKPETEAGVTKTKTKAK
FT                   DVKTESKAKDVKTESKVSKAKAKSKTDKEILKDMLNGAK"
FT   misc_feature    67864..67965
FT                   /note="Signal peptide predicted for CPT_0074 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.980) with cleavage site
FT                   probability 0.352 between residues 34 and 35"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    join(67882..67950,67963..68022)
FT                   /note="2 probable transmembrane helices predicted for
FT                   CPT_0081 by TMHMM2.0 at aa 7-29 and 34-53"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS             68295..68588
FT                   /transl_table=11
FT                   /locus_tag="CPT_0075"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV67"
FT                   /protein_id="CBJ93884.1"
FT                   /translation="MPPLTRVGVDFSTGHSSFPPNVVSSGSTNVLTNSISTVRQGDPII
FT                   PHGSPSPSPPHGGSIATGSGTVMVNSKPACRIGDAISCGQAVAQGSGNVICG"
FT   misc_feature    68361..68471
FT                   /note="HMMPfam hit to PF05488, PAAR motif, score 0.016"
FT                   /inference="protein motif:PFAM:PF05488"
FT   misc_feature    68472..68561
FT                   /note="HMMPfam hit to PF05488, PAAR motif, score 5.1e-06"
FT                   /inference="protein motif:PFAM:PF05488"
FT   CDS             68613..68864
FT                   /transl_table=11
FT                   /locus_tag="CPT_0076"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV68"
FT                   /protein_id="CBJ93885.1"
FT                   /translation="MYFISFSESISKDVELMLFDNNFRRIANNFYINASTKSMSDTYNF
FT                   LSENYFENIKIYYGRLGDLSVCEDGNLKFLEVDNITKF"
FT   CDS             68914..69738
FT                   /transl_table=11
FT                   /locus_tag="CPT_0077"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV69"
FT                   /protein_id="CBJ93886.1"
FT                   /translation="MNTNAILIGPCKSRIPIDGSLSNAFEYFYFAWLHNKNIILIIDTT
FT                   FESLTIVKKYLEIKYNINKDCFKNIIIFKKSFVNVNNLILFEMYCIDHFDRYKPFLKCK
FT                   NLYALSGSKNHTLECNYFVEYEHLKPVGKSVNYRSKIFFEILNKPRFQKNQKFINTRAK
FT                   YIKKESEITRNDLNIMSNIFEQFNEMLYIQDPVFFDVKPRLFQECQYFGIPYEFIEHKD
FT                   CFDGANLRAFDYDLESRAMGLEDPIISLLVDSNNTDNSSSASNSSNVNNTRS"
FT   CDS             69757..70080
FT                   /transl_table=11
FT                   /locus_tag="CPT_0078"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV70"
FT                   /protein_id="CBJ93887.1"
FT                   /translation="MKLIDCFKDNNDSAYIFKGFIYYYIFKYRIQMLQGKSYIIITCYR
FT                   GKDNEYVAIKPKKFKKIINKLMEEKQADIFVMEGTIKLNSVNSKNFRFTLDSGMYLYIR
FT                   NKS"
FT   CDS             complement(70243..70569)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0079c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV71"
FT                   /protein_id="CBJ93888.1"
FT                   /translation="MSDSKHLLNNFGLLCVKINILKSIQHYINNFNLFIYYTAKSEPKN
FT                   NTIIVKTTHNNIAIVIEPMTLTKYKNINVYKTTTNIAIDKTNNPVKNLSINFSKENSLK
FT                   ILQI"
FT   CDS             70690..71676
FT                   /transl_table=11
FT                   /locus_tag="CPT_0080"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /db_xref="GOA:D5GV72"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV72"
FT                   /protein_id="CBJ93889.1"
FT                   /translation="MGLSNRCNLRCVLCPYVHKKIYEQSPHYVNVSKLIDFLDKLKNIE
FT                   VIIIEGNYCEPTLHPELPKLLEYIKTRPIDIRLSTNASTHNTEYWYKMGSLLKSNDIVR
FT                   FAIDGSTQELHSKYRVNSKLDKVLENHRSLKSNPDFRGITVLQNIQFTYNQNDKENIYN
FT                   LFKKEKFDYLSYLKCYPTSIQNQSEFNPPTKIKKYMDFYEKLLKTQKDISVICDSFNRH
FT                   EIYVNHMGNINICGSLDEDEVHTGVNIESSNSDIEKFLNTRWCAPKCGVTCQSCCNYYC
FT                   YTLGEKYPDILIDQNGVRLEMNYFTKELKNEEYNAGHRITRSKTNLI"
FT   misc_feature    70690..71184
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 1e-06"
FT                   /inference="protein motif:PFAM:PF04055"
FT   misc_feature    71467..71532
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1195.000, SD 3.26 at aa 260-281, sequence
FT                   LNTRWCAPKCGVTCQSCCNYYC"
FT   CDS             71673..72539
FT                   /transl_table=11
FT                   /locus_tag="CPT_0081"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /product="Radical SAM family phage protein"
FT                   /db_xref="GOA:D5GV73"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV73"
FT                   /protein_id="CBJ93890.1"
FT                   /translation="MTKIYSINEDYKNYDFHIEWVLTDECNFRCSYCFRASKPRKPIPK
FT                   DTIMRVVKQLNDFSLRYKIKVIMTGGEVTTLPYFEEVVKSLNENIALELNTNGMLLSND
FT                   NLFKRFEFISMSLHSEYFEKQKSKLDNILNLKDTIHLNIVYNYKNHKKAIEMASWCKKY
FT                   DLYFTLVKDQNDDYLLDSKILGDSSSYYHKDIILDVDGKKNNLSIDDILNNKIYKLFKG
FT                   SFCYNNFITIEYNKIKYSCGIKFFKKLSDISDDNKVYCNQDCADMYAFIDTTKILLRKD
FT                   IHKFINL"
FT   misc_feature    71730..72227
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 4e-10"
FT                   /inference="protein motif:PFAM:PF04055"
FT   misc_feature    71736..71771
FT                   /note="PS01305 moaA / nifB / pqqE family signature.
FT                   ScanRegExp hit to PS01305, MOAA_NIFB_PQQE, score 8e-5"
FT                   /inference="protein motif:Prosite:PS01305"
FT   CDS             72574..73413
FT                   /transl_table=11
FT                   /locus_tag="CPT_0082"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV74"
FT                   /protein_id="CBJ93891.1"
FT                   /translation="MIVITTIEPDLKDVNTTNKIFTRYFEKEAICCFKCLRDYFDGNIY
FT                   CLNLNKCDISNQTKYYFEKLNINYIHSFDDRIKNHKCGFWNIPLSGIYFESMFQDINSV
FT                   MLRIDLDMMLLRALPDLDNFKTPAVSPHTQGSHKYLESKKGVLYNTGIMISKPSDEFYK
FT                   KQYQLLNQFDKLLNYKEYGKLYELNITKNPSLNSLEYPLLEELCVNYIEGVNKLEIGSI
FT                   EGDEYEAIQDAYFYHCHYEPEKSQNKLKILIQYSKKYNLSKHIKDYINEQIQHSRRN"
FT   CDS             73382..74362
FT                   /transl_table=11
FT                   /locus_tag="CPT_0083"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /db_xref="GOA:D5GV75"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV75"
FT                   /protein_id="CBJ93892.1"
FT                   /translation="MNKYNIVDETKTIELGLLNKCILRCPMCLRQEANDIDIAIPKGYT
FT                   NFEKLIETLNNFKNINRIDMVGSVGEPTLYPHIFELLEYNNSRNIKSILSTNGSTKIDW
FT                   AKLGKTMKKGDIIRFATDGSTQELHSKYRVGSKLADVLEHHKIFKENSEATTINQFIIF
FT                   KYNENDIDEIIKLSKHNKFDYLETTHTGDTIFIHDEIRASNSLCKRYEQLNNYVNNKPF
FT                   ENIKCLMYSLNQLYINHSGHILPCDDMEEFAFNFLDKTIHNSTFEECIEQISRIIKGIK
FT                   MNKTCIRCCGDCNKKIRSDYPVLQMRLDIDKFEVLNHYRLTIDDN"
FT   misc_feature    73424..73912
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 3.3e-11"
FT                   /inference="protein motif:PFAM:PF04055"
FT   CDS             74371..75399
FT                   /transl_table=11
FT                   /locus_tag="CPT_0084"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /db_xref="GOA:D5GV76"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV76"
FT                   /protein_id="CBJ93893.1"
FT                   /translation="MIVTTQPTYIKNFFKNGYTEKTLKPEDIEVVELSLINLCNLKCPM
FT                   CLRQNIDFKMKVNHLDLNNLKRFLNDLPNLKRVVLMGAVCEPTLYPHIFELLEYMNTRN
FT                   IKVRLSTNGSTKIDWAKLGKTMKKGDIIRFPVDGSTQELHSKYRVGSKLADVLEHHKIF
FT                   KENSEATTIMQFIQFDYNRDDEGNIKQMYKNSTFDLLEICPCYEPPNLDPKASVKPRTE
FT                   LLKFFKMKDNLRNDKSEVLGCPEAAMNAIYLNHMGILVPCNEQEDYFLDKPDTININKN
FT                   TTQECFDFMNNILKNIRCNEVCKRACSKMGLKECFLYPIFQLNRENTKFELVDFRECML
FT                   NR"
FT   misc_feature    74467..74943
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 1.4e-12"
FT                   /inference="protein motif:PFAM:PF04055"
FT   CDS             75396..75917
FT                   /transl_table=11
FT                   /locus_tag="CPT_0085"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV77"
FT                   /protein_id="CBJ93894.1"
FT                   /translation="MKFEFYYKFNKNFELISYSNSVYNDSKSKCIEYNLNKERISEYQD
FT                   NYSIDLATNIIDSYYIELDYDRIYNIVKNLDKTKLKNNSIFYEPLKRVPSGCRSSIKLT
FT                   LDVDDSGFQLMVRNTEIFKKLLNIAKESGINKWLFKKYEKNLYDSFILYIYIYDNKITK
FT                   YCLLFYGEIK"
FT   CDS             75914..76975
FT                   /transl_table=11
FT                   /locus_tag="CPT_0086"
FT                   /product="hypothetical phage protein (possible glycine
FT                   amidinotransferase)"
FT                   /EC_number="2.1.4.1"
FT                   /db_xref="GOA:D5GV78"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV78"
FT                   /protein_id="CBJ93895.1"
FT                   /translation="MTQTEFGELKEVIVGRELEISTRSFDTTFKIFYKNNISDYYFADF
FT                   KEYSINSQLVAERNEDLDNLAKILEQNGVKVYRPEKVKDKIQIQTPNFKSIHSSASNVR
FT                   DLVFTYKDLIVETPVQIRSRYFENDSMYDIFKEKMFKGYKWIKAPLPMLKDETMDLKDW
FT                   DAPRDFDNISMKWDLGVDAAQYLKIGDDILCNYSTYNHYMGAKWFENIMKDYAKIWYTE
FT                   AMIDNHLDGNILPLDFGVFLVNDAALHKPVKEYLPEKFHNWKFISTNGDFKYKQKDYSD
FT                   YNTPFVQLCSYRGMDMNVLSISPKKILVNKDAIAVQDILYKNGFDVIPVRLRHCELFGG
FT                   GIHCSTLDLVRQD"
FT   misc_feature    75923..76969
FT                   /note="superfamily hit to SSF55909, Pentein, score 3.9e-47"
FT                   /inference="protein motif:superfamily:SSF55909"
FT   misc_feature    75923..76966
FT                   /note="HMMPfam hit to PF02274, Amidinotransferase, score
FT                   0.0045"
FT                   /inference="protein motif:PFAM:PF02274"
FT   CDS             76972..77721
FT                   /transl_table=11
FT                   /locus_tag="CPT_0087"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /db_xref="GOA:D5GV79"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV79"
FT                   /protein_id="CBJ93896.1"
FT                   /translation="MKIPKRFTIHITSNCLLKCNFCWLQNNNVSRDVMSIDLFKKIVAW
FT                   LEEQGVEEIDLTPMVGDFFTVKNHYEYLDIVEQSKIKEYHLITSLTPSANYNLIKYKKL
FT                   FLYISCYGNNENEFKELTNVDKFNDFVNNLKNLKLYNRGEIIIRNKNFNGIIKSLIKIK
FT                   NLKIVDCEIDNRVNRFGEPIGFESGCRFLNEPIIHTNGLSLCCMDFQKDKLIIGNLFDP
FT                   LETIYNNVECSKTLNICNRSCGWYQKR"
FT   misc_feature    76996..77457
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 0.0071"
FT                   /inference="protein motif:PFAM:PF04055"
FT   CDS             77697..78497
FT                   /transl_table=11
FT                   /locus_tag="CPT_0088"
FT                   /product="hypothetical phage protein"
FT                   /note="note the nucleotide-dipospho-sugar transferase
FT                   domain"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV80"
FT                   /protein_id="CBJ93897.1"
FT                   /translation="MWVVSKALITTIEGNGGINNIKLGWCRDYESEAIKCFNEWRKNAG
FT                   ELKDIDIYCYCFTKNIISEKTKKKLEKLNVKYIEYFINETDSYECGFWNIPLLLKYVKE
FT                   KLNYDWFIKIDLDMYLTRPLPPHLFEYETSCGRYTFTEIFNRHNNFKDIVIKSGIDFWD
FT                   TGLVIYDKNSAFPELFYKYCKKLTDLHYNNKLLDYINSELNINIDKIDFDIIEELACIF
FT                   VSKEMPIKSVYNYALGTYQDPIHKVKKENLKNICFNHYHLGTNE"
FT   misc_feature    77739..78485
FT                   /note="superfamily hit to
FT                   SSF53448,Nucleotide-diphospho-sugar transferases, score
FT                   2.6e-09"
FT                   /inference="protein motif:superfamily:SSF53448"
FT   CDS             78494..79273
FT                   /transl_table=11
FT                   /locus_tag="CPT_0089"
FT                   /product="hypothetical phage protein"
FT                   /note="note the nucleotide-diphospho-sugar transferase
FT                   domain"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV81"
FT                   /protein_id="CBJ93898.1"
FT                   /translation="MKIAFICVVESNNTYTDKKKHKRLYETESLKCAELLKKYTQCDIF
FT                   YICPTNNGVDENTKKIYSNLGVNYIEKNIYNDLNLEPKDGFYNKIYGCTFLESMLKNKY
FT                   DVLIHIDLDMFLVRDFSNYLNDLELVDSCLIYDDIQAQDERKHNISKYIFNTCFIVDAS
FT                   KKLFENWAEIANTIKYSTYKNIVKDLEPHKLEELSFDILSSKYYIKPLKDLMFGETYTN
FT                   LDIIKQRYNIHNFYFHHYHIGSNYNYKKEEDKFWTLL"
FT   misc_feature    78566..79222
FT                   /note="superfamily hit to
FT                   SSF53448,Nucleotide-diphospho-sugar transferases, score
FT                   0.0065"
FT                   /inference="protein motif:superfamily:SSF53448"
FT   CDS             79258..79755
FT                   /transl_table=11
FT                   /locus_tag="CPT_0090"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV82"
FT                   /protein_id="CBJ93899.1"
FT                   /translation="MDSIINYMDETEVKLIKKFFDVDLINTHNSGVKHIYVGESNFYNI
FT                   CDFYSFECKNEETDFFNKIEQIKLLLTNKIIKLYVNRVDHLGYYWYDYITKIDLKFNVV
FT                   ARHLIINYDKTSDLYDWVLCNICIRIFLTDFNKDYPDVDTTLAKKINHNHIVEVLNTLL
FT                   NK"
FT   CDS             79813..80205
FT                   /transl_table=11
FT                   /locus_tag="CPT_0091"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV83"
FT                   /protein_id="CBJ93900.1"
FT                   /translation="MGKTNDSHEDDILAGNKVYRADVDFLCYSLFKIFKIELGVYEGQQ
FT                   NTGFVFIRPAYEYHTPPITSMSYKDLVQVRFALRRVDELDKYYQNFLFDNNCYYTTKNG
FT                   VEHIYGSLLINWCIAALMLEDIANLK"
FT   CDS             80223..80717
FT                   /transl_table=11
FT                   /locus_tag="CPT_0092"
FT                   /product="hypothetical phage protein"
FT                   /note="note the membrane acid phosphatase domain"
FT                   /db_xref="GOA:D5GV84"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV84"
FT                   /protein_id="CBJ93901.1"
FT                   /translation="MNINYGSIKKFFGLDPDEIDVIQEVGDIFQFGTLWIALFFIALYP
FT                   TNMTITPMVWLYVAAGQLLVSASLKKLVSKYFPKLSVRPNGGKDSMPSGHTCAAYAGFG
FT                   CLFFGINEYNTILIIATVILLALAVFTGFSRIAAKKHHFRDVCAGAAIGLISSWIIINI
FT                   F"
FT   misc_feature    join(80322..80390,80568..80621,80658..80711)
FT                   /note="3 probable transmembrane helices predicted for
FT                   CPT_0092 by TMHMM2.0 at aa 34-56, 116-133 and 146-163"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    80370..80705
FT                   /note="HMMSmart hit to SM00014, acid phosphatase
FT                   domain,score 2e-06"
FT                   /inference="protein motif:SMART:SM00014"
FT   misc_feature    80373..80714
FT                   /note="HMMPfam hit to PF01569, acid phosphatase
FT                   superfamily, score 0.00013"
FT                   /inference="protein motif:PFAM:PF01569"
FT   misc_feature    80451..80705
FT                   /note="superfamily hit to SSF48317, Acid
FT                   phosphatase/Vanadium-dependent haloperoxidase, score
FT                   5.8e-17"
FT                   /inference="protein motif:superfamily:SSF48317"
FT   CDS             80820..81383
FT                   /transl_table=11
FT                   /locus_tag="CPT_0093"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV85"
FT                   /protein_id="CBJ93902.1"
FT                   /translation="MLQESLTKKTNYIKLGEKYINMFNQVLDAKKYLQISLFNVDNKQY
FT                   YCILIMKDSKLEPHFGVFYENKFNELVEAFKNKDTKKISDLVNSELFIQKDGYLNSDVN
FT                   FLKVLSYVFSVLVDYLAIKPIGFVKIMGIPRKFNLYQKVVKNIIQKNEIPYHIVVEEQD
FT                   DSYSSKITGQINPAKSMILKYNFA"
FT   CDS             81494..81790
FT                   /transl_table=11
FT                   /locus_tag="CPT_0094"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV86"
FT                   /protein_id="CBJ93903.1"
FT                   /translation="MYVARFNEYFGYDYQLMDVETVDILENIYDSLGYMPRDPEPIDLE
FT                   IVLEEFYNTDKIYVLCEADDEEIEFCSCIDEVEPEIIIDFLKSKGHTFMNSNA"
FT   CDS             81821..82255
FT                   /transl_table=11
FT                   /locus_tag="CPT_0095"
FT                   /product="hypothetical phage membrane"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV87"
FT                   /protein_id="CBJ93904.1"
FT                   /translation="MLLAFFIYLASVFDTLNSVAKIALFILFVTFCFSFVFNVVSHYDG
FT                   DTFFYKVTSKSIKICIISSIIFGAIVILVPKSSTMYLMASAYVGTEASKNPDVVNKLSK
FT                   VNKIIDYKLDEILNELGSKNLDSNISSFKDFKSKYLDSKD"
FT   misc_feature    join(81863..81931,81989..82042)
FT                   /note="2 probable transmembrane helices predicted for
FT                   CPT_0103 by TMHMM2.0 at aa 15-37 and 57-74"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS             82352..82801
FT                   /transl_table=11
FT                   /locus_tag="CPT_0096"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV88"
FT                   /protein_id="CBJ93905.1"
FT                   /translation="MDYLNPGYEAPKKGNIKITLASLVDSFQEFLTKRNYFLYNITTKT
FT                   QINDIKQTKVYNDLHEQLRSITYSHFYDDYTFYAKDTFDVERVKLIFMACYLDLLEEND
FT                   IDLSNNELVTNNDVNIEHFDLAYKWCNFNTELIRTKAYEMGIFKS"
FT   CDS             82816..83052
FT                   /transl_table=11
FT                   /locus_tag="CPT_0097"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV89"
FT                   /protein_id="CBJ93906.1"
FT                   /translation="MDEINYDVLEYIIQEHLNCSLTREKSVLDYLNLEATKRNQKITGE
FT                   TESFVVYKFKPYMLSDDILKPFILYANKNNKGS"
FT   CDS             83052..83717
FT                   /transl_table=11
FT                   /locus_tag="CPT_0098"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV90"
FT                   /protein_id="CBJ93907.1"
FT                   /translation="MIYNIDKYDIKLYNEFLNNLSKHNVDYSEYVCTRDNKFYLSTQLE
FT                   PFILDYIPIQNASKMFLISKTKGVNNQDIYQYRRQKVTASKDNLKLCINDAYQYFIDLN
FT                   QKQKNSIFYFINIPNKERAEALSKQLGRLYYFGFYYNKYRVYLTNNQYTTNYIDPENIL
FT                   VSSSDLFDAEMQLNYNIFRLQDRLKKFSQTPYRENGTTVLPKYIDPFFRTQTNSNIKN"
FT   CDS             83807..84766
FT                   /transl_table=11
FT                   /locus_tag="CPT_0099"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /db_xref="GOA:D5GV91"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV91"
FT                   /protein_id="CBJ93908.1"
FT                   /translation="MSKESRYTKVKKAPKMISDEDFAEFFQAAIDSNLNEDFKRPLIES
FT                   KYKLKSNILYLTDACNFDCDYCYQKNDRDRLIKNTYISEREINEFFKDLIKREPDKPST
FT                   VVIFGGEPFLNPDIVYYIFDLTDKITFHTNKKFNLSLTTNGAYFKNTKNADYFIERTRK
FT                   LLNHFSLEISYDLSGNTRRVYRNGKDSTKDTEFVLSYFKSKDYKLTIRYTVHKLNYMNA
FT                   LKDLITLSLDSNYKKIVVNFYETELEQYINVSEFKETLKRQTCEVFKRTKMPICHLNCL
FT                   ACMGCNFADFDGIYYQYNDKSFEVQENAKIFESFTEHS"
FT   misc_feature    83966..84496
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 8.1e-14"
FT                   /inference="protein motif:PFAM:PF04055"
FT   misc_feature    83972..84007
FT                   /note="ScanRegExp hit to PS01305, MOAA_NIFB_PQQE, score
FT                   8e-5"
FT   CDS             84809..85975
FT                   /transl_table=11
FT                   /locus_tag="CPT_0100"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV92"
FT                   /protein_id="CBJ93909.1"
FT                   /translation="MKLSELMFILEGGNTTTINKKTGEAKSAEKIDFNRLSIESFRSEF
FT                   IDLFISLNRLFFNKYKEKLWANDSLIKKGLVFNGSTSYIMNPKMDPKEIFKYKQSSGDI
FT                   DIVIPAEHQEKLWDLLDSLEGKTIGNFEYHGCFSQNREKLGDQLLTIFVYKPENIACQI
FT                   DFENADFKDGKPTEFARFSHGSSFEDAKESIKAFAHKLLLRALVGAISANPNIVVATKS
FT                   SKPDNIKLKADKSTPRMAQFSVTRGLRFGLVPMLDKGEPVYYEGKQVYQEQDTSDSEFI
FT                   TDLKEIFKYMFKSSVGLKDLHSFIGVVKLMKKHCDEKTIKLTQERFFDIIFGMPAQFIE
FT                   PNDLKLDRQVKLTAYNYFLKELHLRHPGLEADIDRYYIVKGSKSKAKA"
FT   CDS             86031..88502
FT                   /transl_table=11
FT                   /locus_tag="CPT_0101"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV93"
FT                   /protein_id="CBJ93910.1"
FT                   /translation="MAEIKTGILLRRNLKKHFINDAKPTQGEIVLATDTNEIGMLVNDE
FT                   IQWTPIQGVVNTVAGKQGDVILNKKDVGLENVDNTADIDKPISNSTKLEFQRHYTAENP
FT                   HNITKKTLGLENVDNTADIDKPVSNLTQIELNKKISWDDARKQAGGKDPVFTDTTYTIK
FT                   DGELSEFNFNSYYKNFIDTFNTNSRVLPSTQALIANGRTITLRRADGSSESIETQDTLY
FT                   DDSELRALIEQAKIDLHINIQDNLESDSTQDALSANQGKVLKGLIDEIKKVINITDDDF
FT                   RNLQDIINYIEENREKFDDLTITNIKGLQAALDSKLNRDDSTYIAPNSALLESHPASDF
FT                   VLNTNYNAKLIEIQDSLNSINSQIKLFETQAGVDSKINQAIRDLNFTETIQSINEQITR
FT                   LQGSLDDIDLDAITENLQKVQQDLTSKIEQLETNTSKKLEEFEAIVNNFDMSEIQKTIE
FT                   DFKNQINQNIDSIQGVVDSVSESLANIENNIQTSLENKVSKDELATEVQTINGNIADLS
FT                   NIANEAKWQDNFYCKVDRRRQALWSIISLSKDFFKGSYKKPNTYNYWEAKYKNLKYIND
FT                   NFDSLETISNAPTYDVVTNQVIRLTFNDISQASFLIGSPKNKIQIAKIIAVNANTKKAV
FT                   FIYGYPSFLTDDLSKIMVTIEKDSSFGNYLSRANKTDPETFQKIVTTQEFDLPDDTDDY
FT                   SYFEVSYEISGNTITLTMAENVFLEFYGNMTAVETTVTGAGAAQVWSSTLRSTDFEGKK
FT                   LFSNGVLIGKDLTGAILTIYDDKSTYINDLDEARTNYNDFQIIREEYEDIMYTRDFLPG
FT                   TIEPGDGDLVW"
FT   CDS             88641..89069
FT                   /transl_table=11
FT                   /locus_tag="CPT_0102"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV94"
FT                   /protein_id="CBJ93911.1"
FT                   /translation="MLELSNFLRSSFSELPGMPFDNKSYQDLLKNVSKTIETYPSSMTS
FT                   YLTTETSSGIDVVVLAPGVQEDGSKTIELDFKPDEIVIRYKVHNDAKSFFITGYNTIRV
FT                   SLDSVNNFKLKQNSFKARNGIITFSLESIKETKNTYTF"
FT   CDS             89148..90662
FT                   /transl_table=11
FT                   /locus_tag="CPT_0103"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="GOA:D5GV95"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV95"
FT                   /protein_id="CBJ93912.1"
FT                   /translation="MAFTHKNQKTFYTDYAIKHGMIPTEDTINLFQVRLKKETTDIYNK
FT                   FQMVNGKSPLEWNQSENYEVNEIVRYNEVDYKCVQECINKVPSEEPSFWAVTKYQEYTK
FT                   YPASNYLAKDNQDPYDPSSIQDYEASNTYHPTTVKHVEDRLKYWFDNETVTNADRLDGE
FT                   HKDYFCSKQEFDDFARIALTEKSVVDSLESDNRRLPLSAYQGKVLKGLVDHINTILTSN
FT                   DINLDELQEIVNWIKTNRDMIEALGIDSIKGLRDYLNRIDSDLGKRVTYDYWNAEFLNK
FT                   IKAVDGHLSGVDADTLDGQHADYFLPASRFTPEEIALLLQKVPGSLGKIDADKLDGLDS
FT                   KDFLRRSTSDTPTQDNKFSLGSTALRWSNIYAVNFQGTALRAKYADLAEYYEVPEAIKS
FT                   NIKAGHILGIDACGINLFNPGMKLFGVVSKNPGIILNNECDGVPIALKGRTPVYCKNKP
FT                   SIGDYIYADSNGFGIASETELDLPLVGICIGSIINYKDFWICEIKI"
FT   CDS             complement(90794..92545)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0104c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV96"
FT                   /protein_id="CBJ93913.1"
FT                   /translation="MKDLALGAYTQKDLTEKVNTIGDVTTLKTEAKTTAVGAINELKDN
FT                   YERIKNSIDTDTTNFLIDQKLDPVKEDIKALHTQVDNYTINYKQPNDPTTSINPTIDSA
FT                   TFLNTTTGVIWTCIDKTKNKNRWINGNGEVAGALPSDPNLGDIGFGVGIAPEEITNKYN
FT                   MYPMLGTFTPGHMNYGNYTDIRGNVMVWIPKLYIKTSNVDAAPYYGLKVEVSATQESGF
FT                   WCHRAFINNNEEIPGFFIDKYLASNQGGILGSRRNTVPLTCDVKFNSVALIPGVSAKVA
FT                   LGNKITEDSDLNLDDLKSIKNRNSSFLEAVKNRGPEFQVLTVFAYNYLILLSKCIYQNA
FT                   YNSNNFNNIEFAKSRTDRFAFIQGMNTMQSTQRDIQAAHNLDYKTAGYTDGTNALYRTG
FT                   SVSDSKMGKISHNGHACGVVDLVGGLFNLAIGAMYGYILDRSYFGVIKESINITDLDLE
FT                   SLVDTNNYDETTLPAEIITYINSDSDSPLGYFKDAGAKYNNASTRTTSEYRIDSCGIPK
FT                   WSVLQDATVDTTRQTFQWRGNPTYKDTLTFPIVGSSFKDSFYSSVQFQKDTQGVEFGTR
FT                   CILLPEI"
FT   CDS             92629..93237
FT                   /transl_table=11
FT                   /locus_tag="CPT_0105"
FT                   /product="hypothetical phage protein"
FT                   /note="note the DNA methyltransferase domain"
FT                   /db_xref="GOA:D5GV97"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV97"
FT                   /protein_id="CBJ93914.1"
FT                   /translation="MKGKNFSLNSNKRNKNDYYQTPYSMTKQLLEIENFEGSILEPSCG
FT                   AGAIVKVLKDYNKSVDYCDLNNDFSLTGIFKDFKDFINGDFEKYDNIITNPPFSLAKEF
FT                   ILKAKQIANNKIAMLLPLNYLHGVSRYNEIYKDTDFPLKTVYVFCRYGLLEDTIREDGT
FT                   YKAGMMVYAWYIWDKSYKGEPIIRWLNNNDYIVKSNKGS"
FT   misc_feature    92677..92727
FT                   /note="FPrintScan hit to PR00507, N12N6MTFRASE, score
FT                   1.6e-08"
FT                   /inference="protein motif:FPrintScan:PR00507"
FT   misc_feature    92683..93009
FT                   /note="superfamily hit to
FT                   SSF53335,S-adenosyl-L-methionine-dependent
FT                   methyltransferases,score 5.8e-11"
FT                   /inference="protein motif:superfamily:SSF53335"
FT   misc_feature    92743..92787
FT                   /note="FPrintScan hit to PR00507, N12N6MTFRASE, score
FT                   1.6e-08"
FT                   /inference="protein motif:FPrintScan:PR00507"
FT   misc_feature    92893..92931
FT                   /note="FPrintScan hit to PR00507, N12N6MTFRASE, score
FT                   1.6e-08"
FT                   /inference="protein motif:FPrintScan:PR00507"
FT   misc_feature    92902..92922
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature.ScanRegExp hit to PS00092, N6_MTASE, score NA"
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS             93237..93974
FT                   /transl_table=11
FT                   /locus_tag="CPT_0106"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV98"
FT                   /protein_id="CBJ93915.1"
FT                   /translation="MAKFVTPAGNLLNSLNSKNLRNVQNYRQTIVWSFETNEEFISARI
FT                   VDEGVEHVPKGLKKTWTSTSLTLSGLPDDVDLYHPKMITYLWSGFKLDGTEFKDTNYEE
FT                   KATIEDIKNQDMHYTGKSWGTKGIAGYYRDNNILTFPFTVEVTYWEYSNSGSNSSSGSK
FT                   TNSVSKNTRESGSDGLKVQRTITQDYYITVVPNMDPALFCKKYGDAHGFKGPNGEDFNY
FT                   DQYKAYMVSLGLDFLTIDRSQAT"
FT   CDS             94141..94302
FT                   /transl_table=11
FT                   /locus_tag="CPT_0107"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GV99"
FT                   /protein_id="CBJ93916.1"
FT                   /translation="MLQDKVLKNYRDSLNQRLSILIKDPENNKDVISDVKVEIKKIDNI
FT                   LNRSYNRG"
FT   CDS             94342..96429
FT                   /transl_table=11
FT                   /locus_tag="CPT_0108"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA0"
FT                   /protein_id="CBJ93917.1"
FT                   /translation="MVDFKNFLTLNKVFIDKSNKKPTQGKVNSVLYKLLLKGYKPSQIL
FT                   LEAINNASDSDLKTFEESIVLAAGTTFYKKYTHKLRDISDYEDQFYHYVLRYIFNLDTH
FT                   DYTLSINFSDLIPNKELVELDLIQESEIEKITKNILESQFNPTDNEKDIIIKYGFKYMP
FT                   NKIPNKLALETLISNLNPSEALEFSKKYKPENVNAVRTIVKSLIKIEYNIDPDRLDRIY
FT                   TKEFNLPRYIKTFVMNSINELKLDHETILNEMLIYKKFWQNMQYLIVTTQKRYKNLVVA
FT                   NYVFNRILKRDYKQTSTYKIRALLNNPINFNNAFIEVYNYNINLAYKNIFNLAAKTNNN
FT                   DFSILLDYKPKTLKQLLDLVLNYKRTSKVRMSNIKGNILYFNETKKPEGNLWEVLSKLF
FT                   SILLQSKKDLIDFGPAKRIAISDDLETIVPPVKSKESLKTDVFFPKGSSIKIASKFQVF
FT                   VAWKKKDNSQGSLDLDLSCLFRSVSGSLKDVLDYTKLETSIDGKIQIHSGDWASSRSFD
FT                   PKNPLITAEFCTLDLDPKSDLEVYVNVHSYNKVPLSEYDVIVGVLPGDTKNNDGVINLQ
FT                   DAIFQFNVDIDFKDICAFRIQNGLLQVIGETFNLKGSHSNGHSFDQVAPIYDYYKVYNQ
FT                   MSLKRLFKLIIKHKGLELVDINDNPDLVVSSKLSSKSSPEYKVYNVSEKVNELKELMIK
FT                   D"
FT   CDS             complement(96426..97208)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0109c"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA1"
FT                   /protein_id="CBJ93918.1"
FT                   /translation="MYLNKETNEFTYTAKEIKSDYFTNKLHKNIKGTAGYVIFFGIFTA
FT                   VCLIFQCLDYIIDYYMPGSRIFNKNFQVPMETLTTLYATLCCVYVGVDRTTSVIATFKG
FT                   TKDSANYGNPERNRHIIIQNFFICALALILNRFFDANLGLEPLLVSFGGSIILYVSGQK
FT                   IVYQASKFAPEKDINKNGIDDRIENNKDLINVLNEAVKNDRHFKVYYIDPRGAESLEFD
FT                   SNPGANTPSMSNVPTESNPIETMIVPINPESNLIEPKS"
FT   misc_feature    complement(join(96726..96785,96795..96851,96912..96980,
FT                   97038..97106))
FT                   /note="4 probable transmembrane helices predicted for
FT                   CPT_0117 by TMHMM2.0 at aa 35-57, 77-99, 120-138 and
FT                   142-161"
FT                   /inference="protein motif:TMHMM 2.0"
FT   repeat_region   complement(97290..97325)
FT                   /note="Repetitive region 3.5c"
FT   repeat_region   complement(97326..97410)
FT                   /note="Repetitive region 3.4c"
FT   repeat_region   complement(97411..97495)
FT                   /note="Repetitive region 3.3c"
FT   repeat_region   complement(97496..97580)
FT                   /note="Repetitive region 3.2c"
FT   repeat_region   complement(97581..97665)
FT                   /note="Repetitive region 3.1c"
FT   repeat_region   complement(97669..97706)
FT                   /note="Repetitive region 4.12c"
FT   repeat_region   complement(97707..97791)
FT                   /note="Repetitive region 4.11c"
FT   repeat_region   complement(97792..97876)
FT                   /note="Repetitive region 4.10c"
FT   repeat_region   complement(97877..97961)
FT                   /note="Repetitive region 4.9c"
FT   repeat_region   complement(97962..98046)
FT                   /note="Repetitive region 4.8c"
FT   repeat_region   complement(98047..98131)
FT                   /note="Repetitive region 4.7c"
FT   repeat_region   complement(98132..98216)
FT                   /note="Repetitive region 4.6c"
FT   repeat_region   complement(98217..98301)
FT                   /note="Repetitive region 4.5c"
FT   repeat_region   complement(98302..98386)
FT                   /note="Repetitive region 4.4c"
FT   repeat_region   complement(98387..98471)
FT                   /note="Repetitive region 4.3c"
FT   repeat_region   complement(98472..98556)
FT                   /note="Repetitive region 4.2c"
FT   repeat_region   complement(98557..98641)
FT                   /note="Repetitive region 4.1c"
FT   CDS             98700..99062
FT                   /transl_table=11
FT                   /locus_tag="CPT_0110"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA2"
FT                   /protein_id="CBJ93919.1"
FT                   /translation="MQKYVAIAFIIVVMLGYIGWLKYDNAQLQTTISSLEAKNKGLETS
FT                   LNIQVNLNKIQDEKNRELVNNIKELENKPIRTETKYIAVKDCKVQISKVDTNITSAKGI
FT                   PLFLGNIGKIQLSNQK"
FT   misc_feature    98709..98762
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0118 by TMHMM2.0 at aa 4-21"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS             99072..99350
FT                   /transl_table=11
FT                   /locus_tag="CPT_0111"
FT                   /product="hypothetical phage lipoprotein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA3"
FT                   /protein_id="CBJ93920.1"
FT                   /translation="MKIKKFLLALIPFIFVGCTAVRTEFIYPKIPDVKEPPMTQDYNLT
FT                   VIKINNVEYYSLSPEDAKILSENWIKFKSWAETNYELLKIIKNKDLK"
FT   misc_feature    99072..99137
FT                   /note="Signal peptide predicted for CPT_0119 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.987) with cleavage site
FT                   probability 0.495 between residues 22 and 23"
FT                   /inference="protein motif:SignalP 2.0"
FT   misc_feature    99090..99149
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0119 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    99093..99125
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             99347..100090
FT                   /transl_table=11
FT                   /locus_tag="CPT_0112"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA4"
FT                   /protein_id="CBJ93921.1"
FT                   /translation="MSFKDTLLNLVCEGASREDLDSKDSKIKETDSGDIDTTPTTKADI
FT                   VKRKDSKIDEDTDGEIDSGDDSELEPLSKEEFDDIINSLDPDTVALIISILNDNGYIVA
FT                   TKEEILSAEDFEDIGYLVLEVLEEIAEYEATNYEQYGANPVDESFDDAEVLREAAMILE
FT                   ANDLSDLSEQLVDIAHTKQLRRDRKRSAWKRSAVLRARFRKTGEGRRERKKALKYLKKY
FT                   RRQHKARLKRYSQKYTQVWKGNTKN"
FT   CDS             100090..100368
FT                   /transl_table=11
FT                   /locus_tag="CPT_0113"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA5"
FT                   /protein_id="CBJ93922.1"
FT                   /translation="MIFCEDLEPIYEVVKKLPLYKQRAKEEVFLGILKSKSKKWVGWKY
FT                   LKELKKDKSFTNSTIFIELYELALNYYWIKSQNDSIKYDNLIKNYKF"
FT   repeat_region   100541..100562
FT                   /note="Repetitive region 5.1"
FT   repeat_region   100563..100647
FT                   /note="Repetitive region 5.2"
FT   repeat_region   100648..100732
FT                   /note="Repetitive region 5.3"
FT   repeat_region   100733..100805
FT                   /note="Repetitive region 5.4"
FT   repeat_region   100806..100890
FT                   /note="Repetitive region 5.5"
FT   repeat_region   100891..100903
FT                   /note="Repetitive region 5.6"
FT   CDS             100966..101625
FT                   /transl_table=11
FT                   /locus_tag="CPT_0114"
FT                   /product="hypothetical phage protein"
FT                   /note="note the queuosine biosynthesis domain"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA6"
FT                   /protein_id="CBJ93923.1"
FT                   /translation="MKDTVLSLSGGLDSSALLFEYKDRIKIAVSFKYGSNHQDKELAAA
FT                   KKVVEEVNKLGAEIEHRIIDLTTAFSTFKSALLSGSKAVPEAGSTEVSNVIVPFRNGIF
FT                   LSILAGIAESEGCRFIAIANHSGDSNVFPDCRYDFIDAMFKAIGLGTEDKVQVFAPYTN
FT                   ITKTDLTIRGMTNGLNPDWAYSCYKGGNKPCNVCPTCVDRNKAVQEATTVLKHFSS"
FT   misc_feature    100966..101568
FT                   /note="superfamily hit to SSF52402, Adenine nucleotide
FT                   alpha hydrolases-like, score 1.3e-16"
FT                   /inference="protein motif:superfamily:SSF52402"
FT   misc_feature    100972..101496
FT                   /note="HMMPfam hit to PF06508, ExsB, score 7.6e-33"
FT                   /inference="protein motif:PFAM:PF06508"
FT   CDS             101756..104404
FT                   /transl_table=11
FT                   /locus_tag="CPT_0115"
FT                   /product="Possible phage DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="GOA:D5GVA7"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA7"
FT                   /protein_id="CBJ93924.1"
FT                   /translation="MKLFEACFNLGNFETYERFYNTETNKSEIQKVFLKNQVFIEDPKG
FT                   EYTFLLDPNIKLTKVQANQAKDLETYGKTNIAAEHIRQNYWKLNDSKYNKNISIFYLDI
FT                   ETTAHSPIDTEACRERIVSIQVYHNLTNTNYIFTNEFFDTEAHTKDSKYIFDDRTYDFK
FT                   LKYYQVEGEHNLLIALFKLIEALKPLLVLAHNGEGFDFAYLWRRTEKLGLTEGFSPFGK
FT                   SEFQINELDNGTKKYSIKAPGVFYMDTIDIYKKFRLKPRESYSLDYIAEVELGERKVNH
FT                   DCFKTFDGFRTGEGFIRPEVEPSEESILEYKLYNAKDAEEIKRISKEYFIHYSIIDTYL
FT                   LYRIDNAIKLSDIMISIASIMGIQLPQTLGTTTPWSTFIRNYAMQDKIVLPNPSEFSGD
FT                   VEFKGGFVAEPLVGRYDWVFSVDVTSMYPSQIMAFNLSSETFIPFYKLPNDLQEAINEL
FT                   DLNEDEQYHINNYYKNPEAYKKYTDLLIKYNYCGSLTGSVYDKSKKGILPILTELVFNL
FT                   RKAAKKEMLKYEQMAEDAKEPELIQKYQALATELDVNQLTFKILINSLYGACGNKHFIL
FT                   YNKEIAKAITGNSRFYINLMSKNINNFLCDLCGSGNYIKYGDTDSNYVQVPPKICEKLP
FT                   KDPQLATDIIDKFIETKIQPVINTSSQELGSIFNALDASRISAKREAIASSAVFVAKKR
FT                   YFMKVIDSEGVRFSEPYLKTMGIDIVRSSTPAFSKKYLKKSVNIILESTEEELKEWLKN
FT                   IRSLYLGQNLMDIAKISSVSSSKYKLGVDKSIPINSRAFLVSNHYINSLNTGEFQPLEL
FT                   GEKVRMLYLREPNPLKSNIFAFNNEKFANVFKDYIDWDTNFNKFFLKPLEIMTDPLNYN
FT                   LHKETETLEEW"
FT   misc_feature    101756..102910
FT                   /note="superfamily hit to SSF53098, Ribonuclease
FT                   H-like,score 7.5e-28"
FT                   /inference="protein motif:superfamily:SSF53098"
FT   misc_feature    101816..102562
FT                   /note="HMMPfam hit to PF03104, DNA polymerase family
FT                   B,exonuclease do, score 0.00079"
FT                   /inference="protein motif:PFAM:PF03104"
FT   misc_feature    102038..103639
FT                   /note="HMMSmart hit to SM00486, DNA polymerase B
FT                   domain,score 2e-48"
FT                   /inference="protein motif:SMART:SM00486"
FT   misc_feature    102401..102424
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    102863..104311
FT                   /note="HMMPfam hit to PF00136, DNA polymerase family
FT                   B,score 1.5e-13"
FT                   /inference="protein motif:PFAM:PF00136"
FT   misc_feature    102911..104401
FT                   /note="superfamily hit to SSF56672, DNA/RNA
FT                   polymerases,score 1.7e-64"
FT                   /inference="protein motif:superfamily:SSF56672"
FT   misc_feature    103007..103048
FT                   /note="FPrintScan hit to PR00106, DNAPOLB, score 4.7e-08"
FT                   /inference="protein motif:FPrintScan:PR00106"
FT   misc_feature    103379..103444
FT                   /note="Predicted helix-turn-helix motif with score 973.000,
FT                   SD 2.50 at aa 542-563, sequence QKYQALATELDVNQLTFKILIN"
FT   misc_feature    103418..103456
FT                   /note="FPrintScan hit to PR00106, DNAPOLB, score 4.7e-08"
FT                   /inference="protein motif:FPrintScan:PR00106"
FT   CDS             104682..105413
FT                   /transl_table=11
FT                   /locus_tag="CPT_0116"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA8"
FT                   /protein_id="CBJ93925.1"
FT                   /translation="MFDAFEYFYRLWELDPDTKFVSLHSHINKDFLSIKYNVDPKCFDN
FT                   FIYKDPYDLEFNKALLFDTHDFYNINHSKSLKLNKLYVIANSTIGFKENTEYFDEYFLN
FT                   KNYTNKIYYQIHRIFNHLDNVYVNCMDNCCKSYLNILKMYPKAIIKDPKNNFQHYTMTK
FT                   NFIPDIYKYFNKYIYVKTGRTYDRHPRQFTECAYQGIDCEYICEGSKFTKNDNSYYRFE
FT                   DRYDFDKRSIYNDIVISKMLD"
FT   CDS             105445..106047
FT                   /transl_table=11
FT                   /locus_tag="CPT_0117"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVA9"
FT                   /protein_id="CBJ93926.1"
FT                   /translation="MRFLEYHRLKEAEEFSRNDIKTIVKQYNKVFTRILNTKFYLVNEV
FT                   EYCTSNGSKLIGIRFASTDGYMIRFNYTAKNAKQIQKINKTTKEFHVESIDFWNPITGH
FT                   LNKPSIRVSVISSLSLKYFIEDITTSIKKNLLGTFYYKDLKFTDDLQADTRYTISPDEI
FT                   IFINTKGFKESNDFTLSSQDPNIQLILNNIKEVYGEA"
FT   CDS             106047..106754
FT                   /transl_table=11
FT                   /locus_tag="CPT_0118"
FT                   /product="Possible phage neck protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB0"
FT                   /protein_id="CBJ93927.1"
FT                   /translation="MKRILTLSDLRQYIKEELGYPQLQVELTDNQLDHCIEKTVQMFCN
FT                   VAYDGELTRYIKFECQGQGNYFVDPEVEEILQICQSGIFVGSDLNGLIDQNLSNYILST
FT                   SGVALSYLVTLSSTRSLVDKYFGRRVNFEFNSHKGLLSIYQNYHGPLLIEAKCKYIPDE
FT                   HDKIYDQEWVKAMSVAQARLMQSVVLGKYSAPLINGSQVNYSDIRQLAQDEIQRLNEEL
FT                   SNKFTEPAVFIVG"
FT   CDS             106817..107140
FT                   /transl_table=11
FT                   /locus_tag="CPT_0119"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB1"
FT                   /protein_id="CBJ93928.1"
FT                   /translation="MRVSKYKMLSSLKDSECNLVLTNYKYPQSKIDLEEFNEFGERFLK
FT                   DNAIIDVKKLKDPELNLRYDYVLILRSKLTDTALEIIKEAYPMLKTIDEYKASLTGDFN
FT                   ELR"
FT   CDS             107127..107801
FT                   /transl_table=11
FT                   /locus_tag="CPT_0120"
FT                   /product="hypothetical phage protein"
FT                   /note="note the lysozyme-like domain"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB2"
FT                   /protein_id="CBJ93929.1"
FT                   /translation="MNYDKLNKMGIILIIILSVVYFMLDINNTKVKNLEFKIQDLQIEL
FT                   NKTKKELNDTKINLNHLSSKVQDLKISLMKDMSSMYHLSDKQQSLILAEIWKQSKKYKI
FT                   NPAFLYAVLWKESRFRNDVIHKPTYVRTLKKEIQAQGMGAIVWDFWGDKLKSNTSLKSK
FT                   KDLKNWKKNIEGTAYILSYLKSLPKISNTKNKYESAASRYYGKYQANYVNKTMSKFNKL
FT                   NS"
FT   misc_feature    107151..107204
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0128 by TMHMM2.0 at aa 9-26"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    107397..107798
FT                   /note="superfamily hit to SSF53955, Lysozyme-like, score
FT                   5.9e-06"
FT                   /inference="protein motif:superfamily:SSF53955"
FT   CDS             107921..108232
FT                   /transl_table=11
FT                   /locus_tag="CPT_0121"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB3"
FT                   /protein_id="CBJ93930.1"
FT                   /translation="MNGLSFIPKSEILNKSQETCIKECQDIIFQETKEVSKDLILDTLL
FT                   GMIDSVKISDSAVHIKFNKSLIIQSENIVLGADNLNIQLAGNRVELQPRIKQNPKEIK"
FT   CDS             108229..108921
FT                   /transl_table=11
FT                   /locus_tag="CPT_0122"
FT                   /product="Possible sliding clamp"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB4"
FT                   /protein_id="CBJ93931.1"
FT                   /translation="MITKDFIKELSKMSSITDKVILKYPITTLNSEAIDMLVNIDASKL
FT                   GCQEFPDTGIYELNKFVHMFALFDNPEITRTNNAIEFETPGTKSVYTISDLSVMENFDQ
FT                   KASIIESLDNFPEVARVDISIEVIKQIKQASSIYNELNVLSIEGKSNDLYLYLDAHNRF
FT                   NSSNNTFSKEFLNHSTMDFKLKINIENFVKLPVTNYTLKIKYNESKNAFRILFESEFSK
FT                   ILISKIAD"
FT   CDS             108965..109396
FT                   /transl_table=11
FT                   /locus_tag="CPT_0123"
FT                   /product="hypothetical phage protein"
FT                   /note="note the iron binding domain"
FT                   /db_xref="GOA:D5GVB5"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB5"
FT                   /protein_id="CBJ93932.1"
FT                   /translation="MDNLKQLSATCMQIFIKLNGMHYLAKGNQFHRLHEITQEYYEFFQ
FT                   ESFDTFNERLVQLNLTPCVNIQEIHDLKNPYILDLQATKLDLDTIASTLINDFKLVDNS
FT                   VAVLIQEAIKIEDTVTEDILRTFRIRLQKYIWMLESMQS"
FT   misc_feature    108968..109393
FT                   /note="superfamily hit to SSF47240, Ferritin-like, score
FT                   1e-16"
FT                   /inference="protein motif:superfamily:SSF47240"
FT   misc_feature    109028..109078
FT                   /note="FPrintScan hit to PR01346, HELNAPAPROT, score
FT                   1.4e-08"
FT                   /inference="protein motif:FPrintScan:PR01346"
FT   misc_feature    109100..109150
FT                   /note="FPrintScan hit to PR01346, HELNAPAPROT, score
FT                   1.4e-08"
FT                   /inference="protein motif:FPrintScan:PR01346"
FT   misc_feature    109322..109378
FT                   /note="FPrintScan hit to PR01346, HELNAPAPROT, score
FT                   1.4e-08"
FT                   /inference="protein motif:FPrintScan:PR01346"
FT   CDS             109406..110185
FT                   /transl_table=11
FT                   /locus_tag="CPT_0124"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="GOA:D5GVB6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB6"
FT                   /protein_id="CBJ93933.1"
FT                   /translation="MLKEDKFIWELFQKKFPEVSREAYEDFVEEYLSIKPFKASENIFE
FT                   TNQSISNEAHFIMRTLATKKLQEVFEILKIDLEDPNVKADFENGNLGTPGRVIKLMAGA
FT                   GTDDDTECGSGRFMKPVRIATFPNKDAAKIPITKRINIASNCSHHLLPFNTDFDNDSYA
FT                   IVSYIPKDYVLGISKLQRLADFVSRRYWLQEDLTKEIYNKIKEAAQTEDVYVKLCNIKH
FT                   TCEWIRGARNTEGGFTSEFYGGAFEDPELRKQVQIRV"
FT   misc_feature    109550..110155
FT                   /note="superfamily hit to SSF55620, Tetrahydrobiopterin
FT                   biosynthesis enzymes-like, score 4.9e-22"
FT                   /inference="protein motif:superfamily:SSF55620"
FT   misc_feature    109802..110137
FT                   /note="HMMPfam hit to PF01227, GTP cyclohydrolase I, score
FT                   4.2e-13"
FT                   /inference="protein motif:PFAM:PF01227"
FT   CDS             110339..111676
FT                   /transl_table=11
FT                   /locus_tag="CPT_0125"
FT                   /product="Possible phage ATP-dependent primase-helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="similarities to ATP-dependent helicase 41 (ec
FT                   3.6.1.-) (primase-helicase) protein gp41"
FT                   /db_xref="GOA:D5GVB7"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB7"
FT                   /protein_id="CBJ93934.1"
FT                   /translation="MDNFESVLLKNIIESKDFFNRVRPILKPSIFTDFGNQKIYELIDN
FT                   FYSNYNTTPSIQEIALQIKDIPNKEARTQIATKLNDARNSENINKEFLDDLTVKFIKDQ
FT                   MFTKALMLGAEFIDKKDETYKQKAKDLIDASQLVNIHKDLGNEYNNIEERIDYYQNPRK
FT                   GIKYLRFNTLNEYIGEGFLNGTLNIFMAPAGIGKSLLMSTSIGDFLKQGLNVLLVSLEL
FT                   SNFEFLKRIDADLLDIQINALKDVDPSVIRTKFEELKRSGIGSLYVQNFPAGSFSSNDL
FT                   KSLLEMYKANNIKFDAIFLDYLGLMKSDRVSASAGLYSYIKAIGEEVRAIAVTENIPIF
FT                   SCSQLNRSAVNNTDSNNEAISDSMGTAMTADWICFLLQTEDLKKKNTIRFKITKNRYNG
FT                   RTSSFDMHINYMNMRIEDLATPTMQIQAPAEVPKLSDKPKTDWNFN"
FT   misc_feature    110345..110569
FT                   /note="superfamily hit to SSF48024, N-terminal domain of
FT                   DnaB helicase, score 0.004"
FT                   /inference="protein motif:superfamily:SSF48024"
FT   misc_feature    110822..111391
FT                   /note="superfamily hit to SSF52540, P-loop containing
FT                   nucleoside triphosphate hydrolases, score 0.00085"
FT                   /inference="protein motif:superfamily:SSF52540"
FT   misc_feature    110909..110932
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   tRNA            111946..112019
FT                   /gene="tRNA-Arg"
FT                   /note="tRNA Arg anticodon TCT, Cove score 81.47"
FT   tRNA            112034..112116
FT                   /gene="tRNA-Pseudo"
FT                   /product="transfer RNA-Pseudo"
FT                   /note="tRNA Pseudo anticodon GTA, Cove score 37.31"
FT   CDS             112245..112667
FT                   /transl_table=11
FT                   /locus_tag="CPT_0126"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="GOA:D5GVB8"
FT                   /db_xref="InterPro:IPR013800"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB8"
FT                   /protein_id="CBJ93935.1"
FT                   /translation="MTFKDYLNNITINEALKTDASAIEELRNRYQEVAKKKDELQAEIS
FT                   KLEATQTTAYFKLGGLAAQITPDNVDNEKLNKGLEQYDSEIENIEKKLEPLYKKRESLL
FT                   DELKKISRVANNLVTRNAKKAGVSPLNYVFKHNLSF"
FT   misc_feature    112305..112577
FT                   /note="superfamily hit to SSF46579, Prefoldin, score
FT                   2.8e-07"
FT                   /inference="protein motif:superfamily:SSF46579"
FT   CDS             complement(112837..113454)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0127c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR025484"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVB9"
FT                   /protein_id="CBJ93936.1"
FT                   /translation="MYISKKFLSDLGNLNKNSISWAAASNTSIALLNRSLNTSENNQYI
FT                   DDITPEEIQAGTQAVKEYCLANNLMDLYYEYVLNTASESEKLNVIKEKKKFEIQTKRDI
FT                   ALESGFVFKGHTFQTREKDKLNINGMAANILLDIQSGTNSITEITWIDLNDEKVNFTPQ
FT                   EFLSFVSKVTEYTQEVIFKANTLKEKINSSETVKSVDKIKWE"
FT   CDS             complement(113455..115185)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0128c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC0"
FT                   /protein_id="CBJ93937.1"
FT                   /translation="MQFKKVDVLISENLTKEQLKEKVLAELNKISKESNPSISYIANIH
FT                   DIVNGKYWICMDSETKETMGTTDELIDLQSIFRHTTENPDEASRDLLYSSKYIEDNFLR
FT                   KIIFETYKGTNDSRLAKLETTVGTNEKDIEDKHYKLERRVTTAENNITTNKELEDTRHN
FT                   EYTQFKKNIENNILGINNTLNTKANLGGSETQVFNVADPTSDWHAINLAYAKKNFNADL
FT                   INTHKAATNNPHKTSIANLIDTSIVGPANNHILQYDSNTRKWKNAVLSVDLSNYYSKSE
FT                   VDSKLGTKANTNNVYDKSEINTKFDSYYNKSTVDSFMELKANTESVYDKSEIDTKLQDM
FT                   LTQADNRYLPITTIVPQILTESIEKTVGAGGDFETLWEGIQYCTRYIPTNGAYFTLKLK
FT                   SGFVWNENISIINTNISFIRIISEDIEVMVDTSVSGILFLLDNSRGPAWEILLNGNGRA
FT                   ITKVFDVGRNSNIVIGSNKGAYNFDCTAAIYLWGNSQCQALGSKWGNLRVTGSAVRVDG
FT                   NSNINLKSARFLDTPNLCVDLIGGTAFVCSATFTNCGNTKFNIPTNQVTANGILFDDGV
FT                   "
FT   CDS             complement(115195..115458)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0129c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC1"
FT                   /protein_id="CBJ93938.1"
FT                   /translation="MALEASKIKIIDFVYETTKTLSQITEEAVTEMQGLVAKNDGKPVY
FT                   VRVTDVDQSRVILINSDGKIINNTSNNIVQDKRIDRLIKSLA"
FT   CDS             complement(115480..116169)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0130c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC2"
FT                   /protein_id="CBJ93939.1"
FT                   /translation="MATVTLNKLASVINTIKWSKTSDFIVIMKPINATFQNLINWGNPT
FT                   ETQNSIDICLKSINLPQYTGRFEELLIGGTWVLARGADPVYQVDMTFRDFDNASMYRRF
FT                   VNAFQISKGNYNDVCAWLIQVYLSNGSKNILVMETQDALLTDVSQIQLSQDNNEIIEFN
FT                   VSFKMNQPNHDNTDIKNIQLAGTSNTTGNDSVQSKASSYFSNMLKNGLSAAQNAVQDTF
FT                   ENLVSKW"
FT   CDS             116257..116886
FT                   /transl_table=11
FT                   /locus_tag="CPT_0131"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC3"
FT                   /protein_id="CBJ93940.1"
FT                   /translation="MKFKDYIKSLRDFKNLDNIEINTNVKFNESSLARLYKHYKEHDSG
FT                   TISAYRGENTKEENQENNKKLKNYLLANGYSVTQIQGTYEETDSKGNKKIVKEISFIVI
FT                   DINDTGKLKKVLINVGKKFNQEAVTFSTKSGDYYLIMCFTGEEFKLGSPMFGKDGKIIS
FT                   KISGRPFIFAECEDIDNHTYNDTLDAYNPLILRYHIKNSFSNLDTI"
FT   CDS             117020..117508
FT                   /transl_table=11
FT                   /locus_tag="CPT_0132"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC4"
FT                   /protein_id="CBJ93941.1"
FT                   /translation="MKFIDYLKNKALNEMAVERKVAVSVCDSQFNSIITHLLKVYIGQD
FT                   LKSALPGEEWERQINGFLNEILRVKIKNTNKHIPDSILKSSIKALIDDCIEDSRIKSLQ
FT                   SEIKSYNYNGTPLKTPKNEKKLLLYIKAFLEDVSQKITKGELNFKEDFKRYLKNIKDF"
FT   CDS             117567..117815
FT                   /transl_table=11
FT                   /locus_tag="CPT_0133"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC5"
FT                   /protein_id="CBJ93942.1"
FT                   /translation="MTFKGYLYEQAFSKDVMISKFTNNSDNIFNHILKVLVYDDNLNNK
FT                   KHLREMSGIVRSLQNKTIKSKITPEDCIEFKRILSYF"
FT   CDS             118032..120728
FT                   /transl_table=11
FT                   /locus_tag="CPT_0134"
FT                   /product="Probable phage ribonucleotide-diphosphate
FT                   reductase alpha subunit"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="GOA:D5GVC6"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC6"
FT                   /protein_id="CBJ93943.1"
FT                   /translation="MNLDTIHIVKNNGEREIFDAEKIHKHLHFACQNLDVDIISIIKDA
FT                   RLKIFDGAKSVDIQDSLIKSAQEKISEDSPDYELVAGRLLNQKLRKEVYKQYTPLDFKS
FT                   QVKERIKKGFYTEDLNAYSDEELDYFGSLINYELDNELPYSALNQMYSKYLIKHNKKCI
FT                   EVPQEVFILIPMAIFYNTDIEYRKKYVKLGYELLSQRKISLPTPIMNGARTSYKKFISC
FT                   NLLNFGDSVESFARGLEAVLKCTSAKSGLGINTSFIRGLGAPVGKPSRLDHTGMLPIVK
FT                   AIESATSALVQHGRGGASNLSMPFFHYEIELFSQLGDSKGSLENRARHTDQTIIINKWF
FT                   LEKALNKEDIFLFHMNAVGNKDPKLDLYDALGDYKRFDELYKHYSAKVPNKSKKKINSY
FT                   DLLSLIINERMITGRVYIVFADNFVNSSFKENLYMTNLCCEISVPSHSLDNYRGIPGEL
FT                   GTCILGNINFGHSKESDIPKVADFLVRFLDNMIDISDFAMPEIEYSATKRRTLGIGVSN
FT                   LFGYLAKSKLFYNTKEAREHINDLMELFYFNLVKTSIDLAKERGACELYNESFYSDNKF
FT                   IFERYLEAGIKPEFKTKLDWESLREELSKYGMRHSSLSAVPPAGNCISEDHTIETYEGN
FT                   FNLKDICNRESIDYNDLKIGWYDLKSPLKVPTFEGDSISNRFYYNGEVDVIEIETDSDV
FT                   SEVTANHELLVERNGNNIWVAASLLGPGDTIIDKFIEHKIVKNIKIGKKIKTWDLEVEK
FT                   YHNYFLNDGIISHNSSKPSSATPGIEPPRELVTIKTEKSSTVKQLVPFYKTAKKYYTTA
FT                   WGVDFNNKDYLKLVSTIQRYVDQSISTNQYYNIVETKKVNIEDVIEEFIECFNLGVKSL
FT                   YYANFRTTDDADGDQVIEGCGSGGCSV"
FT   misc_feature    118047..118313
FT                   /note="HMMPfam hit to PF03477, ATP cone domain, score
FT                   3.7e-10"
FT                   /inference="protein motif:PFAM:PF03477"
FT   misc_feature    118062..118682
FT                   /note="superfamily hit to SSF48168, R1 subunit of
FT                   ribonucleotide reductase, N-terminal domain, score 8e-37"
FT                   /inference="protein motif:superfamily:SSF48168"
FT   misc_feature    118449..118682
FT                   /note="HMMPfam hit to PF00317, Ribonucleotide
FT                   reductase,all-alpha d, score 1.8e-09"
FT                   /inference="protein motif:PFAM:PF00317"
FT   misc_feature    118686..120665
FT                   /note="HMMPfam hit to PF02867, Ribonucleotide
FT                   reductase,barrel doma, score 3.5e-26"
FT                   /inference="protein motif:PFAM:PF02867"
FT   misc_feature    118686..119891
FT                   /note="superfamily hit to SSF51998, PFL-like glycyl radical
FT                   enzymes, score 1.4e-76"
FT                   /inference="protein motif:superfamily:SSF51998"
FT   misc_feature    118914..118973
FT                   /note="FPrintScan hit to PR01183, RIBORDTASEM1, score
FT                   8.8e-17"
FT                   /inference="protein motif:FPrintScan:PR01183"
FT   misc_feature    119325..119360
FT                   /note="FPrintScan hit to PR01183, RIBORDTASEM1, score
FT                   8.8e-17"
FT                   /inference="protein motif:FPrintScan:PR01183"
FT   misc_feature    119442..119513
FT                   /note="FPrintScan hit to PR01183, RIBORDTASEM1, score
FT                   8.8e-17"
FT                   /inference="protein motif:FPrintScan:PR01183"
FT   misc_feature    119556..119624
FT                   /note="FPrintScan hit to PR01183, RIBORDTASEM1, score
FT                   8.8e-17"
FT                   /inference="protein motif:FPrintScan:PR01183"
FT   misc_feature    119640..119711
FT                   /note="FPrintScan hit to PR01183, RIBORDTASEM1, score
FT                   8.8e-17"
FT                   /inference="protein motif:FPrintScan:PR01183"
FT   misc_feature    119817..119885
FT                   /note="PS00089 Ribonucleotide reductase large subunit
FT                   signature. ScanRegExp hit to PS00089, RIBORED_LARGE, score
FT                   NA"
FT                   /inference="protein motif:Prosite:PS00089"
FT   misc_feature    119850..119933
FT                   /note="FPrintScan hit to PR01183, RIBORDTASEM1, score
FT                   8.8e-17"
FT                   /inference="protein motif:FPrintScan:PR01183"
FT   misc_feature    119889..120218
FT                   /note="HMMSmart hit to SM00306, no description, score
FT                   0.0096"
FT                   /inference="protein motif:SMART:SM00306"
FT   misc_feature    119892..120329
FT                   /note="superfamily hit to SSF51294, Hedgehog/intein (Hint)
FT                   domain, score 3.3e-16"
FT                   /inference="protein motif:superfamily:SSF51294"
FT   misc_feature    119895..120146
FT                   /note="ProfileScan hit to PS50817, INTEIN_N_TER, score
FT                   8.297"
FT                   /inference="protein motif:ProfileScan:PS50817"
FT   misc_feature    120207..120350
FT                   /note="HMMSmart hit to SM00305, no description, score
FT                   0.00044"
FT                   /inference="protein motif:SMART:SM00305"
FT   misc_feature    120264..120335
FT                   /note="HMMTigr hit to TIGR01443, intein_Cterm: intein
FT                   C-terminal splicing, score 7.7e-08. ProfileScan hit to
FT                   PS50818, INTEIN_C_TER, score 8.732"
FT                   /inference="protein motif:ProfileScan:PS50818"
FT   misc_feature    120312..120335
FT                   /note="PS00881 Protein splicing signature."
FT                   /inference="protein motif:Prosite:PS00881"
FT   misc_feature    120330..120719
FT                   /note="superfamily hit to SSF51998, PFL-like glycyl radical
FT                   enzymes, score 1.9e-15"
FT                   /inference="protein motif:superfamily:SSF51998"
FT   CDS             120850..121527
FT                   /transl_table=11
FT                   /locus_tag="CPT_0135"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC7"
FT                   /protein_id="CBJ93944.1"
FT                   /translation="MKHITKIFLGYKNNKVYFNRTQSQITSAIKNLERLKPSFNINEAR
FT                   FEEIYEAKQIEINPNILYIAVTDKQYVIVANSDWRGNITLDYKNIDFGVERSLQISRLK
FT                   RLFRAGIRIWKCNTYLYDRKRKSIGLKPSLEDRLAEYKKSKINDFNKYCLNKLKSVSNL
FT                   NLNVNNIEDLDFNNLEKQIDFMKELLYYTKKYITNEKYKFCDEPYFEYTKRKTMNAIIN
FT                   LKI"
FT   CDS             121565..122395
FT                   /transl_table=11
FT                   /locus_tag="CPT_0136"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC8"
FT                   /protein_id="CBJ93945.1"
FT                   /translation="MILDTKADILVTHSFHFNNTKMHGLSGHLFEVLDYYWYFKNKGVN
FT                   VKCLIPEVVTKETFNDFVKGHYSVDFDLNDMYFLDTKILAIKARNILVTDGGYWFLNQY
FT                   KSKLLGKVFSFACGPSFLESEDKPEYVTFLADHKIYPGLGINYTKKVLPHLNHIPGDKP
FT                   FAHITKNCRALSESQIKDLIRDYPDIVMYSDYLNIQNSTNKPIKNFNFSKYVYTPIMRH
FT                   FDCSPRLIIECRILGIDFDLWNINYKDPGLERRLETDLGQFILDESDNIINYLV"
FT   CDS             122422..123342
FT                   /transl_table=11
FT                   /locus_tag="CPT_0137"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /db_xref="GOA:D5GVC9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVC9"
FT                   /protein_id="CBJ93946.1"
FT                   /translation="MNKIDFSGSECSYEKLLNGTLEFEGIRAAIMTTNKCCFSCEYCCN
FT                   SGFTDFNAAKNTKSEADLKCFNLVKAIFPRLKSAVLCGGEPLMCDYLYNYLDLFKDLKD
FT                   VTILTNLLYIKDHYKRLKEYRNLDLVTTYHASQINSNQYIERLKYFLDIDLPKEVKLFF
FT                   NHKKPDLIERTQNVKDFLESQGFTNIICTHISGFGFSNPNKNVAGVDLNADRDYVLISR
FT                   GTKKHINESEFASQNYLGMVCNGLRLHVYPDRIIENCSRKTLTVEEVLKLKDYQVCKFK
FT                   SCNVGMCLNYFNKYNVKYLKNQLNY"
FT   misc_feature    122509..122964
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 1.3e-06"
FT                   /inference="protein motif:PFAM:PF04055"
FT   repeat_region   complement(123380..124748)
FT                   /note="IS200/IS605 family insertion sequence element
FT                   ISCaje3 (TnpB component only). Similar to ISCaje2 in CPt10
FT                   in non-synonymous location"
FT   CDS             complement(123446..124654)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0138c"
FT                   /product="ISCaje3 transposase"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD0"
FT                   /protein_id="CBJ93947.1"
FT                   /translation="MSKTKNIYSTVRSVKFVLKPNIKQREILESFFGLSRTIYNISLHN
FT                   IKNSKFGTYEIQNGKNKGCIVPRIPTEFDLNNSIPKLKDGYSFLSLLPATYTQSVMKNL
FT                   SRGFNNFYRTFNYPKFKAKKNSIQSFNCYAGAKIEGDHIILIKPRCSDYTKEDLKIRFK
FT                   RHKIKYNFDKVTGFTISKENNKYFISFTFHCNIESKETSDAVGIDLGIKDFCICSDGTI
FT                   YENKRFLEKSLRKLKISQRKLSKKQKGSNNREKQRLKVSKLHKKVKNQRNDYQHKVSRE
FT                   IADKYRTICLETLKVKNMVKNKKLAKAISDVSWSSFIEKLSYKVAENQGCLIKIDTHYP
FT                   SSRTCSNCGCIKENLSLSERTYNCEECGFSIDRDLNASINILNLGLKNIVATVTTTGTT
FT                   LKN"
FT   misc_feature    complement(123503..123715)
FT                   /note="HMMPfam hit to PF07282, Putative transposase
FT                   DNA-binding domai, score 2.3e-29"
FT                   /inference="protein motif:PFAM:PF07282"
FT   misc_feature    complement(123632..123856)
FT                   /note="HMMTigr hit to TIGR01766, tspaseT_teng_C:
FT                   transposase, IS605 Orf, score 9e-13"
FT   misc_feature    complement(123749..124612)
FT                   /note="HMMPfam hit to PF01385, Probable transposase, score
FT                   1.2e-56"
FT                   /inference="protein motif:PFAM:PF01385"
FT   CDS             125073..125612
FT                   /transl_table=11
FT                   /locus_tag="CPT_0139"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD1"
FT                   /protein_id="CBJ93948.1"
FT                   /translation="MIKNAKIQEIKDFNNDLIAKMLKACPDFNLKVNYRTQFIIIKDNS
FT                   IRESAYYRTEIDAYEAGMIEIDEDALDGISISHNKIEFFRNDRRNGLSIELIEDNETRI
FT                   KIRFDLQDRNIFDEDYYAYDCFGSRAFIFRNDLNRFNDSFTTKIKLKNFLTKNFDLFKD
FT                   FIKSSNEYLNLINESL"
FT   CDS             125633..125884
FT                   /transl_table=11
FT                   /locus_tag="CPT_0140"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD2"
FT                   /protein_id="CBJ93949.1"
FT                   /translation="MEIIKSVASGFFKYTIIIFLLGFFSGVSFTFFMTKWYFEDRGSTI
FT                   GYEIQRANMIKNCIKEVDVALEIMKEENSVIDATQPLN"
FT   misc_feature    125660..125728
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0148 by TMHMM2.0 at aa 10-32"
FT                   /inference="protein motif:TMHMM 2.0"
FT   CDS             125899..126195
FT                   /transl_table=11
FT                   /locus_tag="CPT_0141"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD3"
FT                   /protein_id="CBJ93950.1"
FT                   /translation="MIIEIKDFPLNVKRVVLEFDDSGACVVEPETKIKNKPRNDKIVKE
FT                   PEPEIQNEPEPALDINFGSKPVKAASIEPIDKVVIPDIEREANVSATMQNLKL"
FT   CDS             complement(126275..127189)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0142c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD4"
FT                   /protein_id="CBJ93951.1"
FT                   /translation="MYKLLLENSLKESTNLINEGIDADFYQVMLGDILKDKIKSFIGHH
FT                   IAEVQPMLQPSGYVFARQETQDTFKIIKKQIDVDTNKSIIKISQEAWEDLLNLSNLNKA
FT                   GNEQTPELFINWVKSSAAHKETEKIINLIKENAVDAGNLTLDDTNDSKQNAETNLFYIS
FT                   KKVGDLVIKMNSPNFRTYDSFCILPQTGIGGILSLSFTYSRIDDSTDENRANDYFLGKI
FT                   NNTRYYLNPNPNDNNAYVGLKSHKEKGVNSLIYSPYCMNLTTAYNYQSGERTVGIFTRN
FT                   AYTIHPLHSPTTPMLYKFTITEA"
FT   CDS             127449..127889
FT                   /transl_table=11
FT                   /locus_tag="CPT_0143"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD5"
FT                   /protein_id="CBJ93952.1"
FT                   /translation="MLTAEIADKLNISMTNISKWYTEFSESVANKHLVRICNCVFVHRD
FT                   FPNLTKNMKIIFDESRIDWSNKLPLNYMIKNFKINVAYCEKYNIGHKISYDFKTHRNRV
FT                   IQKDFFEFNPSILKLLKDTELESSKVASLKSIQVSKNYFICF"
FT   misc_feature    127449..127514
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1500.000, SD 4.30 at aa 1-22, sequence
FT                   MLTAEIADKLNISMTNISKWYT"
FT   CDS             127908..128162
FT                   /transl_table=11
FT                   /locus_tag="CPT_0144"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD6"
FT                   /protein_id="CBJ93953.1"
FT                   /translation="MDSKSFIKKQVLKILKVTNIEEEILHKMFVDEGVDADFLIQVLKD
FT                   LHKEYKIKVLIKSDSCLFEWDSHKPYVKGVYLIERIFRT"
FT   repeat_region   128167..129880
FT                   /note="IS200/IS605 family insertion sequence element
FT                   ISCaje4"
FT   CDS             128193..128435
FT                   /transl_table=11
FT                   /locus_tag="CPT_0145"
FT                   /product="putative IS200/IS605 family transposase TnpA"
FT                   /db_xref="GOA:D5GVD7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD7"
FT                   /protein_id="CBJ93954.1"
FT                   /translation="MIVIENKDRLCRFGFEMLQSIFRYFGTRIIVISEDIQNKSYEQEL
FT                   TEDLLVIIHHFSMKSYSHRRKLNKLKKSIELGESL"
FT   misc_feature    128196..128408
FT                   /note="superfamily hit to SSF53041, Resolvase-like, score
FT                   5.1e-06"
FT                   /inference="protein motif:superfamily:SSF53041"
FT   CDS             128432..129829
FT                   /transl_table=11
FT                   /locus_tag="CPT_0146"
FT                   /product="ISCaje4 transposase TnpB"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD8"
FT                   /protein_id="CBJ93955.1"
FT                   /translation="MIKDQENIITIKLDYKSSDTERILDCIKNYNSLFRSTYSFYQQVP
FT                   DLKQAETTRLQSKLNNIFLDKWFFASAVFDVKSFKNKKKKDEKVIFGGKKNFFDRLKGK
FT                   ISKQEYQLKRLLPLYSVGEASKSGNRKFQIEDENTIIFKVSRKEHITLKLNGTSKRYRD
FT                   YLNQLITLQINKYIPITYKLDTKYVYISFDLNKLKHNLKVQDKIKDRVFGIDLNPNYIG
FT                   YSVVDWKNDGSYKIIKTGSISLKALNDYDNSLKGQEYSSQSKERKYISNKRNHEIIQIA
FT                   HQLPKLANHFGCEIFSLEDLNMKQGAKEKGTKFNKLCNNQWCRNLLVSQIKKMNCLYKI
FT                   RTLEVQPQYSSFIGNLVYRVHQLPDYVLASIEIGRRGYEFYHQYILKDKKMEKNIIFGN
FT                   YGKDKNLYNLSLEEIGIKESFNSFMEMYSFIKNSKTRYRVSLDDIDSSRVFRKLFIKSY
FT                   TEFYNFL"
FT   misc_feature    129236..129484
FT                   /note="HMMTigr hit to TIGR01766, tspaseT_teng_C:
FT                   transposase, IS605 Orf, score 8.5e-06"
FT   CDS             129886..130599
FT                   /transl_table=11
FT                   /locus_tag="CPT_0147"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVD9"
FT                   /protein_id="CBJ93956.1"
FT                   /translation="MTIYSFSKIDTYKKCPKQYYYRYIEKVPETQKNPALKKGSDIHEI
FT                   LEFHNTEKYDIIFNSKDPEIQNIALRFIDSELGKEILSRKSLREFELFLDSNYEPCSKD
FT                   TAIFVGYIDRINTTENGLELIDYKTGKYKEPSYQDFTQLILYSLYMFKRLKLDEIKIRY
FT                   VYVEHLLENTLSLSQDSAIYWQDNLNNQIKSIENSIESNTWNSKPNKLCPWCPYAGLCP
FT                   DFKGKPKCQKTISKN"
FT   CDS             130572..131990
FT                   /transl_table=11
FT                   /gene="uvsW"
FT                   /locus_tag="CPT_0148"
FT                   /product="Probable phage ATP-dependent DNA/RNA helicase
FT                   (uvsW)"
FT                   /product="atp-dependent dna helicase uvsw (ec 3.6.1.-) (dar
FT                   protein)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="GOA:D5GVE0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE0"
FT                   /protein_id="CBJ93957.1"
FT                   /translation="MPENDFKKLNESFSLISLTDNQKAKLIFKKDIRYNIWAQMNPKLA
FT                   YEYFYKDFNNQQIVPNGVLEYLGITTKPEINEKLDSQLEIIIKHLEPFPVYDYQKQAIK
FT                   DAIQFHKLFIRAATGAGKSVIIGLIAKILTLKKLKGLILVPNISLTNQFNNDLINYKLN
FT                   IETRLIGGENNIKSFDKPLTISTWQSVKNFKEALNDLDFIIVDEAHTAKADQIFDICNK
FT                   CVNAKYKIGLTGTIPDNEIDAMRLISIFGLPRTYITPRGLIDRGLATNAIINIIDLKYK
FT                   FNFEGEYSSQLKQLKEYDPRNNLIQRIGDTVVSKGNTLVLFSHTEHGLTLFYKFLKSRG
FT                   LNYDKKTYKDLAFQQRNNVFFINGMIEGSQRETIRQLIDSVNNAIIVANYATTSTGVNI
FT                   KNLHNLVLASPLKSYVTITQSIGRLLRLHDSKDIVNIYDIADHNGFFKKQINARITKSY
FT                   EPEGYEIKRFAYNI"
FT   misc_feature    130605..131897
FT                   /note="superfamily hit to SSF52540, P-loop containing
FT                   nucleoside triphosphate hydrolases, score 1.2e-20"
FT                   /inference="protein motif:superfamily:SSF52540"
FT   misc_feature    130842..131369
FT                   /note="HMMSmart hit to SM00487, no description, score
FT                   1.2e-16"
FT                   /inference="protein motif:SMART:SM00487"
FT   misc_feature    130845..131285
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 7.9e-15"
FT                   /inference="protein motif:PFAM:PF04851"
FT   misc_feature    130857..131303
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score
FT                   1.1e-07"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    130893..131333
FT                   /note="HMMSmart hit to SM00382, no description, score
FT                   0.0077"
FT                   /inference="protein motif:SMART:SM00382"
FT   misc_feature    130917..130940
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    131628..131855
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 0.017"
FT                   /inference="protein motif:PFAM:PF00271"
FT   CDS             132290..132718
FT                   /transl_table=11
FT                   /locus_tag="CPT_0149"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE1"
FT                   /protein_id="CBJ93958.1"
FT                   /translation="MLIQVNENTTVKLSAVCNINVLKDKQVFNMCYTFTDKKGAMSGYY
FT                   YVDNSNINYQNSKYFKEKFIAVRGIDRLIYINTDFVSFIKKDYANYPKVVIGFSHSVLR
FT                   HNVESFAFAPEYMYIRTKPEDLDNTYAEILEAITNISK"
FT   CDS             132729..133457
FT                   /transl_table=11
FT                   /locus_tag="CPT_0150"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE2"
FT                   /protein_id="CBJ93959.1"
FT                   /translation="MRDEFDDLLASLAIEPIKKPEIEYQEPLVVKPTSNIEVNEANKQN
FT                   TNLNDFSDVLNSIESDVSSTNNNENIVASSDSEAFKEYIDLRNIKNESDIEVPDLVDTM
FT                   RLEEAPSLVSDTSNIPTNQTQESKPRGYEVPDIKGTTKRVPDIDDSENNVYKLETEYID
FT                   IILSYEEELKDLKRRFKLNTLEYQAKGVQTRLVIKAVKQAAKDAKKEGYIIKDENRIQE
FT                   RINNDSNLLGRICSVINSSI"
FT   CDS             133519..134847
FT                   /transl_table=11
FT                   /locus_tag="CPT_0151"
FT                   /product="Possible DNA topoisomerase (medium subunit)"
FT                   /product="dna topoisomerase medium subunit (ec 5.99.1.3)"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="GOA:D5GVE3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE3"
FT                   /protein_id="CBJ93960.1"
FT                   /translation="MVHKSIQDYFLNELTNYSCYSTLRMIASSIDGLKNSSRKIINTAL
FT                   DKKLNTETKVSIFDNMVQSYTQYLHGSCAGVIQNMAASYTGSNNIPLLEGKGNFGSRFI
FT                   NEPAAPRYVYVKNKKYINDLFDIKDVLISQNFEGSEIEPVFYVPSLPILVLNGSMNGLA
FT                   SGFKQNILPRSLDSVIKYIKTGKKVDLKPYIAGFKGTVELVEDASSNNTQWNFIGVVEV
FT                   NKNKAIITEIPPFIEYTKYLEILDNLVESKKIKNYKDLSDQRNQEFKFEVIFFDNISKD
FT                   KAIDILKLSKRETEIYNALDENNQVRTFENIESIIDYYIDVRKRFLIKQKDFDLKVLEN
FT                   DLNINVQKLRFVKLIIDSELQIMKRSKKDIELDLESKGFIKFEDSYDYLLKLPIHSFTN
FT                   ETFEKLVQNAKEIKAKFETLKNLDTFKNYVESLDSIKNILTKA"
FT   misc_feature    133528..134808
FT                   /note="HMMSmart hit to SM00434, DNA topoisomerase IV
FT                   domain, score 4.2e-16"
FT                   /inference="protein motif:SMART:SM00434"
FT   misc_feature    133552..134841
FT                   /note="superfamily hit to SSF56719, Type II DNA
FT                   topoisomerase, score 1.8e-61"
FT                   /inference="protein motif:superfamily:SSF56719"
FT   misc_feature    133588..134838
FT                   /note="HMMPfam hit to PF00521, DNA gyrase/topoisomerase IV,
FT                   subunit A, score 1.5e-11"
FT                   /inference="protein motif:PFAM:PF00521"
FT   CDS             134874..135761
FT                   /transl_table=11
FT                   /locus_tag="CPT_0152"
FT                   /product="Probable phage ClpP protease"
FT                   /db_xref="GOA:D5GVE4"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE4"
FT                   /protein_id="CBJ93961.1"
FT                   /translation="MRYEAMNNKTKMEDSELDIISVKDARHSLYKKSFNYTNYTLNINS
FT                   FDHEEGELENIFASLNDAAEGDSIQIFIASVGGFADELNRFTNIIRTKFYGNVTTVLNP
FT                   FGYSCGAMLFLIGNSRVIYENSSIMFHSVSFGVSGKHSDVKTQFDFSNKYWNEYMKSLL
FT                   NPYLTKKEIELLIDGVEFWFDAYEMCKRGIATHINVFGLSMKASDYCEYIDNLDYRIAF
FT                   LEYIIKEGDLDSIDLQRAEIELEQAKKDAKKAKTIKTIKTTKKAVESKPKAKTTKTAKA
FT                   KTTTNSEIESNDLN"
FT   misc_feature    135024..135476
FT                   /note="superfamily hit to SSF52096, ClpP/crotonase, score
FT                   1.2e-06"
FT                   /inference="protein motif:superfamily:SSF52096"
FT   misc_feature    135153..135221
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0160 by TMHMM2.0 at aa 94-116"
FT   CDS             135834..138020
FT                   /transl_table=11
FT                   /locus_tag="CPT_0153"
FT                   /product="hypothetical phage protein"
FT                   /note="note possible domain"
FT                   /db_xref="GOA:D5GVE5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003450"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE5"
FT                   /protein_id="CBJ93962.1"
FT                   /translation="MKITIFGTASKNEKFAKSPYDDNSFIFETIEVQTTYQAFQLLVNN
FT                   FCLNITLDLKGPSKSRRLKTDLEPHIIKTFDHLLFDFECKSEFNKNMALDYFKSTQCTI
FT                   GQSRSYDGVNNFNLKGIIKTTPMSLKELKVLQAKIQKELSEYGKYTTDTLRITYYTAPL
FT                   NKDNILLDNPNGSVLMPVGTNVTDYYNNIDLDCKFNITSKETTEICKTIFKNLGFILVD
FT                   INANGSIKYTKDSEDYIWYPNNPYIMNHTESYMSVNIWKEAMKYEPTFDITPYIDYKAD
FT                   IVVDRNFTEIKSELDSIVESFLFKHNGALTLRAPMGSGKTTFIDRIIEYALEQDFKIAI
FT                   ITNRVTLAEDYKRKYKKFLYYKDYTNAIKAKNDYKNNNDCNNKPKIVRPKGKSLICQYD
FT                   SFNYFDLDDYDLIILDEFMSLLMHTRTALNSKTENLIKFYTALNKKVVVADAFLSKYIV
FT                   DNMFTKPLNVVSYTKNNTELYSCNDANTFYTLIKNALDTNKKITISTTSIKVVDIIKEM
FT                   CHILNKKIIIFNKETSTISKDIIYDKIRSKEVLDCDVFIYTPVLTVGVNILNDVDIHFH
FT                   YDSASSTDVISSLQMLGRARFSKKIIYYVMNKKYNACINYDLLKTTVEKKPKEYTDDSK
FT                   DRNAEYKRGSIKNLLYHFHIPPGKDYQELSHIGKACLKVDVFNNMTLCDYKKSFDILLS
FT                   FNFSKIPIELRKIGGDILKLMDIKIQDSKDSDTF"
FT   misc_feature    136623..137957
FT                   /note="superfamily hit to SSF52540, P-loop containing
FT                   nucleoside triphosphate hydrolases, score 1.8e-10"
FT                   /inference="protein motif:superfamily:SSF52540"
FT   misc_feature    136773..136796
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    137382..137627
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 0.021"
FT                   /inference="protein motif:PFAM:PF00271"
FT   CDS             138106..138531
FT                   /transl_table=11
FT                   /locus_tag="CPT_0154"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR016133"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE6"
FT                   /protein_id="CBJ93963.1"
FT                   /translation="MKLIDGYYTDFDNNKWDSSRYTEDQAREASESLVFCKDCLNCFNC
FT                   VACYKCIDCIDCCKCRVSEDCIDCKSCIDCIDCYKCQGCFKCHKCVYCLDCHECVDCKR
FT                   CRASIDCLNCIECGNISNKSHIRKSYTVLKLYKILNT"
FT   CDS             138565..139104
FT                   /transl_table=11
FT                   /locus_tag="CPT_0155"
FT                   /product="hypothetical phage protein"
FT                   /note="note phosphatase domain)"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE7"
FT                   /protein_id="CBJ93964.1"
FT                   /translation="MIYITSDLHISHQNIIKYTGRYINDALEYSKEVHKYFKSVLKDSD
FT                   ILMFLGDLDCGPNKNIEFLRHFISSLPSKKIFVRGNHDKWLDTESILYIGFSAVSDIIR
FT                   YKDTLFCHYPLDSRSVIPKEAPEFLKSYDLTGIKKIYHGHTHNNWIVDSKDGIERINCC
FT                   IDRNPEVIGALIPFEI"
FT   misc_feature    138565..139050
FT                   /note="superfamily hit to SSF56300, Metallo-dependent
FT                   phosphatases, score 1.2e-11"
FT                   /inference="protein motif:superfamily:SSF56300"
FT   misc_feature    138565..139017
FT                   /note="ProfileScan hit to PS50185, PHOSPHO_ESTER, score
FT                   12.466"
FT                   /inference="protein motif:ProfileScan:PS50185"
FT   CDS             139123..139308
FT                   /transl_table=11
FT                   /locus_tag="CPT_0156"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE8"
FT                   /protein_id="CBJ93965.1"
FT                   /translation="MNKVSEVKKVTRVFQGKSVYDCFVRWNDTNKFVPCTVDIQNPGDL
FT                   KPLADYLLKHNLISGL"
FT   CDS             139333..140349
FT                   /transl_table=11
FT                   /locus_tag="CPT_0157"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /db_xref="GOA:D5GVE9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVE9"
FT                   /protein_id="CBJ93966.1"
FT                   /translation="MHSDIIQTLSSAGAYLPNDTICPRAKLDTGTYCNYRCYFCYYQNE
FT                   LDKKTPFEVIKKRIDTLYNIGCRDFDLSGGESSVHPDFFKILEYIKSLNPDNKISCLTN
FT                   GSKFQNKDFLKKAKDLGLSEILFSLHSVNETHDKITGIKNSYNYIIKAIHNAKDLDIVV
FT                   RLNSTITDVNYKLVDTEYFEVVEKLEPLEMNFLPLNYFSQNSKSKGVNYSEILEPIKRF
FT                   IDLSKIPLINVRYVPFCYMTGYEKYVVGYYQHIYDIYDWNIAMYEYLEPNLVNLAKQAA
FT                   SNRQKSYRKCDACRTCKYFYICDGIEPQVLKTGCEFKPIQGSKIKDVNTFRKSFFNF"
FT   misc_feature    139399..140004
FT                   /note="HMMSmart hit to SM00729, MoaA, NifB, PqqE
FT                   domain,score 0.0074"
FT                   /inference="protein motif:SMART:SM00729"
FT   misc_feature    139411..139896
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 5.8e-25"
FT                   /inference="protein motif:PFAM:PF04055"
FT   CDS             140449..140997
FT                   /transl_table=11
FT                   /locus_tag="CPT_0158"
FT                   /product="hypothetical phage protein"
FT                   /note="note thymidine kinase domain"
FT                   /db_xref="GOA:D5GVF0"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF0"
FT                   /protein_id="CBJ93967.1"
FT                   /translation="MDISLIMGPIRSGKSLELLRQAEKLHFSNKSYVLYRPKADTRDFI
FT                   SRSFRPSLDLNIQYYNNEKFSESKYDYILLDEFQFFEPEIIKNILESNKTFVLCALQSG
FT                   TNNINEPYNVEVFKNVNRIIPFCSDIRLLTSICEKCGSSCATHSYTDVITVSDDYKILC
FT                   NNCLDFEISNAGVFKRLKT"
FT   misc_feature    140449..140949
FT                   /note="HMMPfam hit to PF00265, Thymidine kinase, score
FT                   3.1e-10"
FT                   /inference="protein motif:PFAM:PF00265"
FT   misc_feature    140470..140493
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   repeat_region   141026..141092
FT                   /note="Repetitive Region 6.1"
FT   repeat_region   141093..141163
FT                   /note="Repetitive Region 6.2"
FT   repeat_region   141164..141234
FT                   /note="Repetitive Region 6.3"
FT   repeat_region   141235..141305
FT                   /note="Repetitive region 6.4"
FT   repeat_region   141306..141376
FT                   /note="Repetitive Region 6.5"
FT   repeat_region   141377..141447
FT                   /note="Repetitive Region 6.6"
FT   repeat_region   141448..141518
FT                   /note="Repetitive Region 6.7"
FT   repeat_region   141519..141589
FT                   /note="Repetitive Region 6.8"
FT   repeat_region   141590..141660
FT                   /note="Repetitive Region 6.9"
FT   repeat_region   141661..141731
FT                   /note="Repetitive Region 6.10"
FT   repeat_region   141732..141795
FT                   /note="Repetitive Region 6.11"
FT   CDS             142024..142452
FT                   /transl_table=11
FT                   /locus_tag="CPT_0159"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF1"
FT                   /protein_id="CBJ93968.1"
FT                   /translation="MDPKNEFDEFDTLLNFLAVKPEDEYPGEPVDISEFYKAYNLPNPS
FT                   DEEYTESNYKTENTLAESLKNTKGNELESKIANIFNLTGFDAWNKIIKIRGEVENIHTH
FT                   IKLDQRLNRHINHLLSDRSTLSKTYIEHALPQQRIQFS"
FT   CDS             142679..144403
FT                   /transl_table=11
FT                   /locus_tag="CPT_0160"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF2"
FT                   /protein_id="CBJ93969.1"
FT                   /translation="MLKNRSELFKKSRKNTRYGYTSQLEHINNFYSIGDECLAKSSLLY
FT                   TDDPLRYRDYNGPLVGSFKALKITPTEFKSLLNKEFKNYIRNSVSYFYDYLKHHDIQYF
FT                   EHINIADLFYSLCELMDYTEHKCRVLSVRANYVRDSLDYSNVFNIMCWLLYKLQSSLGV
FT                   EKCTDSTQKHKINFDELTNKLYFGEYSFFKQSLGNLTKFYDRIRKEVKNQKYVVKSIKF
FT                   SKRLPNVVDVKPFNMDVYEEPDPDDYINDDEVPRLATNKVDRREAKYARDRLEFLKYCK
FT                   IPYFYLTGDYAEKFEFLARVFDVDLKTTTAFRRLKKFGSIYKKSKDTLDVCEFKKAVNN
FT                   INKKYFKKRKYLIKRESWKLYAPINIMSINGRVANLKMREIIFSIDRMDKIKKEFDNLN
FT                   KLRSKYGATFTYCKANPHKQNKRDLKNALKAVEKSINKILKIDSQIRAKHPCSDSEDGK
FT                   FKSLIKRLTDMEEGIRCSGSVGSKLSKHKDELELRFKDLDFDNNDLSVDGTKKARDLNL
FT                   SLKNRLYNYVYSIVSPKTKGLNLKQLIFNYNSSYTGNDNFNSIYNILNYYNTSTFQL"
FT   repeat_region   144570..144641
FT                   /note="Repetitive region 7.1"
FT   repeat_region   144642..144714
FT                   /note="Repetitive region 7.2"
FT   repeat_region   144715..144765
FT                   /note="Repetitive region 7.3"
FT   CDS             144858..145730
FT                   /transl_table=11
FT                   /locus_tag="CPT_0161"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF3"
FT                   /protein_id="CBJ93970.1"
FT                   /translation="MIKTNKKLEAIKDTLSSPENLGTHFYILESIKGFNFSVKFDKING
FT                   SIEYFTKSKPINFKSNKSSKIKVLNDTINGVSLISKLVELINIKYPEDAHIEFFLTLFS
FT                   VGASESKYTEYAIIMYDILVGSKQLESKYEDFDNVLDYCTLAGIKTNPIIKIANDLDSA
FT                   LSISVNSDSMIPYLFNNSSKLVPMYGITIRPYKELQYKLRSKTHRLIIELDESNTSADS
FT                   KTEDSEFLKFLNIESLNVVKAQNPKNLETELIYYIIEKINEIKHLSVEEIKNLKSKYLQ
FT                   RVKDFISAN"
FT   CDS             145890..146798
FT                   /transl_table=11
FT                   /locus_tag="CPT_0162"
FT                   /product="hypothetical phage protein"
FT                   /note="note NAD-dependent epimerase-dehydratase domain"
FT                   /db_xref="GOA:D5GVF4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF4"
FT                   /protein_id="CBJ93971.1"
FT                   /translation="MKIFVTGSSGFLGSNFIKMIYSLDSNSRVIGLDIKPGEYTDSIQG
FT                   IKNAKKSGLLKNLIKNSDIVVHFASHLGVQNIIDNPNLPFKSFKNDKIVVDLAVKYNKK
FT                   IVYFSTSEVYGDSKDYSESSDLIISSKLRSNYALEKLFMERYIQSKTNNYLIIRPFNVY
FT                   GPGQNPNNGFIAKVLAAAFNPKELIKIRVDTESKTGTERCYCYVDDFNKILYKLIKQNV
FT                   SGVFNIGNPMARANPLDIIKIINSFGYNIKYKFEIIENENDYEIQRRVPSIVKLSEVVY
FT                   TDFTNLKTGIKNILYYVDPPF"
FT   misc_feature    145890..146657
FT                   /note="superfamily hit to SSF51735, NAD(P)-binding
FT                   Rossmann-fold domains, score 8e-26"
FT                   /inference="protein motif:superfamily:SSF51735"
FT   misc_feature    145896..146576
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase fam, score 7.1e-16"
FT                   /inference="protein motif:PFAM:PF01370"
FT   misc_feature    145899..146591
FT                   /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
FT                   dehydrogenase/iso, score 5.7e-05"
FT                   /inference="protein motif:PFAM:PF01073"
FT   CDS             146836..147408
FT                   /transl_table=11
FT                   /locus_tag="CPT_0163"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF5"
FT                   /protein_id="CBJ93972.1"
FT                   /translation="MLKHLIIAGHPDDEVIGCSSILLEDSVGVLYITNDYSTANAERNK
FT                   VKDKLALDYQKCLNYPFFRMPDINELADNIKDVLDSIKPENVYVHHPEDLHQDHNAITK
FT                   ATLIAARMNRNDYIKSLSYYYVENPFELKACEFRKIDKDEKLKFLSKYKNYIPENHIKT
FT                   ILAFNEFVGIYSNLGFAEPFEVVYKRS"
FT   CDS             147445..147990
FT                   /transl_table=11
FT                   /locus_tag="CPT_0164"
FT                   /product="hypothetical phage protein"
FT                   /note="note polysaccharide deacetylase domain"
FT                   /db_xref="GOA:D5GVF6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF6"
FT                   /protein_id="CBJ93973.1"
FT                   /translation="MSEIIMIHEVNDKVLKAAESLDPDSIITFDDGLYTQFHYRSHFAL
FT                   FKRVIFFVNPSIICESSEKQSKEYIQCYNAHKKAFKGCFENYMTLDQIQQISRENMYNF
FT                   EIGSHSYNHKYFKDSKSLIKDIQDSLDFFENHNIPIKSFCFPYNQDSRNPHFIQAVKLK
FT                   FKDLDIFGNNRVPIESKF"
FT   misc_feature    147520..147885
FT                   /note="superfamily hit to SSF88713, Glycoside
FT                   hydrolase/deacetylase, score 0.00011"
FT                   /inference="protein motif:superfamily:SSF88713"
FT   CDS             148057..148695
FT                   /transl_table=11
FT                   /locus_tag="CPT_0165"
FT                   /product="hypothetical phage protein"
FT                   /EC_number="2.1.1.148"
FT                   /db_xref="GOA:D5GVF7"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF7"
FT                   /protein_id="CBJ93974.1"
FT                   /translation="MKNIKVKLIADSGINVFIDAVRTCWDSHSKCDTTGDNVGENDKAL
FT                   IDRIVHKHKHHSTLEHLFYNFEITGISRLCLQELARHRMASFSVKSTRYTLKELRGSNI
FT                   STLEAASKFIVLTGNELVDTASHKNLKELHNIVNTNGITQDYAKYCLPECYRTSLRFSL
FT                   NARSLRNLLELRLSKGAHFEIRYLAKLLFDALPDLHKELIFNDLEYSEN"
FT   misc_feature    148057..148680
FT                   /note="superfamily hit to SSF69796, Thymidylate
FT                   synthase-complementing protein Thy1, score 9.1e-33"
FT                   /inference="protein motif:superfamily:SSF69796"
FT   misc_feature    148057..148674
FT                   /note="HMMPfam hit to PF02511, Thymidylate synthase
FT                   complementing protein, score 8.6e-27"
FT                   /inference="protein motif:PFAM:PF02511"
FT   misc_feature    148069..148677
FT                   /note="HMMTigr hit to TIGR02170, thyX: thymidylate
FT                   synthase, flavin-dependent, score 3.6e-34"
FT   CDS             148739..149050
FT                   /transl_table=11
FT                   /locus_tag="CPT_0166"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF8"
FT                   /protein_id="CBJ93975.1"
FT                   /translation="MYITKEDGEEIEVEIDEFGDDDVLRYARDLIEDDRSKIEYFKDLM
FT                   EPEFKFDFLNDLYNIEYKKNYFESFPEHKKLIDFIKDLYNLEYKKDYFESFPDYKKIN"
FT   CDS             149076..149186
FT                   /transl_table=11
FT                   /locus_tag="CPT_0167"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVF9"
FT                   /protein_id="CBJ93976.1"
FT                   /translation="MLSRKIRIDNFISDKEKEEIYQYSRLLKIQKMNITL"
FT   CDS             149267..150376
FT                   /transl_table=11
FT                   /gene="NrdB"
FT                   /locus_tag="CPT_0168"
FT                   /product="Probable ribonucleotide reductase (small
FT                   subunit)"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="GOA:D5GVG0"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG0"
FT                   /protein_id="CBJ93977.1"
FT                   /translation="MNVLYNNEYIDFTKEPLFFGTGKNSQRYDVIKYPIFETLFKKMAG
FT                   FDWQEDEVQCTKDQADFNVLNEAMKHSYTRVLNKLIFLDSIQGRGLLQTIGSIVTNPEL
FT                   EVCMTEWQRFEISRHSRSYTHILRSVYANPSKIFDESFEIPELLELADSISKPYEEAFE
FT                   AVTKYHLGLIDTEEVKVKVLNMLVEINILEGVRFYSGFATIWSMHYSQGLMERTGKILQ
FT                   LICRDENLHLAITQNLIKILSRSPEEGFINAWNSIKDNITDRYLEAADQEFKWIDYLFS
FT                   KGAFLGMTPELAKNYIKYLINKRLKAIGFKEVFAGFNKNPIPWVETYINYDKNEVLPQE
FT                   SEITNYKMDILDTEIKDSAFERLKKKLKI"
FT   misc_feature    149267..150256
FT                   /note="superfamily hit to SSF47240, Ferritin-like, score
FT                   7.4e-61"
FT                   /inference="protein motif:superfamily:SSF47240"
FT   misc_feature    149327..150244
FT                   /note="HMMPfam hit to PF00268, Ribonucleotide
FT                   reductase,small chain, score 2.4e-07"
FT                   /inference="protein motif:PFAM:PF00268"
FT   CDS             150523..150930
FT                   /transl_table=11
FT                   /locus_tag="CPT_0169"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG1"
FT                   /protein_id="CBJ93978.1"
FT                   /translation="MKDLTTKFINIMLNNNHDEALHNKIQEKLFSSDLQDSNCDTGFES
FT                   FRLELNCSIDELKSKLLGCGYLDDTDEDLWNFFKLKDSDGDSQWDKYVYSLPSSTRDLS
FT                   STTFRIKDGNTIVFYDMVWGSEQTCHLTFKN"
FT   CDS             complement(151000..152148)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0170c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG2"
FT                   /protein_id="CBJ93979.1"
FT                   /translation="MNPGTQSLFSHACDVKDFTFSILNNKSSKSLELKTGETKSGEISF
FT                   NGFIILSYFTVNGTTDLQYYLDQSGDMRFIPFILDASEGYYRREFQVVKNNKTQTTDKS
FT                   NFTIQGQDLISYLFSKLYIAKTYKNKKLSDIFKDIYDTYIKPKLKYNPDSVKLELSSNI
FT                   VIENFVLTSRKSVLDFIFEECDRQGLILFQDKQKIVMKPYKELKPNNLKLQNIQYDDFK
FT                   KDPNNPYDILSRKIINTNQALKLPKSQIIAFDKATKTMKVMKINLEDLDFDVPVESQDH
FT                   DGFEYQAQEYLYDDNIFADTYKSFLDYSKLELVVPGVVKAPEIFTKYKVLFKSNENTNE
FT                   TQEGDTKISGEYILTGFIDKIESSQFYITKLILSRFKDTDIQ"
FT   CDS             complement(152148..152843)
FT                   /transl_table=11
FT                   /locus_tag="CPT_0171c"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR021674"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG3"
FT                   /protein_id="CBJ93980.1"
FT                   /translation="MNFNQHTNEYDLSGSVTEELIRLYGAPLKLIITKKINRDLTFGDF
FT                   SHFKADNRACFEIFGMPENSEEFDQYERLQTQFGVPLDTSIGLYVSKISTFNLVQSSMN
FT                   SKNEYDVTLPDSRIHDLIGSLIIVPSGKILEITEITLDCFGLNNVFLYNQYKNVYKFKC
FT                   KTYVFKKSDELESDFVIRSDELLDKQTPNTDMHNELEKYFDELSSIKDKQQQETKDFYT
FT                   NSDDVFGRF"
FT   CDS             152909..155776
FT                   /transl_table=11
FT                   /locus_tag="CPT_0172"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG4"
FT                   /protein_id="CBJ93981.1"
FT                   /translation="MDSTDNSKATSIETNQYIKNPKYTTKEAIDKFVNLLILGRYTEKD
FT                   LSDALNYCLIRSTESFDSIDSIKEAIEELKKDSEAFKIFIDNTNKLLDAIQDINKEQTA
FT                   EIDKINEFLKTAVTLDTEQTITGTKTFNKIYVSDPTENKQAANAQYVMDYVRNQLSLTI
FT                   GDLNNLKTESKDLIVNAINEVLDNLNIYKETINETTINQMIDTKLNPLIERITTIESTA
FT                   DYTKELAEANKQAIEDLNTKVVDNTSDITDINRRLEEAVFYSKIDDTRKTIQLKNYDSI
FT                   SGVSTTGAGINIAMVSKWDKVDLGSTQIPINLNGSGTRPTYNDSNEIALIDDVNLKANS
FT                   NDVYNKTEIDSKLDTKADSNSVYNKEDSDARFVSLTEDQSIEGNKTIEGIWEYNGVLSK
FT                   PKQLATTEYVMNYAKTYANQKVGDLASLKTEAKDTAVSAINELFDKIGSGSADSKQLIH
FT                   KEYLDKNITDNVAYNISNTPLIPYTDVSSLNNKKISIRISATTNNSSYSSGDTVVVSNF
FT                   KIKLKGDDEYLKPYGVEVIDRENNKIGLNLIGDDTVYNDNDALLSTRPSDFNSSSVDLS
FT                   SGSNALVTVKTNGAYDYSGVYDIPNPFREYNKKYSLFLSNDGLKNPYYQVDINSSKQVD
FT                   NISFQLFGTSATNPFLYSKDCKIELFIENTIVKTFNIKGSSGNNSPVNINIDYKDGMFL
FT                   ISVLDSINYINNRINKNAELLTGSGKPNFSLNPNKIGSLYSDTTNKAVYMCIDNTSGAN
FT                   KWVNIVTGDEIKPNLRKIEITCNVRLRSGQYGGCMSGVKIGFDNGYASTKQIVKGLNSG
FT                   QILLSLDGLGNLSGYSEVSSLTPSSQDIKVDVDTTGIYNDPSYHCVTNIFKEYLGNADQ
FT                   CSLWSDASVKQLKIILLSEKIPNKILYVGDGYYGQTSVSDVKAIWYYVNDNGDKIEGSI
FT                   DNDLEISNNNSETNDSSYIYAFNIN"
FT   misc_feature    153545..153592
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /inference="protein motif:Prosite:PS00038"
FT   CDS             155795..155923
FT                   /transl_table=11
FT                   /locus_tag="CPT_0173"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG5"
FT                   /protein_id="CBJ93982.1"
FT                   /translation="MIVPTKDFLKDIIWKHHYYFLIHFIKENRDIYIVFIIINKVR"
FT   CDS             156076..157446
FT                   /transl_table=11
FT                   /locus_tag="CPT_0174"
FT                   /product="Possible phage tail sheath completion protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG6"
FT                   /protein_id="CBJ93983.1"
FT                   /translation="MAFFHFNTLRKYTGALIHLFSNLEIQTIQSNGKPLYSIVPIQYAN
FT                   RERFDIYSQLSYNQMFNGNTQVLPRGILLFTGMNANINRAKNKFAKIYRKSQIIKGETK
FT                   KLNYQFNSVPYDFTYQVIIQCRGMNEASMILEQVTSYFNPSYCLRIKEVDLPDFGDTSC
FT                   ILELNSTSVDQESMDELSTNIVTCTFDLTLRGNIYPAIKEHHLIELVQLFMSTDLPEST
FT                   EVNPVVTRAYSEGSKETESGIQTFINQYKAVIKDIEFNQDYLLCKIDSECEKLIKFRFN
FT                   WWINDIKQDSEIEKLHYVPRDGDIVKVQAFTDIVESDIFEKEFYSDEPRYDLIINDLIR
FT                   DKEFLECDFTDSNTSNIKYTFEWFINGKKLDLTQRIIKYKSKVSFDCECIIRSSDGREA
FT                   KYFKHFHNNEMIFKDSFKVKDSMKLELKTDLKSIAIGYNDSVNFDTNNDSNDNSNGN"
FT   CDS             157455..158207
FT                   /transl_table=11
FT                   /locus_tag="CPT_0175"
FT                   /product="Possible phage tail tube protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG7"
FT                   /protein_id="CBJ93984.1"
FT                   /translation="MGTFSFSLSDIKKQLGPGLGVRSNAYLLEVAVVGAVSKKLAVLCQ
FT                   STALPERNIGTTDIFYKGRKYKMRGETDLSGTYTINITDDSEMKLRRMFDSWMREVDNT
FT                   TPKGTNALAGLFGGAMGDLMEVANGTLKAVNEIKSAWEFDGGVSWLKNMIMGKPLPANY
FT                   QTTVNIWQLTKVKEKLYGYALTNAFPIEVGAVEVSDENENQLSMFSVTFAYSDFEPIED
FT                   KGIIGQIVDTVIGQEGQEIAQGVENLLD"
FT   CDS             158389..158895
FT                   /transl_table=11
FT                   /locus_tag="CPT_0176"
FT                   /product="hypothetical phage protein"
FT                   /note="note topoisomerase subunit domain"
FT                   /db_xref="GOA:D5GVG8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG8"
FT                   /protein_id="CBJ93985.1"
FT                   /translation="MDISIKEIQPSSEQLRQYKAQRITQRKRIIKGGFEHVLVTSDSDL
FT                   DGIHIGALLMGFIERFRPEYKGRFGRFNTPVKMVLKGETPIKWTYDITEELPVKSGENA
FT                   KYFKGLGSWQKELLDFVIKKDGLENMIDVYDFDNINIINDFLGSEESDKRKNYIRNHSF
FT                   SIASL"
FT   misc_feature    158479..158529
FT                   /note="FPrintScan hit to PR00418, TPI2FAMILY, score
FT                   1.2e-06"
FT                   /inference="protein motif:FPrintScan:PR00418"
FT   misc_feature    158488..158871
FT                   /note="superfamily hit to SSF56719, Type II DNA
FT                   topoisomerase, score 1.5e-09"
FT                   /inference="protein motif:superfamily:SSF56719"
FT   misc_feature    158533..158586
FT                   /note="FPrintScan hit to PR00418, TPI2FAMILY, score
FT                   1.2e-06"
FT                   /inference="protein motif:FPrintScan:PR00418"
FT   misc_feature    158698..158748
FT                   /note="FPrintScan hit to PR00418, TPI2FAMILY, score
FT                   1.2e-06"
FT                   /inference="protein motif:FPrintScan:PR00418"
FT   CDS             159076..159996
FT                   /transl_table=11
FT                   /locus_tag="CPT_0177"
FT                   /product="Probable phage ssDNA binding protein"
FT                   /db_xref="GOA:D5GVG9"
FT                   /db_xref="InterPro:IPR012339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVG9"
FT                   /protein_id="CBJ93986.1"
FT                   /translation="MDINFDWNSMNAGANPFESKSYESDTRFYTLAKDENGNGAALIRF
FT                   LPSEVHENGSMSTIMKVFKYNVRSKTSKRFIAEWSPSTIGLPDPIQEKWAALWNSGQKD
FT                   EARRYARSTRYIANIKVIKDPKNPANEGKIFLFDMSQTLGEKIKSILTPNEQELALGAV
FT                   AKNLFDPIKGFNFKLIATKGANGFTEYSKSDAEANPSAIYNSVEEAVADIKNNAYKLSD
FT                   WQKPESYKSYEALKELLDGLDTPVESNNLDSMVQAAPVTSFAETEAPKAPQGTLSVATP
FT                   KTEAPKAPSANQADNLDELMADLLK"
FT   CDS             160037..160309
FT                   /transl_table=11
FT                   /locus_tag="CPT_0178"
FT                   /product="hypothetical phage protein"
FT                   /note="note chaperonin domains"
FT                   /db_xref="GOA:D5GVH0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH0"
FT                   /protein_id="CBJ93987.1"
FT                   /translation="MIDIENFKPLQDFVLIKTEPVKFETESGIITKIQKSNLYDRPTKG
FT                   VVIKQGPKCQYDLVNKTVQWDITKGQDIEENYILLTEDSILGIIE"
FT   misc_feature    160043..160306
FT                   /note="superfamily hit to SSF50129, GroES-like, score
FT                   1.4e-08"
FT                   /inference="protein motif:superfamily:SSF50129"
FT   misc_feature    160052..160303
FT                   /note="HMMPfam hit to PF00166, Chaperonin 10 Kd
FT                   subunit,score 0.00036"
FT                   /inference="protein motif:PFAM:PF00166"
FT   misc_feature    160055..160102
FT                   /note="FPrintScan hit to PR00297, CHAPERONIN10, score
FT                   1.1e-07"
FT                   /inference="protein motif:FPrintScan:PR00297"
FT   misc_feature    160130..160195
FT                   /note="FPrintScan hit to PR00297, CHAPERONIN10, score
FT                   1.1e-07"
FT                   /inference="protein motif:FPrintScan:PR00297"
FT   misc_feature    160262..160303
FT                   /note="FPrintScan hit to PR00297, CHAPERONIN10, score
FT                   1.1e-07"
FT                   /inference="protein motif:FPrintScan:PR00297"
FT   CDS             160309..160770
FT                   /transl_table=11
FT                   /locus_tag="CPT_0179"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH1"
FT                   /protein_id="CBJ93988.1"
FT                   /translation="MRAQLFELHQELNNDDNTSSDIMLLHCDMFPYTGKNIINLHIQEQ
FT                   TMINVAAGIAYTGKPVIIYGVLGFVFLKALEQIKFSILDFSAKYAPIIMCNAGYTGCYE
FT                   MFGKGHIFNEELDLCRIYNIDFFVPNKENFKDLIKDCLKTNGFKYILIY"
FT   misc_feature    160456..160524
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0185 by TMHMM2.0 at aa 50-72"
FT   CDS             160932..162536
FT                   /transl_table=11
FT                   /locus_tag="CPT_0180"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH2"
FT                   /protein_id="CBJ93989.1"
FT                   /translation="MKELTASWLSRRFTDNDFRSVLKNVVLKDGIGKGVKRPNNATNFV
FT                   DTKTGELIEPTKIREFIKAMNVEVQTRNNFYKGNTTYQNVSQVTQSGILQGSVVSNTPY
FT                   TAMQVVLESFVGDGIVNFGTAVQADFNQVKLNQKSLFLAHGNYFARLEFTASAIVNISG
FT                   GVRLTYNQSQLWYDQGRSKVNINYDALTKILALKDFTDVEVGIADFSSKKIKWFNNVKL
FT                   KASTLKFTVSQNTENANKTVQKRIVSGYLDFTIDQTIEDAISEKLRGALITAARFNKFK
FT                   QLLNKAEVACLCDCNYCTCDCNYCTCDCNYCTCNCNYCTCDCNYCTCDCNYCTCNNNKE
FT                   YTDSVNYWNGVVCTCNANITCQTQGPGYTPVYENKYMTECSCQGDKSVPQYNQYGQIYG
FT                   YACRCNANWINSVRQHATVTQVCSCNVDKQWTKNITGKPIWDKKSTGQIDNIVNNNTSN
FT                   SQVSTTVRVCVCDTNVTIAAKCATNRTMAYVDGSTGNQGGYRCVCDINTNRQVACSANR
FT                   EYKYVTDYTQFQNKKYN"
FT   repeat_region   161808..161828
FT                   /note="Repetitive region x.1"
FT   repeat_region   161829..161849
FT                   /note="Repetitive region x.2"
FT   repeat_region   161850..161870
FT                   /note="Repetitive region x.3"
FT   repeat_region   161871..161891
FT                   /note="Repetitive region x.4"
FT   repeat_region   161892..161912
FT                   /note="Repetitive region x.5"
FT   repeat_region   161913..161933
FT                   /note="Repetitive region x.6"
FT   CDS             162697..163782
FT                   /transl_table=11
FT                   /locus_tag="CPT_0181"
FT                   /product="Probable phage RNA ligase"
FT                   /EC_number="6.5.1.3"
FT                   /db_xref="GOA:D5GVH3"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH3"
FT                   /protein_id="CBJ93990.1"
FT                   /translation="MNYLELKNMAENLKDSNYRSTKLNNFKFYTYIFSDYKNFKENNTF
FT                   FIRGLMIDSKSILNKDTLAPGISIPMPKFFNINENEDWLLPDSTNLEDFTIVTKYDGSL
FT                   MIPYEYDGIKFRTKMSIDNDQTKLANKYIKNNPDILDLIKNNPDTQYFFELISPLNRIV
FT                   VDYNKTELKLIAELDLRTLEFKIHETNEFNFKDLNIKTLKDLKDYINTISNYEGVILQH
FT                   KVTKKVYKLKTQEYLDLHNTMTNLDLKVIYKMILEETIDDVLPKLSPEAVAYIDSVSNS
FT                   VKVKLNEILDSIDSNYIKTKDLETPALYIKDLNIDPIAKDCLFKLCKNKLNLDDVLNQV
FT                   KKSMLKYNKLRDIKVFLKWIH"
FT   CDS             163869..164282
FT                   /transl_table=11
FT                   /locus_tag="CPT_0182"
FT                   /product="hypothetical phage protein"
FT                   /note="note purine phosphoribosyltransferase domain"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH4"
FT                   /protein_id="CBJ93991.1"
FT                   /translation="MSTIKLTWNDIHQALHNLTNEVDLKNFDCILTPNRGGLIITGMLQ
FT                   YTQRVKLPVYVINNSDVINIQNHKKILFLDDINDTSKTIFKIQKVFNGLITFKTLFERY
FT                   NSPFKTETINIIMSDAWLIFPWDVEPEVLNLRK"
FT   misc_feature    163869..164138
FT                   /note="superfamily hit to SSF53271, PRTase-like, score
FT                   2.4e-05"
FT                   /inference="protein motif:superfamily:SSF53271"
FT   CDS             164292..164642
FT                   /transl_table=11
FT                   /locus_tag="CPT_0183"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH5"
FT                   /protein_id="CBJ93992.1"
FT                   /translation="MIKTLVPKIIRNSKVYRLLKNIIKFRDELTIWGPYEPIFDLKLIY
FT                   KMLKIKREYWLNDCGGAVYEGAEKELDTLNRLLNELDLVFKYSNGGDEQTAMIHFDIFM
FT                   ETYKKNAFKLWC"
FT   CDS             164742..165911
FT                   /transl_table=11
FT                   /locus_tag="CPT_0184"
FT                   /product="hypothetical phage protein (Radical SAM family)"
FT                   /db_xref="GOA:D5GVH6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH6"
FT                   /protein_id="CBJ93993.1"
FT                   /translation="MEYLPKTQGPKKLYNFDINMTQACTLRCTYCIQDFNKQKFEKLSP
FT                   ELTKKMIEKFDFLLNSVEFNKHYDGIRISFWGGEPTTNLEGVKEFVEYYRHNPRVCFFM
FT                   YSNGYKYNHVFDYLETFKYMPNVGSEPKFLTQISYDGMASHDSDRLNLQGKGSAQQVKE
FT                   TVFELAKRNIPFIVHPTIAAKNFDKIAINYFEFKRMSDVLGIELNYNPTIDYMSKYDFT
FT                   KEQLEALTNTLKEEFLKIRDAEVEFFKRKGYFNFGWMNPNRSICTAGDGYSGIELDGKM
FT                   YACHGVFSEEYKPNNVLNDINFENVKFTDTLIKSSQDHRKILNENMPKACQECFTHYCL
FT                   KCNSTKFGISNKETYAERWTDYSCQPGLCYMFKFIGKYRIALMKYIQAS"
FT   misc_feature    164793..165329
FT                   /note="HMMPfam hit to PF04055, Radical SAM
FT                   superfamily,score 2e-05"
FT                   /inference="protein motif:PFAM:PF04055"
FT   CDS             166007..169486
FT                   /transl_table=11
FT                   /locus_tag="CPT_0185"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH7"
FT                   /protein_id="CBJ93994.1"
FT                   /translation="MLRSKINIQKVGFILGIIKSTARGIRGTYRAGKNVVNSVNSAYNS
FT                   AVSGINKVNSALDPMNTVRSATQRLNNWIDSSSKVSKTTQKNNDSIVNELNNVGNEVIS
FT                   AAKALDPMNARKLTEISESLKNLSKQISDIKKGLIDNQDTEIRHQGFDKKVQNVSESKV
FT                   NAPQNKSFFDKLLGWLGGLLGVSAGALLPLLGSLGSFLTKPLDFILDLLKGGINKLWTL
FT                   FEPLLGPIIDPLKNGFDFLKNKWNSLVDFINNKINIGDKWKISDNDNPKNPKSPKVSSS
FT                   NPAKEQSWLSKKWDSFKGAVQNGYDWSSRKIDDLKSYASKKYQDIKNSKVGKIISAGYD
FT                   KLKAAQKYIVEKAIEGFDAVKNMVSSAWDSAVKAAQKGFNMLKKFALAPMEKFVGSVGK
FT                   KLFGGSKLFSILPSILGNLEKIGARLAASGAKIASKALPGVGFAVGIYQAWDFFTRGRW
FT                   VLGSIAALSACISLLPGIGGIISMCLDLGLFAADIITSPEDVDSLNKEQNDLVNVVNKM
FT                   VQNNDTGGIPEPSQVEKDKAQSGVQDSSSSSGAKGLNAKVLDGKSANDFTALYTPHKVD
FT                   ANGTVIAAKTGSIYKGLTWEESEKYDAEKQAYFKKREEKQAQLDALFERGQKAMDSGDT
FT                   ETFNKLATQRNKLSDELSKMSLDSINTKYEAMGQARIKKLQNQGANADLSVFRTNADSV
FT                   TSSGGTDTKPDSTNASASVASQASGSITPTIQTQEAQGSSSGGSPGSKAAAEFSKKYNL
FT                   GIRSTGSCAKYVRSYLMAAGYPLSGWPVAAADYINFLPKYGFTPVQGRATQIRPEVGDI
FT                   SITQRFGNHKYGHIAIWNGSNWVSDFKQNSVSIYRDVNAFGGPDANITILRDTSGQNPS
FT                   QELVNQQLSNMNSSFKVALGGGGAKGAVYSLASGVSNVVTNTAGTAASVISSGISSAQS
FT                   FANANSISTRKSLTQMYTESGLSTSFRSSSTPSSASSSTPKETKADIKPTSKAVPKAAS
FT                   HGTPGRGQYDAETMSDFNNLVDNFSKSKSPISLPGDSKPASSVSSNVQTNNASPVTPVV
FT                   ITKNTSASSDYSWASKNSFKIARMFGLDGISDYEILNEGTESDFLQSYGISKRRAIQAA
FT                   GLNNTVQTKAASNVKTKDAVPAVNKTQINNTNIQTKTKETSNKDLTDSFVLS"
FT   misc_feature    166529..166597
FT                   /note="1 probable transmembrane helix predicted for
FT                   CPT_0191 by TMHMM2.0 at aa 175-197"
FT                   /inference="protein motif:TMHMM 2.0"
FT   misc_feature    167669..167692
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             169514..170446
FT                   /transl_table=11
FT                   /locus_tag="CPT_0186"
FT                   /product="hypothetical phage protein (possible baseplate
FT                   tail tube cap)"
FT                   /db_xref="InterPro:IPR024389"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH8"
FT                   /protein_id="CBJ93995.1"
FT                   /translation="MGLFGSVSSVISGVDLPKATKTFSASNGAEILKFTKALESDNFKH
FT                   KQIILTVYDPNDFYKKVKDAIGQKMSSLMAAGTSAFSGDGYDSSKNSQTLKDASQDIVD
FT                   MSAVNILYTIHLPLMNAFQEQNSHNYSEDTGILGSIANAANELSSTASSGIIEAYGRFG
FT                   DFGGNTDNMAFAPQLPQVDPLKWQNFKGSNLRTFQFTFKISPRNIDEASNMMRIFWLLK
FT                   RSSYPKKEAGGVLLIPPARIGVQFSNPLLHKLIAPGICVIDGVSMVYENGDDIAVTLDG
FT                   VPKKIEFTLSLKEFRQKYQDDWNFENASL"
FT   CDS             170455..170946
FT                   /transl_table=11
FT                   /locus_tag="CPT_0187"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVH9"
FT                   /protein_id="CBJ93996.1"
FT                   /translation="MYINKQLTNYLDNYSFSEANKTEAEVCNVRDYRSMDYSAITKYIN
FT                   DSNTINVKINANDFIESVSNRLYNDPNLWDLLMLINNKDALSDMPYDNDRIADMADELI
FT                   ANYFNNPEKPYQGNVTEQLITEYREYLIDLLTQKNYQNMIIKALDPVYLGDFLRLFKYK
FT                   "
FT   repeat_region   complement(170956..170994)
FT                   /note="Repetitive region 8.5c"
FT   repeat_region   complement(170995..171079)
FT                   /note="Repetitive region 8.4c"
FT   repeat_region   complement(171080..171164)
FT                   /note="Repetitive region 8.3c"
FT   repeat_region   complement(171165..171249)
FT                   /note="Repetitive region 8.2c"
FT   repeat_region   complement(171250..171334)
FT                   /note="Repetitive region 8.1c"
FT   repeat_region   171491..171587
FT                   /note="Repetitive region 9.1"
FT   repeat_region   171588..171684
FT                   /note="Repetitive region 9.2"
FT   repeat_region   171685..171781
FT                   /note="Repetitive region 9.3"
FT   repeat_region   171782..171866
FT                   /note="Repetitive region 9.4"
FT   repeat_region   171867..171963
FT                   /note="Repetitive region 9.5"
FT   repeat_region   171964..172060
FT                   /note="Repetitive region 9.6"
FT   repeat_region   172061..172157
FT                   /note="Repetitive region 9.7"
FT   repeat_region   172158..172254
FT                   /note="Repetitive region 9.8"
FT   repeat_region   172255..172351
FT                   /note="Repetitive region 9.9"
FT   repeat_region   172352..172448
FT                   /note="Repetitive region 9.10"
FT   repeat_region   172449..172545
FT                   /note="Repetitive region 9.11"
FT   repeat_region   172546..172642
FT                   /note="Repetitive region 9.12"
FT   repeat_region   172643..172739
FT                   /note="Repetitive region 9.13"
FT   repeat_region   172740..172836
FT                   /note="Repetitive region 9.14"
FT   repeat_region   172837..172933
FT                   /note="Repetitive Region 9.15"
FT   repeat_region   172934..173030
FT                   /note="Repetitive region 9.16"
FT   repeat_region   173031..173127
FT                   /note="Repetitive region 9.17"
FT   CDS             173272..173775
FT                   /transl_table=11
FT                   /locus_tag="CPT_0188"
FT                   /product="Probable phage tail completion and stabilizer
FT                   protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVI0"
FT                   /protein_id="CBJ93997.1"
FT                   /translation="MTSNSYSQSSNYKIFLPFLGDEWIYAQNIALPGFSLNPSQANFGG
FT                   KTIYVGGDHIDYDPVTVGFLVGEDFKIYTKLIKYIFDRVHPNNGNIEPLKEFTCGVEIT
FT                   DNKGESLVSMTMYGCKITNLGALQLISNADDAEQTFDLTFNFDNFELIDYFESIKLKEA
FT                   VIKS"
FT   CDS             173785..174204
FT                   /transl_table=11
FT                   /locus_tag="CPT_0189"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVI1"
FT                   /protein_id="CBJ93998.1"
FT                   /translation="MEQVLEAEIVEFDSEKAKINKAQLNPDEIIQLDLVVDDYNKLRQI
FT                   ILANVAQLKVMSDNLVQEMEIEGYNPDLVTAYSKLIETSNKSLKILTDSYKGISDILIN
FT                   INKINVLHPSTEVKEDFEVISTADVIKRIRDSKKD"
FT   CDS             174403..175596
FT                   /transl_table=11
FT                   /locus_tag="CPT_0190"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVI2"
FT                   /protein_id="CBJ93999.1"
FT                   /translation="MNVDAVELLIYDKDTKKYKNFKGSINGKKGEVPFSKIHKSNVSGI
FT                   TLKGQKSDNKDDLAECGVVYYLDMFLNTKLTDIKFYTETQVKNTRTRTPLDSVKTFLFE
FT                   NPDWDKACKDAAKCILNEIILKQNLRNYEFHHKTDVFNDLKKQGKQLTKLAEDKWNPGD
FT                   FFLVKPTYKIKKYKTYQELNKEINAFDNIIPISLKKSTKEALGGSYALNNLSGNYGLPN
FT                   FKSIKYKSFDDNFFKFFKECMVELKKHKNSDIIRVRTNNNNLAAIYSEIASNAKAANFF
FT                   EGFSPSLAFIAMSSEHFNDIIFEVVCNCLSRSPLSSNFYKVSGNHLEVFDSLPSDFKIE
FT                   YCVVSCDGNADIKWNVKIDGKLWKLQLRSKGSLPQFMLVPQPVSSSSQDKKIQAIKV"
FT   CDS             175674..176186
FT                   /transl_table=11
FT                   /locus_tag="CPT_0191"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVI3"
FT                   /protein_id="CBJ94000.1"
FT                   /translation="MAKLILQRVQECTNVRKPSKEKIEGSTLSDLILYDDNDQILWKGA
FT                   ACENAGPSTEESGTDKRITAGSYKLEWCASSKNTGLAKKYPQWYNKDRSTIAIWVKRPN
FT                   DANFNNRLIRIHIGNYPQDTEGCILPGKTRGAGIVSSSADACNELYTKIKEIGIKTVDF
FT                   IIKEIEA"
FT   CDS             176195..176509
FT                   /transl_table=11
FT                   /locus_tag="CPT_0192"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVI4"
FT                   /protein_id="CBJ94001.1"
FT                   /translation="MKGLVYKSPLKVDLDLVESYKGNIFLYDEPIKNDPEYSIQDSINL
FT                   VSKPDPVTFRESVTLDDANHFNIDFNFSESVILKDSKFDITSTTIDSDFSRESDSNTDK
FT                   "
FT   CDS             176537..177247
FT                   /transl_table=11
FT                   /locus_tag="CPT_0193"
FT                   /product="Probable phage prohead core protein precursor"
FT                   /EC_number="3.4.99.-"
FT                   /db_xref="GOA:D5GVI5"
FT                   /db_xref="InterPro:IPR005082"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVI5"
FT                   /protein_id="CBJ94002.1"
FT                   /translation="MSDKLKLLYEYHDANVLIEESVNDKKEKVKKYKIAGIFSTIGEKN
FT                   RNGRIYPKELWESNVKKYQDVIKSGSINRLCEWEHPERGTVDPMEAVAAINKLEINGKY
FT                   VMGEATLLDNPRANQLKSLIDNGIKLSVSSRGSGRVKNGIVESFDLITYDLVSAPSDYN
FT                   ATMEGTSIYESQKEFVMVDGKLVESKSSEVETKDSDSGDADTKDSNTEDSKLKESVLKE
FT                   HFLEFIEILKNKNK"
FT   CDS             177269..177475
FT                   /transl_table=11
FT                   /locus_tag="CPT_0194"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:D5GVI6"
FT                   /protein_id="CBJ94003.1"
FT                   /translation="MYDDIVMNVIQNKGLAQASNDFRAILINKFDDMPEIRSRLASIEK
FT                   YKNMRDLQISANTAYKPDPDLIS"
XX
SQ   Sequence 177534 BP; 68648 A; 21927 C; 26645 G; 60314 T; 0 other;
     atagctttaa atttcaaact acaatcagtt aattttaata tataatataa taaaacaaaa        60
     tcataaaaag atttataatg ttaagcaaag aagaaataaa atattttcaa acacataaaa       120
     atgaaataac agatgaactc ttagaaacaa ttagagctca aggaaaacta ggaaaagcac       180
     aagctttaga aatcttagat ttacctaaag actctgataa ctattactta gatgcgtata       240
     atacgagaat tagttataat gggtctcgtg gtcttaaaaa agcttacaca aaattaaact       300
     taagtccgat acatatcagc gagcttgaaa aatgtgcgaa tgatccactt tatttcttaa       360
     gaaattatgt tcgaatgact acaccaaaag gttttgattt cgtagattct aggccatacc       420
     aggatgaatt tatacaattg ctgagcgatg attctatcga aaacgtgata tcaatgcagc       480
     ctcgccaatg cattgaagca aatactaaaa taaatgtaaa tggtaatgaa actactatta       540
     tgagattatt cattaaccaa gaatctaata aaagattata ttttaatagt tctaagttta       600
     tcgaaagtta tgaatgtaaa gacaaatatg tagaaacgcc tataggtaaa gtcaaaattc       660
     tcgaagtcca taaaactatt aaatacaata tttttgagat agaaaccgaa aatggattca       720
     agttacaagc atctgaatta cacgtattaa tagacgaaaa tgataacgaa ttatatgtta       780
     gagattgttt aaataaggta attaaaacaa aatcaggacc ttctaaaata atatctaaaa       840
     catttataaa atatgatcat tgttatgatt taactttaga gcatcatcac ctttattaca       900
     ccaatggtgt tttaagtcat aattcatcta aatcaactac aacaagtgta aaactcgcgc       960
     atttatactg ttttaagaaa gatatcaaca taggcatagt tgcttacagt ggtaactcgg      1020
     cgcgagagtt cttagataaa acaaagaaaa tgttgatagg cttaccaata tggatgcagc      1080
     ccggaacagt tacttggaat aaaggttcaa tagaatgtga aaataatata aagattttaa      1140
     cagacgtacc aagttcggac gcattccgtg gaacgtccac aaatataatc gttgtagatg      1200
     aatgtgcata tttagatcct gccggatgga tagatttcac tgacggtgtt ttaccatcac      1260
     aggctggttt agctttcaaa aaattagtca ttttatctac acctaaaggt aagaatcatt      1320
     tctacgatat ttggcaaggt gctggcgaca ctttagaaac ttctattaat ggatttgtga      1380
     gacacagagt agattggaga ttagtcccaa ggttcaaatc tgatggtact aagtacgacc      1440
     ctgaagaatt caaacaacaa caaattaaaa ctggtggttt agttgtttgg aattctgcat      1500
     atgaatgtaa atttgaaggt tctgcaatga cattgatacc tagtgaaata ttagatactt      1560
     ataaaccaca agaaccaata gaagttgata atattaagga ttctaaaata ctaatatatg      1620
     aagaaccaat acccggacat aaatacgtta tgggtgttga cactgctaaa gaaggtgctg      1680
     attttacagg ggttcaaata tttgatacta cagatttaaa tttcagacaa gtagcatcag      1740
     caaaacttaa aatagattat atgttattac cagagttact caatgagtat ggtttaaggt      1800
     tcaatcaagc tttaataatt gtagaaaata atgaaggctc tggtcaagtg gttgctgata      1860
     ttctcaaaag agattatgaa tacgaaaact tatattatga cgtcaataaa caaaaacaaa      1920
     gattaaaata tcctgggttt agaactacaa aattatctag ggacgtcatt ttacaaactg      1980
     tagcaacctt agcacaagct aataaattat tattagtaga taaagaaact attaaagaat      2040
     ttggtgtatt cacattaaat gataatggta agtaccaagc agctgtagga tatcacgatg      2100
     atttagtaat gtcttgttgt ttatgttttg gtatttttac aaatgttaag aactttgaag      2160
     atatgaaaga aattgttgat tctttaaaaa gttctgaagg aaaaagtttt gagtatctaa      2220
     catttggagc ttttgcagat ggtttaggta cagagccaga ttctaacact gataataagg      2280
     atttgaatct cagtaatttg gaatattatt aaaattttgg attctaaatg aaagaatata      2340
     ttaaatataa tgatagaaaa tttattttaa cagcatataa agttaaaacc gaacgtgact      2400
     tactattaac tgcaagttca gatgatacta catacagtaa agatctaaat gatttaaatt      2460
     tagatattta cttaagaatc ttagaacctt atatagattc taatataaac atttatgatt      2520
     tatatccaga agaaaaatta tttttacttt atagattaag agcaacttca gtttctgacc      2580
     aattatcttt aaatactagg tgtgattgtg gctgcacttt caaatctaac atagatttgg      2640
     gtaaaattgg agaactacat agtattgata caaatatata tccagatttg aaagacgttt      2700
     atagcccaaa tttagccgat atatacggtg attcttactt agaatctaat attatggatt      2760
     gtgattcaga attagatacg tatttagaag ctaatactac taaatttaac tttattaaag      2820
     ttgttaaatg ttataattgt aagaaagacc ttgaaattga tttaacaaac ccagaaatat      2880
     ataaaaatat attttcagag aatcctatag gtgagttcta caaaagttta acaaggttat      2940
     catttctagg taagtttacc atagatggta ttttaaatga tttatatccg tttgaaagag      3000
     aaatctttat aagtttaata aatgatgaag tagaagaaca aaataaagca cttaaaaaat      3060
     aatcttagtc tttaagtgct tagtgcaagt tattttatat gttttttttg tctaatctac      3120
     tcttaatact ttcattgatt tcaacagtta tttcagattt taagtcattc ttgacttctg      3180
     acttaatttc agattttaca tcatccttaa tatcattctt aatattttca acaagtttag      3240
     ctaaatcttt atttttttgt ttttctttga gctgatcaat aataacttct ggttttttag      3300
     aacaaccaat taaactacca ttaagatctt gttgtggtgt tacacaattt cctgtcgata      3360
     agtataaaac accgtctaca caaacttgat taattctgga atctgaagtt ccacgaactt      3420
     ctttgcctgt tttatcgctg gaataatcag acccacaccc tattacaaac aaagctgaca      3480
     aagctacaac aaaatatttt agattcttca tataccctct tttaatatta tttatgattt      3540
     tatgcttaat agcttataaa tcttaatttt tgaattaaga tacttttaag atattttaca      3600
     atataattat tataaaggag tttaaaatga aagaattttt ttataattta atagctcaaa      3660
     tcaaaggact caaaatacat aaaaatgaaa aagatacttg gtatttaaaa tgggatttaa      3720
     acactggata ttatatagaa ggtctaaata ctaaacgcag actatattgt ggtggctatt      3780
     ctgacagttt aaacaaaata aaatatttgt attgaagctt tgtgttagtt cgaatactaa      3840
     aacgttaaga tacttttaag atattttacg atataattat cataaaggag atataatgat      3900
     caaaaaatta accgatagag aacacattct aaaaagacct agtatgtata taggtgctat      3960
     cgattctaca aatactgaag attttatcat agaatctggt aaaattaaat atactacttt      4020
     aaattacgta cctggcttaa ttaaaataat caatgagatt attgataatt cagtagatgc      4080
     tgcgattaga tctaagttta aatctggctt aaatataagt gtcaaaatat ctaatgatac      4140
     tgttagtatt gaagatgatg gaactggcat accagtaata aaatcaggcg atcactatat      4200
     gccagaacta gcttggaatc acgctaaagc aggttctaac ttcgatgatg atgctaatcg      4260
     tgtaacaata ggtaccaacg gagttggaag ttattgtaca aatgtttgga gtattaattt      4320
     taaaggtatt acagacgatg gtaaaaatag atatattttt aaatctaaaa acaatgctga      4380
     aacttatagt gaaaatatag aagcttctaa aaaatcagga actttagtag aatttaaacc      4440
     agatttagaa agatttaatc ttaaagaaat cgatgaaact cataagaata taatctatca      4500
     aagattatta aacttagcta tttgttaccc agaaattaat tttaaattta attctaagaa      4560
     aatagatttt aaatctttta agaattattt aaatatgttt agttcagatt ttgaactata      4620
     tgaaaaccaa aatattaaaa ttggtataat cccaaatgaa ttggatgact ttaaacaatt      4680
     tagttttgtt aatggtttaa aaataccaga cggtggtgtc cacatagata ctattatgag      4740
     taacgtagtt caaggtataa gagacaaatt agttaaaaaa tataaaagta ttaaacctgg      4800
     cgatattaaa aataaattaa tgattgtttg tttcattaat ggaatgccaa atcttaaatt      4860
     taattcacaa tctaaagaaa aaattacaaa ctcagtaaaa gaatttaatg atttttctaa      4920
     tatagattat aattttatca ataaaattct taaaaataaa tctattatag atcctattat      4980
     agacatatat aaagttaaag aagctttaaa tgcagataaa gcccttaaga gtgtagaaaa      5040
     atctaagaag ttaaaatctg aaaaatattt tagagcaaca aaaagtcaaa aatatctttg      5100
     tatttgtgaa ggtttttccg cttatggcgg tatatcgcaa gttcttggaa atgaacatac      5160
     gagcttctat gttcttaaag gtaaaccatt aaattcttgg gatgtcacta atcaaaaatt      5220
     tgcagccaat cgcgaattat ctgaattata tcaaatactt tccgagaacg cagaatttga      5280
     ggatttaaaa gacggcaagt tttacgagat taaaattgat ggtaaaactt atattatgaa      5340
     tgaaaatgat acaattgaaa ttaataatat taaatataat ttcgaagatc tacaaaaagg      5400
     attgtaatga gaccaatcag aatagcaatt tcaggagctc aatgttctgg taaaactaca      5460
     ttaattaatt taatgaagaa acatagttat tttaagaatt ttgatttcat agaatcattt      5520
     tctaataaaa tagctaaaac aaacaagaaa cactcagaaa atacaaactt ggtgactcag      5580
     ttacaaatgt tgtattatag tataagtgct ttaaaaagta taagcatacc tactgtacac      5640
     gataggtgca ttttagatgt tatagtatat acaggtatta acaaagacat cgatttaaga      5700
     ttattcacag attctttaat aaaatattat aaacagttcg attttatttt tgttttagat      5760
     tctgaaaata taccattaga atcaaatggt attagatcaa tagatcctga atttagatct      5820
     aaaataaaca atatttttaa gaaagtagat ttagaaaacg tcgttcactt agattctaaa      5880
     ttagatccag attctaggat attaaaaata atcgaagcta taaaatctaa aactaattaa      5940
     taggagaaat aatggatttg aatctttata tacataaaac aaatgaagat gctgtaatac      6000
     cagaaattgc ttataatgga acttcagcag catttgatat tacttgtgct gaaacaactg      6060
     aaattaaacc aggagaatca aaagtagttc caaacggact aagaatttca atcgatgaaa      6120
     aagatccttt ttatatgaca gtacatttaa gaagttcttt aggtttcaaa aaagacctaa      6180
     ttccgcatat tggtatcatt gatgctggtt atactggtga ttttggagtt aaaattaata      6240
     atattggtaa agaacctata gttattgaaa aaggatctcg ttacgcacaa gttttaattc      6300
     atagaaaata tagttttaag ttcgttgaac tcaatgatgc tgaattcaag gattttgaag      6360
     ctaagcaaga aagaggttct aaaggatttg gatcaagcgg caaatcttaa aagatttaca      6420
     cattttaata attcttaata aggatttaag tatgaataca ataaaatttt atcatagaca      6480
     aaaggaatat gtagttcaat ctcaaaatat taatcaacat acatttaata agaactataa      6540
     taaagttcta gcattattaa atgaaaatga aattaaatct attaatgaat gtgaattaat      6600
     accagctggt aaaactgata ttttaaaatt atctacaatg ggtagtgatg ggttaataca      6660
     agagtttgaa ttaagattag aaaacgttta ttaataggag atataggtgt tagactttgt      6720
     agatattaag tattttaagt tagcagttcc cgggccttat aaagaaagtt ctttggatat      6780
     tgctgttaaa tgcccaattt gtggagactc aaaatataaa aaatctgtta aaagactaca      6840
     cctatatgaa aaacaaggag ttactttagt ccattgtttt aatggtgatt gtgtgttaaa      6900
     tacgcaaatg ggtttaagta atttcttaaa gatttataaa cctgaattat tattaccata      6960
     taaatcagag aattttaaac ttaaaattaa ttcaattgat actagtaata atatagaaag      7020
     taataatgaa attgagacta tgaagtcttg ttttgattct agtgctagca atacaagtat      7080
     tgaaagcatt gctagctcta ctagcattga cagctccaac aatgggttca aatatattaa      7140
     cttgacttca gtgttagaca ctaatacaag taaacaaata gagtttttaa aatctcgtgg      7200
     gtttaacgat gatactatta actttttaga tttctataat ggaactaaat cttttaattt      7260
     aaatggtgtt tattatggaa tcaaagacta tcttgtaatt ccattttcta aagactctaa      7320
     ttattatgga ttctatgcaa gatctttaac tgaaaaaaga tttattaatt ttacattgaa      7380
     tcaaaattat ggagtttgga atctatttaa tgttgattta aataaaccag tttttatatt      7440
     tgaagctatt ctcgatgctt tgtcttttag acaaatatac agaactaatc aaataatagc      7500
     tttaaatacc tccacaatag caaagaatgt tttagattta ataaagtatc ctttcttttg      7560
     tttagataac gacaaagttg gaattgaaaa aatgataaaa tataattcaa ttcaaaatag      7620
     tcattttata tgttatccaa atgatttaac acaaaaagat tttaatgaaa tgcttcaaaa      7680
     taatattaaa atagaacttg tttttaagaa aggttttaac gctttattac atttaaaatc      7740
     tttgttatga ttttaattgt aaattaagtt ctaatatact ataattaaga aaatattaaa      7800
     aggagttcaa tgacagtaga tttaaaacac gatatttggg tagaaaaata tcgtcctcaa      7860
     aaaattgatg acttaatttt accaaatgtt tatttagata aatttagaaa atatattgaa      7920
     aaaccgtcaa acattttatt aagttcagta aacccaggaa caggaaaaac aagcacagca      7980
     caagccatta taaaagaagg taattttgaa tctttatata ttaacgcttc gttagaatct      8040
     ggtattgata ctatgagaag taaaatatta caatttgcta gtactgaaag ctttgatgga      8100
     aaacctaaaa ttgttttagc agatgaattt gactactttg gccaaaatgg tcaagcagct      8160
     gcaagagcac ttatagaaga agttgctgct aattgtagat tcatattaac gtgtaattat      8220
     gtttctaata taatgcctcc tatagttaac agatttgaag tatttgattt tgatgttgtt      8280
     cacgcttcta ataaacaaga acttgcccaa aaagctttca atttactaaa agaaatctta      8340
     gacaatgaaa aggtttctta tgtaaatgag gatcttgtca atattattaa gaactattac      8400
     ccaagtataa ggggcatgat tgcttgcttg caaaaatgta attttaataa taaattaatt      8460
     ttggatatac aaaaagattc agatttcgag ggtttgatta acttaattag atcacgtgat      8520
     tttgataatt taatgaaagt aatctatggc ttaacaaacc cagatgcttt ttatgaatac      8580
     gcatttaaaa aattagatat tcaaaactct aataaaccac aagctatcat aatactagct      8640
     aaatatcaat accaaagtgc tttctcaaga gatagaaact taaatttagc tgcttgtatt      8700
     atggaattag caccattatt ataaggatta tatatgattt tatatgattt aagttcgttg      8760
     attcacagag ctttacatac tagtattaag caaatgaatc cacacaaaaa agacggtaag      8820
     tatattactg aagaattcat aagtggaact atttttagaa ttatagaaga attattagaa      8880
     aattatagac tttatagagt caaatataat actatggtta tttgcataga cgatcatagt      8940
     gtaccatatt ggcgaaaatc tttataccca gattataaag ctcagagaaa aactcaaaga      9000
     gaagaatcag aagttaattt taaagaagtt tataaacata ttaatatact aattagaatt      9060
     ctaaatgatt atacaccatt taaagctatt ggtgtcccag gagctgaagc tgatgatatc      9120
     attggtgtat taactaggaa gttctgcaaa gcagaatcta ttttaattct aagtcccgat      9180
     aaagacttta aacaattaca taaattaggt gatataaaac aatattcagc aataaccaat      9240
     aaatgggttg ttaatgacga tccagaaggt tgggaaagaa tacattgttg tttgggtgat      9300
     gctgccgata atgtaccacg cgttgtggat ttttcggaat ttacacctga gtttaaagct      9360
     tattatcaag gaactgaatt agatttctat aagttagatg aaaacttaaa actaggtatt      9420
     attaataatt ttaatgaagt ttatcctgat gttgaagttt ataaaaaaca aagatttggt      9480
     gaagctgctt taaataaaaa gattaaagag tttgggtctt tagatgcctt tttagattct      9540
     aacgaaatat atagacttaa ttataatcgt aattataagt tagttatgga tagtgaaata      9600
     cctattgata ttgaattaga aatcttaaag aaatatacag aatctagtac agattttaat      9660
     atggaaaatc ttaataagta tttttcattt tataatataa ctacttgtag tcaatggttt      9720
     agtcaattat ggaatgaaat gagtaaacct atagaaatga caccttggaa tgtggatttt      9780
     agcaagatct aaaatccctt cataatcaca caaaaacaag gtttaaatcg attttaattt      9840
     aaaggtatat tatgatattc ttaactggtg gaaatggtta tttagctaat ttattgtgta      9900
     attatactag tcatatagat tatgttgcta ttttcgggtg tcctagcagt ataaaagata      9960
     tagattcaga cccgaagaaa ttagcttcta cattagatac tattgtttta gccaaagagt     10020
     ttaaacacaa aattattttt gcaagttcag tgggttctaa ttatcctggt ttaccaggaa     10080
     cccaaggtta ttacaatcgt tataaaaatg tcgcggagca ttatataaca aatatgtatg     10140
     ataattattt gatttataaa attccaagag tttatggccc taataaagtt aaaggtattt     10200
     ttaagacatt aaaagacgga acttatgatg gttctttaga aactaaaata gattatatta     10260
     atgaagatga tttcgttact tggtttatgg aaaacttaag ttcaaataat aaaataattg     10320
     aatataataa agattttaga agtattaaag ttaaagatct taaagattta atacttaata     10380
     atactttata tttgctataa attgtattgt agatcggaaa taaatatcca aaaaaggctc     10440
     agcagtgaac gtaagattac gtattattaa taatcagcaa gtaccagaat taccaagttt     10500
     cacagattct aaagaagaca acttaactac agatgttaaa ttagatgtct taacacacca     10560
     agaagtagat agaaactttg ctaatattat tacgtggtta aaaactgtta gtgataaaat     10620
     agtcgaacaa tcaacagttc taaaacaatt agatcctgaa aatatggaga aacttttaaa     10680
     agctgctgaa caaatacaaa caatttctga tgatatcaaa agcttagaaa ctaagtataa     10740
     ccaagttaat aatgatttaa caaattacaa aacttcaaat gatttggctt tatctaggaa     10800
     attagattca gtaaaaacta taaatggtat agatattaca ggttctggaa acgctgatat     10860
     taatataaca agaacgcaat ttacaaatca cttaactaat attggtatta atgaaattgg     10920
     cagcatagct atattagatt ctaaaacaac tttggttttt aataatttat atgcgggttc     10980
     tagcttgtcc acggatactt atgcatatat gcaaggtact tggaaatgta ctggtaaatt     11040
     aagtgataat aaaggcttat tcatcagagt atcgtaatca aaaacttaag caaaacttaa     11100
     gcatttatat aatataataa caaataagga gattcgatgg tattagaata taaccctatt     11160
     aaattaggta gtagatctat taaagttcgt aattggaaag tcaaagaccg cgagctatac     11220
     aaaggtaaat taaaaaatat cagttctgca gaagatgaac tcaaagcaag atatgaatgt     11280
     tttgttacaa atattttaga aacaccaact gctttaaata atgatgaatt agaatatttg     11340
     tttttattat taagaattat aaatcttggt gatgatttaa attatcattg gtggtgcaga     11400
     agttgcgaaa aaactactga ttctaaaatt aaattaagta aattatttac aacaaaatca     11460
     ggtaaaatcc aagatattga tattggtgat atcaaaattg aacttcaaga tgttcaaaat     11520
     gttgaactct ataataataa attaagaact tcagattcgc caagcacaga tgatttaatt     11580
     tttcatatta aatctattaa tggtgataat acaaaaggct tccaagatat taaaaactac     11640
     ttcgatgagt tagatattaa tacaatggat aagatttctg aagcattcga aaaaatgata     11700
     tttaaaattg aatctaggga acacacagta acttgttctc attgtggtgc taattcaact     11760
     tttaatttcg atgaaatacc agatattatg ccaccaaaat ggttaaaacg ttaagaaagg     11820
     attaaattat gagtatgtat ataacatata tagatcaagg cgcttataat atgattgttt     11880
     ctgctcaaag agacaatgct tttttattac cggggtctag cacattagaa gtttttgata     11940
     gtaaattatt tacagcagtt ttagaagcat tagcagataa aaaaacttgt aaattctaca     12000
     aagatgttga tgtattaact ttagaaaact tggaaattga cgagagtgct aacttagtta     12060
     agaattcgta tattttccaa ttaacttctg caatgggtca gatttttaca agaataccac     12120
     aatatactta ttttagattt cagtatctta ataatatatt tgcttcgcaa ggttatttta     12180
     taactgacga taatcgcgaa gagatgtata ttaaaattct tgaaactgat aatgataaat     12240
     taattgctag tcttgaagaa tatcttaaga ttgtaaatca actaaatcaa tatgaaaaaa     12300
     tgtatcaaga attcttaaat ggtttagatg aaatggaaat gacagatgat gaagcaactt     12360
     tagatcaaat cttacaagaa gctttaaatt attttacgaa cgctcaaaag aatttcgtaa     12420
     ctatggatta taaaggatgg ttttcaacaa ttaaagcaga ttatgaaaat cgccaaaatt     12480
     cagctcagcc ttcaaatcaa gcttctaatc aaactgctaa tagctaaaaa taaagatcta     12540
     aattatttta gatctttctt attttatgat tttaaaatac taaaatttct aaacgctaaa     12600
     ttctaaaact caaaaaactt taagttattt tattatataa tactataaag gagttatgaa     12660
     tgaataaaca aaatatgaaa gatgttttag aagctgaagc taatatcagt aagtttttag     12720
     atccttgggt gttaacaact tttgaacacc aggtattagt aagattttta actaatgaat     12780
     ttattggtgc taactttgat gaccccgaaa ccctaaaata tttagaaaac agagctaaat     12840
     tttatattga agaatttatt aaataacaag ctatatttaa cgctaagtgt taatttaaat     12900
     ataaaaacta aaacaatttc aaaaaacttt aagttatttt attatataat actataaaag     12960
     gagattaaat gattttcaaa acacgaacta aaaaagttcc attctatgaa tttttcggcg     13020
     atacaattca aggtgaagga ccaagattaa aatctgcagt atttgttaga gttgctggtt     13080
     gtaataatac ttgcaaaggt tttgggtgct ctgcagtagc tcctgatggt tcggcagtaa     13140
     caggttgtga tactattcgg gcagtatcac caaaatttaa atcacaatgg aaatactttg     13200
     ataatttcaa agacttaaca tcaattattg atccattagt tgcatttaaa aactctgaaa     13260
     ttaaacatac caaagacatc attttaactg gcggtgaacc tttattatat tggaatacta     13320
     atgttattca agatttctta gcttattaca tttcaagaaa acatcaaata acaatagaaa     13380
     ctaatgcaag tttggatatt gagttcttta aagaatatca aaaagaaatt atgttcagta     13440
     tgtcagttaa attaagttgt tcaggagaac ctaaaaagaa aagaattaat ataaaaacaa     13500
     tcagtaagat tcttgaaaat tgccctaaat cttatcttaa atttgtagtc aatccagaaa     13560
     cttgggatac agactatgct gaaataaaag aaatacttta tgatttacct atatacactg     13620
     aagtatattt aatgcctatg ggtgaaactc gtgaattgca aattaagaat acaccatttg     13680
     tgtttgaaaa atgtgctgaa cacggattta gttttagtcc aagagctcat attttagctt     13740
     ttgatactaa ggagggtatt taatgttaag taattgtgta caatataata tattagaaac     13800
     aactggttta attattatta aatttttgtt attattagtt gaattaggct tctatgtatc     13860
     ggctttattt ttagtagttc ttggtattgt tagtgtgttt aaaataccag gagtgtttta     13920
     taagttattc atttttatta ttttgggctt aatagcgttt gcttgtttaa gtttaggcta     13980
     tactataggt ttaactaata ttgaatttat atttaagatt taaggagtta atatgaactt     14040
     aataattggt tttggtgtag tcgggcaaag cttaggaaat tattttgatt ctaaaggcat     14100
     tgaatataat ataatagatc caagatttaa tgataaagat cttaatgaaa ttggtttaaa     14160
     ttgttatagc aagattttta tatgcattaa tgttttaaat gatgttgtat ctgaaggtca     14220
     agatacaaaa acattatacg aaattttaaa tactatagaa tcaaaagatt ttagaggttt     14280
     agttgttatt agatcaacat tgttacctag caatgtagat tttatagaat ctgaatacaa     14340
     tttaaaattt gtagcctggc cagaatttct aacagaagtt gaatcattga aacgagcaaa     14400
     atatcatata ataggcgcta ataatattat gtatgctaaa gaaattgctg aattaataga     14460
     tacgccttat gatttttgta gtcttagaga agcaatggaa gttaaatacg ctagaaatgc     14520
     tttaggtgct ttaaaggtat tattctttca cgaattaaat gaagctgggt tcaatgttag     14580
     aaaaatagaa ttattattaa atgagttcga agattttgat tctcaaggat tgatggctaa     14640
     gttatgtgta gatggtaaaa aaggttttgg tggcaaatgt tttcctaaag atatccaagc     14700
     attgatgttt gagtctaata aacaatctaa acaagcaggt gatttcttca gaaatatttt     14760
     agaagctaat aatcaactta gatattgttg taaaaaatca taaatatatt aaatttaaag     14820
     gtgtaaaatg aatatgaatg tacaaaatcc aaaattttct tttactgaag atcaaacaaa     14880
     acaagttctt atgacagcct atcatctaag tcaagcttca gaatatatcc aagaaactaa     14940
     cggtatgatg tctttaatgt ttaattctat ggctattgaa ttattagacc aagctggatt     15000
     atctcaagca tttttagatg aattaggata tactaaaaca actgaaccta agattcaact     15060
     taataagaaa gaacaagcag aagtagactc tttattcgat gagattttaa atgggtctaa     15120
     atctacaaca aaggtagaaa ctgaagtcaa agatttaaaa tgtgatcacg agagttgtgg     15180
     ttgtaaggat tcgaaaggaa tataatggtt caacaagaat taagaaaaat aatttttata     15240
     ttgtttgacg aacatttact ttcacaagtt gtagaaatgt tcgaaaaata cgaatatatc     15300
     atagaaaata acccagaagg tatagaaacg aaaaccgcgt atttaatttc gaaaatatac     15360
     acaactggtg ataaatctaa agttttagat tatttaaaac aattgggtga attagaagct     15420
     actgatattt ttccagatat caaaatgctc caatgtaaat tagctatgaa ttgttatgaa     15480
     aacaatttaa ttgaatatag caaattaata gcaacatttg ataaaaatga tttagattat     15540
     gctcaagtaa ataacccagt agtttacaac acaccagcat tgtacagagt ttctatcaat     15600
     ggtaaagatt ttgatgataa tattaataat atcaataaat gtctgactta tttaggtgat     15660
     aaggttgtat ttagacaaac aattgataaa gtagatagac caagttataa aaattatctt     15720
     aagattagac attctttaga acttggtgat tatgattatg ggttcgatgc tgttaaagca     15780
     ttacaagaat tattttatca agaaggttta gatgctaaaa taaactctgt taattataaa     15840
     gaacttttaa gtgattatat tataataatg gattttatga gcgctttcca attacttgga     15900
     tataagttta ccgataaacc agaatataac aaattaaagc aaatgtttaa agatattatt     15960
     atagaattaa gtgtagattc tttattaatt ttagaaactt ctcaagaaaa tgttcttaaa     16020
     acgctcgctg agactaaaaa acgtcttata aatgatgtaa aatatgatgc tagtgaagtt     16080
     gatgcttatt tgggtccaat tttacaaagg attaaagaca gtggtaaaag atttaataga     16140
     taaaaatcaa gccgaagttc agttaaaaat acaagatttg caagacatca gagtgggtat     16200
     aaaatatgct ttgcgttgtg ctaaaaagat taatttaaat tctgaatcta actcaagttt     16260
     agattcggat ttaagccaag aagaactaaa ctttttagct tgtttaactt gcttacctaa     16320
     gaccaaaact aaaaacaaag gttaaaatgg caggtaaact aatagtagaa tttagcttag     16380
     atactaaatg taacttagct tgtaaatatt gttatagtgc acatacacca ccaaacccta     16440
     tgtctataga caccgctatg aaattctttg atagaattaa ttatatgtta gattattatg     16500
     ataaagatag ctatcatatt tcatactttg gtggggaacc tttattaaac tgggaagtga     16560
     ttgaagcaac tttaccaaaa ttccaagaag atccaagatg taccagctat gttgtgataa     16620
     ctaatggtgc attattagac cctaaaaaag ttcagttctt aaaggctcat aattgtggaa     16680
     tttcactgag ttttgatggt ctatggcaaa atactaatcg accagtggtt gaaggtactt     16740
     ttgaaggaac tttagattat tttaagcaaa acaaagcatt aattcatagc attacagata     16800
     cctgtaaagt tatgatacaa cccaagaact tcacaacaat gactgaaaat tttgagtttt     16860
     ttgttaacga ttatgaattc ttaagacccg atttttgttt agttcgtgat aacatttata     16920
     ctaaaagtca aatagaaaca tttgctatag aagttgaaag attagcacat aaagtacttg     16980
     aatatcaaca taaaggaata ccagcaagtg taggattatt tgatttatat gctttagata     17040
     ttttagcagg tgctagattt ggtaaaagag accacggttg tttcgtagga aataacggtt     17100
     gtttatatgc ggtagatggc aaattctggc cttgtgagcg atacagatca actaataaaa     17160
     tggttctata tagtccagaa tctggattaa atctaaagaa tctcaagttt atgtctaaat     17220
     acgctgaccc aagaaaattc aagaaatgta tgaagtgtga aattcgtgag tattgtaatg     17280
     ttgggtgtac acatcaagaa atgagagaag ctaaattcga aggtagagaa ccaatagatt     17340
     ctgtatgtca tttatttaaa tattctttta aatgggctat gtttgttttt aagaactcta     17400
     ctaaagaata taaagattat ctgtatagaa ggcttgaagt tggatcttga tatcttttag     17460
     catctaacac tcgagtgtta tttttaaaag cctttaatca aaatttaaac aaaattagga     17520
     tataattaat tatggcaaat atattcgaac aatttacaaa ctgtcttaaa gacaaagatt     17580
     ataatgagag tttaggtttt aatagcttta tgttttgtag gttcttaggg tcaagcccta     17640
     gtactttaca attagctaat gttattaata tattatataa aagcttgcca gatgaagcac     17700
     aatataattt agtgagatac gcaaaaaata aaccaaaatt tataagattt acgaaagcat     17760
     tggctgaatc agaatctatc aaagaaatac aattaaaata taaggtaaat aaagaagtag     17820
     ctaaattata tgcaagtatt ttagattcta tacatagatc ttaatcaaag gagctatgtc     17880
     agctccaata attaaaacat tacactccat tgaattctga atgcgactgt tgattctttt     17940
     actttacctt taaaggttct catagcaatc aaatttgtgt cactatacaa accagcttcg     18000
     gtataaacta caccatcatt agcacagtta aaagcatctt gtgcgatatt aatagtataa     18060
     gttactacgg gctctgcttg ctcaatacca gtaactgtaa tatctactgt agagttatta     18120
     ttagcaccat cctgaacatt tgtggcagca gtgttaacca tattaccact tggtgtaaaa     18180
     attacttggt tccaagttct attaatatca ccttgttctt gcccactgaa aatattagta     18240
     acagacgcag taaatccagt agtttcatcc tttggtgtta aaatatcaga accttgatgt     18300
     cctttggtgc ccataacaaa tctattaata gcattacttt cattgatacc ggcaatcaat     18360
     ttagcaaatt cagctcttgc cacatttgta ataagatttt tctgttcgaa tttatcgata     18420
     acattaccat tagcatctaa actttcaata caaaaataac ctctggcggg tgttttttga     18480
     gcttctttaa aattcatatt aggcctttat gattttttga tatatttatt tagtaataaa     18540
     taaaacaaaa agtgaataca atgcaaaaag atcaaattga tatatctata ttaaatgcaa     18600
     acaaatattt gactagccaa gcaagaaaag aagcttttat ctatgataaa gttaaagtag     18660
     aagaaaaata tgacggtatt aaagtaacca tagttcatat agataaaact ggtgattata     18720
     aacaagattt tatagtttct tataaatcta atattatata tcctgatgag tttgaatacg     18780
     cagtcaaatc caaaataaga cctgaaagca ttaataattc acaatttaca tttattttcg     18840
     atattcttaa aaaatgtgac tcaaagagtt tacctttaaa ttatgaattc tttgtagaat     18900
     ttctaatgaa aaaacctaca ttacaacata agtataagaa gatgggtgca attttattag     18960
     cttatagccc ttgtacttat gaagtcaaat ttgggagatt attcacaaaa ccaaaaggtt     19020
     tttatactga ttcaagagaa acttatgcta agaaattagg atttgattac ccaagaacta     19080
     tatttgaagg taatttcgct aattttgaac gtggtatcaa atcacaagaa ctcaatgata     19140
     tttttagaac ttataaaaat attcttaaaa tagaaaacat agatttatat atacaacaaa     19200
     tatctgaaat gtttcttaaa atggaatcta agtatggtgg taaacctgag ggttatgttt     19260
     taacttatcc tggattctta ttaaaaattc aacaacctta tcaggtggat cctaaagcaa     19320
     gagcagaaac ccgttcacaa tatcaaggag atcctgatac tgaaaatgct tattgggcta     19380
     acgttagatt agcagcttta aatattattg gagctagtaa tattaaaggt tctttaaatg     19440
     aaatacttca aaggtatgga gaagctctta agaaatataa gttgaatttt acacatccta     19500
     aaaagacaca atttcaaata aaagatgata ttcaaggtaa tatcaaaatg atcgttatta     19560
     aaagacttaa aggaaataat aactttttat tcttaggcaa gtttagaatt ttaactaaag     19620
     ctcattataa tattattaaa aatggattaa aaaaatacga taatggtgca gtctgtttgg     19680
     taacttcaaa agatactaaa gaatttgaag atcttagatt agaaatgtta aaatcttgtt     19740
     ttcctgaaat tgaaattata caacatagta caggaaatat tattagtatt atgaataaat     19800
     ctaaaatgaa tataaatgct gttttatgtg gtagtgatag atataatgac tatgtaaacc     19860
     aattaagagc taacccagat attcaagttg tcgaaacgcc tagagatact ggcgctattt     19920
     ctgcaactgc agtaattgag aatctaaatt cagaaatttt ctttaaaaga aatacaccaa     19980
     gtgaaataca ttctatgtat aataaaatat taaaaagatt taaaagctta ggtttagtat     20040
     cagatttgtc taaagaacca gaaaataaat aacaaaaaat gacgggcaag gtttaaaatg     20100
     actgagttaa gattaaatgt agattctaaa gataccatag aagcgggaga ttataaatct     20160
     acccaaagag gtatgttaac attttctaaa aatgccgtgt atttaggtga tggtaacaaa     20220
     gctaataaaa ttatagatgc agaaagctta aaaaccgaaa tagaaaaagt tcaaaataat     20280
     gtaaataaca ctataactca gcaaatacaa aacgtaaata acactataac tcaagttcaa     20340
     aacgcacctg cagttcaatt tttaaacata tgtgataatg cgactgattt agccacgtta     20400
     aaatcaagtg ttacattaaa aaatgttttt gataattggg taagacattc tattatgaat     20460
     tctgctagtg gtcctaaatt agatgatgat gctggtcaag cagaagctgc taaatggtct     20520
     tacatagaag cagaagatgc tatagcaagt aatataaatt caagttatta taatatgttt     20580
     ttaagtaatg acgtcaaaga tacttatagt gtgcaaatat cagctgtagg ccaagacggt     20640
     gatgatgacg ttttaagtat tgttgtagca gctaaaatga tcaatggtaa attatataca     20700
     ttaagtgcat tgagatcttt acaattaaac gctttaccag gtggtacttc gtggggttta     20760
     ttttttaatt attgtggtaa caatgaagaa ccttatacaa cttataggtt attagcttct     20820
     aaaggtgata tcaccaataa ttatcctaaa acaacttggc gagcaggtag acatttatta     20880
     aaagtaacca gaactaaaaa tagagtacaa tgttggactt cagatctaaa caaagcacta     20940
     gataacaact cattaattga ttatacatta ccgactacaa aacctagtgt tttatcgaat     21000
     aatgaattta atgtattaaa agaattatta aattcacctt gtcaaatggg ttttggtaat     21060
     tggtctcaaa atattaaatt ttattttgat tcacaatcag gtgtgtatga tgatactata     21120
     atagatatat caaaaaatca aaaatggaca tataatagtt ctaataaaac ttgggtagcg     21180
     tctgcattag ataactcaat aataccagaa aatgttttaa ttagttctaa gaaaactaaa     21240
     aaattgtttt ataataatgg tattgaaata tcaagtttaa actaggattt aacacttgtc     21300
     aaaccattta attaaaactt tcttaaatat ggctatagcc gtatcagtag gtataatttg     21360
     ttttttaatt gatttttata tgcatcgcac attatcttgg aaaatgttta taatattttg     21420
     tataataact atatattacg atattaaatt aattcgcgat gttgttaacg aatcatcgga     21480
     tactaatata aaacataaaa tataaagact aaaaatgcaa gatttaaaac cacaagaact     21540
     aaaaacttat gaaataggag aactcatagt tctaaacaca aaaaccgcaa aagaactcag     21600
     agattctatg gtagaatcaa acccagtttg ccctttatgt ggttctaaaa ttttcaatcc     21660
     cgtacttgat cacaaacata gtaaaaaaca agaaatttta ggtgttcaag gcgccggctt     21720
     agtcagaaat gttatttgta gtacttgtaa tattttctta ggtaaaatgg aaaataatta     21780
     taaaagatat agaattcaaa acttggctga ttttttaaga aatgctgcaa attatttgga     21840
     aactgatacg acaccgtatg tatatccaag tgaagcaaaa aaattaaaag aaatttttcc     21900
     gaagtcttta tataataaac tgattaaaac aattcattta gaaactaaaa aagatattaa     21960
     ttatattaaa aagaaaatta agtacacaaa atatcttagc caaaaaacaa aagatttatt     22020
     aatatcttat gatttatatc ctggatccta aaactaaagt ttaaaagttt agaacataaa     22080
     tattaaaaaa aggttaataa tggggttatt agaaagtata aaaaatagta ttataggtga     22140
     aaaaatagat agaccattct tagaacaacc tattaataaa atagatacta cagttccatt     22200
     cggcagagta ataaacactt tatctgatga tgaaccttta agattccaaa ccttttttga     22260
     taatgtaaat gacataactt atgtcgataa tctacaaaaa gcatcagaac aagctcaaaa     22320
     aattgatatc tacagacaaa ctgctaagat tgctgaatgt tggagtggtt taacagaaat     22380
     tgtagacgaa gtcgcatatt gtagagattt caaagatcct attaaattag aagttgatac     22440
     ttcgaataag aaaatagaca tagcaatatc taatgctttt gaaaaaataa tgaaattatt     22500
     tggaacccaa aaatatctac attcttttat cagacaatct tatatagatg gccaaatgaa     22560
     tatattaatt aaatatcacg atgataagaa aaaaggtata aaagaattat attatttaga     22620
     tcctagatat ctttggtatg atttgacgga ttctaaatac aaatacatag atataaattc     22680
     ttcagtagct cttaaaaaca atttcttagg aaatcaaagg tatatcaata tcaatggtaa     22740
     aactccagtt cgaatagatc aagctgcttt agaatacgat atagaagaaa tagttcatca     22800
     aaattttggt ttgttttcag attctggtat ttgtttaagt gaattagaag cttctgttaa     22860
     aacagctaat caattaaaaa cacttgaaga tttgttaata cctttaagat tttcaagatc     22920
     aatttcaagg cgtgtattta atatagattt aagtgaatta cctaattcta aagcagaagc     22980
     ttatatgagg gatttgacta ataagttcaa atacaaaaaa caatacaatc cagaaactgg     23040
     tgaggtaacc aataatcaac acattgtcac tatggtagaa gattattgga ttggtaataa     23100
     agctggcgct aaaggtatgc aggtagatat cttggatgaa actggtaact taggagaact     23160
     tggtgatatt atgttcttct acaagttatt atatagatct atgggaatac cagttaatag     23220
     aatctactta gatgaccaat cacaacaacc attatttgat ttgcaagcag atgctatcac     23280
     aaacgaagac atcaaattct tccaaaaaat aactaggatt cgccaagtat acactgaatt     23340
     ctttatgcaa attctaaaaa gagaattaat ttgtactaaa gtttgtactg aaaaacaatt     23400
     tcaagaactt aaagattcta ttaatatata ctttagtgaa gaaaatcaat ttatcgaaag     23460
     aatgaattta acattgttta tgaaacgtgt agatgcattc tcaacagcta aagattttgg     23520
     aggaacagtt ttacctgtag atacattata taaagaaatt tttagattta atgatgttga     23580
     aatcaaaaag aatcttaaag ctattcaaaa agaatctaag aacccattat acaaacaatt     23640
     ttatagagat tttgaaagtg gtgatgaatt tagctcagat tcagattatg actcagattc     23700
     tggtgatgaa cctaaatacg acgattctaa taacaatgtt aataatacag atacagaaga     23760
     agaatatgat aagacaggtt tatctattaa aaaagactca ttaatttaaa acttttgaac     23820
     ttcagaaact tttaagctat tttatgttat aattatttca ttaaaagata aaggagccat     23880
     aatgaataaa atagctaaag accctaacaa ctatgcacac aatgttatga acgatttaat     23940
     agatcgcgtt agaaatgaaa aattaatatt tacattcaat ggtaaaaaat attttttaga     24000
     tcacgtagat tcttatcaac acggtgaaga ttttggtcta ttctttagag ggttggattc     24060
     agaatcagat cgatgttgta tggaagtact tggttgtgaa ctttttatat tcaataagaa     24120
     agattatata aatttagatt catttgaagt ttatgaaggc tggctatcat tttaggtttt     24180
     aaattataat attaaaggag tttaaatgaa attaatagat ggttattatg tagattctaa     24240
     taacaataaa tggagtgctt ctaggtatac agaagagcaa gctataaaag tttcagaatc     24300
     tttggtgaac tgtaaaaatt gtattaattg ttcaaactgt aaaaattgct ttgattgtga     24360
     agactgtatt aattgttcaa actgcaaaaa ctgtattaaa tgtgaagatt gtgttggatg     24420
     caagaattgt gtaaaatgtt tagattgtga aagttgcgat tattgttata attgcgttat     24480
     atgtgaaaac tgtggagaat gtgaagactg cgatcattgc aacaattgtg atgattgttt     24540
     tggttgttat gggattctaa aacaagaaaa tgtataattt aataattttt taagttcaat     24600
     tatattataa ttatcaaaag gagataaaat gcaaattata acagattttt taaatgaatt     24660
     aaatgcttca aatagttcta attataaatt agaagttctt aaaaaatata ataatgaaat     24720
     cattaaagaa tttctttcat tagtttatga taaagtcaaa tattcttacg gaattaaaaa     24780
     agtaccagaa ttccaaaata acaatgaaac catagatttc aatgtaatta aaaatacgtt     24840
     catagcgttg cataaccgcg attttacagg gaataaagca attagtgttg ttcagtcatt     24900
     acttaataat aaaacaccag aaataaccag gattattact tgtattttag atagagatat     24960
     tcattctgga atttcaacta aacaaatcaa caaagttcat aaaaaactta taacagaatt     25020
     tccatatatg cgttgttcat taatggataa atttaagaat attagatttc cagcaatgat     25080
     tcaaataaaa gcggatggga cttatagaac ttttattaaa aaaggtgata gtgttcaagc     25140
     attttcaaga tctggtgaaa gttatgatca tcctaaagta tattcagcat tattgaatct     25200
     gccagatggt gcttatattg gtgaattaat ttgtaatgaa gttgaaggta ctaattcaac     25260
     tgaaatcaga tataaatcta atggtttact taatagttta acaccacctg aaaatgtaac     25320
     tttttatatg tgggattatt tgactttaga agaatttgaa aatggaaata gtaaaacacc     25380
     atataaagaa agatttgagt ttgtttggag attaactgaa tctttagaat ctaatacatt     25440
     aactgttgtt agaaccagag ttattgataa tatagaagct gctaatgagt atttaaatac     25500
     ttggttaaaa gaaggtgaag aaggtgctat attaaaaaat tgtgacgctg tatttaagaa     25560
     tggtactagt acagaacaaa taaaattaaa accagaaata gaagttgaag ttcgttgcat     25620
     tgattttaca gaaggtaatg gtaagtttaa ggatactttt ggtgctattg tttttaaaac     25680
     agatgatgaa ttaattcaag gtaaagtttc tgggattagt gatactgaaa gagttgaaat     25740
     atttaaaaat agttctaagt atttaaataa agtttttaca gttaaagcaa cagcattgac     25800
     aaaatctgaa gattctgaaa tatatgcttt aatgcatcca agatttaatg gatttagaga     25860
     agataaagat tatacagata ctttagatag agttaaaaat atgggattaa aattttaaga     25920
     aatcaattta gaattcaact aggcaattca ctagctgctt gaattctaaa tacaacttct     25980
     tcaattaaat atttaggttt ataataaaca tctacataaa tgttattatc ctgagtagga     26040
     ttattagaaa tatcacaaac tattttaaaa tcttctatat tattatctgc aacataactt     26100
     ctgcaaattt cttttatttt tgaagctaaa tcatttcttg tatattcatt attattttca     26160
     aatacataat ataatgcaac gttttcacat tctcgaacta aattgaaata tattattcta     26220
     tttgttaatt tagatccttt taaggtattt tcacttaaag cgtatatacc ggaatatcct     26280
     tttttaacaa tattaatatt taaatcatat aaatctttta tttgagattc cgttagatat     26340
     atatccaaat ctattgtatt taagaaacta taaattgttt tgcagtgaga tactgataat     26400
     tcttgagaat taattaatct ggttcttaaa ccaacaatat ctcctataca attaacatat     26460
     atattttgat tattaaatgg atttaattgt aatttagaac catagtaaac aacagcattg     26520
     tttgaaattt gtagttgttt aatatattct tctggtttaa tacctctagg tatacctatg     26580
     aaagcacaac aatcaccacg agtatctgct aaattgatag cagaatttgg actttgtgta     26640
     ttagcaatta taaaatcaaa cacataatca ttagattcac caacactttt atatgtttca     26700
     tctatttggg ttgtacttgg caaacttgca tacccgttac ttaatttaag actattagaa     26760
     ccataaaaaa ctgttttatc tgagttaggt tcatttccat cagctaaacg atttaagccg     26820
     tctacatagt tgatattgcc gtcatataac ttgtattttt taggatcgaa aataatgaat     26880
     atataattag aattttcatt aatagtatct accatatcct cagattcttt taagatatat     26940
     ttttccatta atgtatcttt taagaacaca caaatacaat attgatttga actcattgaa     27000
     ttttgaatat cttttgctaa ataattgctg tgtattagca tattattaag aacttcatat     27060
     tgtgtaaaaa tacaaactgt taaatcattt ccccactctc ctgggtttct agcaatgatt     27120
     cttaagaaat tattttcaga aattatgggt ttatttctaa aatcatctaa gttatctatt     27180
     ctaacatcaa agtcattaaa tggatagcta atacttgcgt taactgaatt ttcaccgata     27240
     gatctcgaaa taactatttc attattatca tataaaaaat aattataaat ttgaaaccag     27300
     tcatttatat tatttttgtt tggtttacca aattttgttt taaaatctaa tatagaataa     27360
     acgggtgtta aagtgtctgg tgaaccttta tcgaaatatc cagcatagaa tactcttctt     27420
     ggttgtgaat aatttgatgt tgaactggta tcactatcaa taaatctaac acttggaact     27480
     ggcactataa atccttcata caaaaatata tgatttttaa attctataga aatctacaag     27540
     aatttaatca aatattacaa agtaatattc attttttgta tcttgagaag tctattcttc     27600
     tcaaagatat gggataacca taaatcccca catattttgg ctatattgac agctgaattt     27660
     atatctctat caactttgaa acctggactt aattctacct ctctgatact gagattcgag     27720
     tctagctctc tttttcctgt aaggcagtta gtctgagaag tatatgcttc attcacaagt     27780
     aaaaagttca atcctttatt ctctgcttta tactttaaga aacccttaaa tctactcaat     27840
     agtccttcat tttgggttga tttgtttaaa cttgttttat agtctttctt taatttttta     27900
     gtcttgatat ctccacaaat gatgttatct ataccattaa gaatacagag atctactaca     27960
     gtctttgagg ccttatgaag atagtctttt cttttattag ttagttttgc ttgctttctt     28020
     ctgattgttt tgttaagttt cttatatgct cttgagtctt ttttcttctt atctctttta     28080
     gacttcagct catttatagt tctttctaga cctttaaatc tcttagtttg tatcttcaag     28140
     caatcaatct tgtttgagta acaagatgct atactgctta ttcctagatc tatggaaaga     28200
     aaattttgat ttggtgcttt ttcttgtttt ttctctgaga aaacaaaaat acaatctatt     28260
     ctcttattct catcgatctt gatgactatc tgttttaaag tctcatagtt gataagttct     28320
     atatcatagt aagggcattt acttaaatct aattcaaatc ctattgaagt aaagtttatt     28380
     ttcttacctt ctagtttaaa tcctccacct ggatagtatt tcttttcgag aatcgcttct     28440
     ccagttctag agttaacaat ctcctccgtc ttagaggaaa gatttgcgac cataatgata     28500
     ggactatatt ctctatgtaa ttttggaaat ctagcagact tatcgttctt ctttttcact     28560
     agataagatt ttacagcatt tataacctct ctagaggtat tctgtatatg ttttgaatgc     28620
     aagcctgttg cttttgatcc accttttgtg attttagata gatctttaaa attcaaattt     28680
     tctttaagaa gatctagaca ttcgttgtag atagcagaaa gagatttaga atattgatat     28740
     atttcttctt tttctttatc agagataaag ttatcaattc ttatctttct agacaacatt     28800
     ctaaactcct ttctttatat ctatttatat ttctcttcta tggcccgatt cgagtaaaat     28860
     aggttttagt ttatttgttt tatcccaatt tcttaaggtt gtcctagtaa cacctataat     28920
     tctagaaaat tctccaatac tatacattta aatccttttt aagaaaactt ataatataat     28980
     tatagatatt tatatattct tataatattt catagatggc atagaatata aaatgaatgt     29040
     aactactaaa agcagtatta acaaatctac tattattaat tgttcatatt cttggtcatt     29100
     atgtgttaac atattttata ctttagtgtt tactaagcca actagttcag attctttaga     29160
     ttctaaagct atacctataa aatatttttc ttcttttttg cttggattta cacaagcata     29220
     accgtcatac tcagcgtata attcatcacc agctcttaca gaacctttaa caattacagg     29280
     tgtttggccc tttaaagcta ttaacacacc tttacaatct ttattaagaa taaaccctgg     29340
     tttatctgaa acgacaccta aaggtctatt atgtttatag atatcgaaat attcaatttc     29400
     tgaattttca ttaatgccta gaacagcgcc aacttcaaac tctttgccgg tttcatagac     29460
     ctcagctaag tcagcgtatt ttgcttttaa agcagttcct ataaaatctt gagcatacat     29520
     agctttaaat tgttgggttg ttgagccaat tgtagatact aagtttaatc ctggtaataa     29580
     tccagcttct gtggttaacc aagcttcttt tttacttttg cgagtttgta attgcttaga     29640
     tttagaatcg acaaatacat aatctgccaa taaatcatct atattagtaa tactttgttt     29700
     tacttcatct attaaattat ctacgtattt tttagtcgtg acatgagtag gtttagatat     29760
     ttctaaatct attttattat cttgtttgat gtagatacct gctagataac catctaagaa     29820
     atctttgaat tgttctaaag cccatttaag atactttaag ttaataacat cgtaatcatc     29880
     gataataggc caatctttat cattgtctgt tttagtaggg taattatcta cgtctaacca     29940
     aggatataat tcatttaaag tgactttttt ccacatatca gagttagtat ctgggtaata     30000
     tccttgattt tcaatatcgc taggtaatgc taaataatat gaatttttaa tagtttctat     30060
     atctggatta tcttctgtta tataagaaac aatttcacct gcttcataaa ttatgctagc     30120
     atcccatctg atagattctt ttgaagtcaa tattttaaat tgaccgatta attgattaac     30180
     ctctcttttg agtttattaa ccgacttgtt tagtgcgtct gcgctagctc tttggttatc     30240
     cataatatta aattcttgaa cgaactctct aaaactagtt aagttaaaat tgtagccttg     30300
     gtatctaaaa tcagacatta aatctcctgc ttatattttt agtatttatt tttgatcaga     30360
     ggcttaaatg atttaaatag attaattagt ctttaaggtt attgtataag tttcgaagct     30420
     tgaagtttct actcctgtaa aattataatt aatacttaat ataaccctgt tgaattctgg     30480
     ttgtgaataa atgtctacac tttgaacttt gattctaggt tcgtaaactt ttagacatct     30540
     tgtaatttcg gtttgcatac tattaatagt aatatggtca atcatttcaa acaaataagc     30600
     atataaatta caaccaaatt ctggtttacc agctaaggaa ccttttctag tagttaatat     30660
     gttaaaaata ctttgttcta tagcttgttt atctataact acattattta aagaatcgtt     30720
     atgaaaatct ttataagttg ccatttatat acctatcgta ttattttaag gcataagtcg     30780
     atattaaatc gacttgttag ccttgtccag cgcctgcagc agcttcagtt acttcaacac     30840
     ttaatttaac aactttttca gaaccacctt gagctgtagc ttttacagta atttcagaag     30900
     ttcctttagt tgcagcagtt atagtgaatt taccagaacc ttttttgaca gtagcatttg     30960
     tgttgttcga ttcaactgtg aaatcgctag catttgtagt tacggtgata tctttagttt     31020
     gacccttttc aatagtttgt ttagttgcag ggtttaaaga taaagtagtt tccactgatg     31080
     gagcactcac ttcattatct gctaagtttg cttcagttct ttcagctata atagctttaa     31140
     cctctgcttg tgatttttca tagattgaac cgtttatatc gactttaacc ggatctacag     31200
     taatatgttc taatgccata aaataccttt cataattatt aattattaga tatttatttt     31260
     tacactaaag tgttatatgt tttagaacta aaatgctata ttcaaaacat tctaatgtta     31320
     tatgttttag aactaaaatg ctatattcaa aacattctaa tgttataatt tagaatcttt     31380
     gtctttaggt gatatattat ctaataatct atcaattata ctttgtattt tttcataccc     31440
     agcaaacgct ataaaaatcg atacacctat tctgctcgaa taagttaaat caaaattatc     31500
     agttattaaa aaagaagata atgctaaaat accggaggtt gttgatgttt taaaaaaaag     31560
     tttaaatctc gttaaaaaat tggtttcatg tttagcagtt ttgtctatat gtaagaattg     31620
     tacagcacct ataacagcac ctataaatag tatgggaagg gagccaaaca aagcatcata     31680
     aaagttcaac gttttactcc ctttaaaaat ttatgttatt tattacataa aatattagca     31740
     atctatgggt taaccaacat aatcaaaaaa gctagctatt gcatatatca acgaaaatgt     31800
     aataacaccc catatggttc tattacatat tttccaaaca gttcttaatg aaatagtata     31860
     aggttcgctg tcagtacaat gatatctacc tattaaaaac catctgaaaa caaaccaata     31920
     atatcttagt ctctttttta aatcttttgc ttgttcaccc attctaagcc ttatttatta     31980
     tcatattttt cttttaattc gtcatattct tttttaagtg cttcataaag agcttcagct     32040
     tttttagagc cattgacacg aatgcaataa cctacagcaa gaccaacaac gaatatagca     32100
     acgtaaatag caatacttaa cattcataat cctttaatat tttttattat ttattaaaca     32160
     aaaaattagt cacaaaaatc aaataaatat tacaaaaatc aggattttta aatggctatt     32220
     ataaaagaaa cgttaccttt tacgtatgat gaaatatatc aagatatagc taaaagatta     32280
     attgaaaaag gctgggatgg tggagcttac gaaggctcta atggagcaat cttagcatct     32340
     gttttatctt atattgtaag ttctttgaac ttcaatacag cagtaaatgt taatgagaat     32400
     gttttaactt tggcaaccaa acgtaaaaat gttatacaag atgctagggt tttgtcttat     32460
     gaaccttctc ataaaaaatc tacaatactt gaaataacat taagttttac aagaactggt     32520
     tattttaaaa taccaaagta tagtacattt accataaatg gttttactta caattattta     32580
     ggtgatgatt tagaattcaa tatagataaa ataggagcta caactacaat acaagtaaaa     32640
     gaaggtacgt taattaaaaa cgaagaatat cctgatattt taacttataa aatagatgaa     32700
     aaatttgaat acatagatat accttggaat gacgtagaag atgatggtgt agaatgctac     32760
     gttacttatt atgatacttt tggaaatttg ttggataatg cgacttttgt aaaatcttct     32820
     tttaatttaa ttgatattaa ggatagtact aataataaat tcttcagaaa agatgatgta     32880
     gatactggta atgctaggat atattttcaa ctagggactg ctggtactaa gttgccttct     32940
     aatacgagag tttatattaa tgttttaaga acttctggta aagatgctta ttatgagaga     33000
     tgtgattcag cttccgttaa tggagatctt ggctcttttt gtaaaatatt aacttctggt     33060
     aaagatgtgc cagtattagt ttctcaagct caggatgaag aaagcattga atccatcaaa     33120
     acaaatgcac caatgtttta taatagtgct tcaagaacag taactataca cgattataat     33180
     tcagttataa aaacacactc gagtgttaaa aatgtagtga cttggggagg tgaagatgaa     33240
     tatccagtcg cgccaggtaa tttgtatttt tcagctgagc cccgaagaaa agaaccagaa     33300
     tttacaatct ttaaaaaagt tcaacaaagt gatggaacat atacttacaa aaaagaaaac     33360
     tctactttag caaacggtga attattgaat actactgaaa taagtactaa tcaatactat     33420
     ataaaagaat cttataatga tcctgacaca ttatatttaa atgatggtga agttgtttct     33480
     gcagaaaaag atgctaacgg ttataaaaac ccaggtattt ttgacttagt agatacatat     33540
     aatttaccag cacttaagaa taatcttaaa aatccaacat atgttaatat agatttacaa     33600
     gttcttatta aacaataccc atttggtact ccaaaatcag atattcgtaa aaaaatctat     33660
     gcaaagattc gtgaaaaaat ggcggaaatt gaaaaatttg aaggtgagtt tatccattct     33720
     aacttagtta gacatttaga caatgaatta ggtctaggca atggtataga agtaaaacca     33780
     tattttagtt tattgctaag cgaagaaaac tgtgtaaaac aatttaaaga aaataaagac     33840
     tttagtaaag taaattgttt ttatgctaaa tcatatgaca aattatctaa gaatttagtt     33900
     cttagtgttt attttagttt attggctagt gtaggtgata aattagaagt ttattttaat     33960
     aaagaaagtt tgccgtttat tttggataat acagatcatt atacttatga attaacggat     34020
     actgacgtta accaatctta taaatctttt tattttaagg atgtgggatt tgatgaagaa     34080
     tcattaaatg ttagaatagt atcgtatgac ggattaacca cctatggggg aaacgacatt     34140
     aatttatata acttaaaaaa taaaactgta ttttttaatg ttaatatagg taatgaatta     34200
     tcagttatta aaatagcatt accaagattt gttagtgtgg gtgatagttt taaagtttat     34260
     ggtttatacg gttctcgaaa agcagaacaa ttaatatatg atttctatat cacagaagag     34320
     atgctttcac aaggctatct acaatgtgat gatttacaaa ggggtaaata tgcaggtttt     34380
     gtaggagcaa gtgattataa agttgtctat acttgtaaca aagaatcttt aaaaccaagt     34440
     gatgatgaag aacctgatag caatgggtta aaatctaatc aactattagg aactgccagt     34500
     ggttcttggg aatctgcagt taaccaaact gaaagtcaag ataatgtttt tggtgatata     34560
     gaaacttcta atttatatta taactggtat gaagattctg atggtcaaat agatattaga     34620
     gtttggatac caagctcagt aaaagccaat gatacattat taatagatta tgttcaaaaa     34680
     actacaagta ttgttataac agacgctatg atagctcaaa ggcagtttga tacaaaaata     34740
     gatggtatat tattagatat tacaaaaatt tcatttggta gtacagatgg ttctattggt     34800
     atatatccta cttatgtaga aagacaaaat gaattgacac ctgtagaaga tgatagaatt     34860
     caatttgttg ctaaacagtt tgaaaatata acagaatata cacccactac tacatttgat     34920
     agagaagttc aattaaaatc taatgaaaaa attacatttt atgttaatta taataataaa     34980
     ttcgatgtta gaaatttaat tgcaaatcac gacgattcat tagattcata tacagtcagt     35040
     atactagaag attctccatt aaaatacgaa gcaccgtata tcgtattaaa taattataga     35100
     aaaacaggaa cttttaattt taatttagac gttcaagtaa aacgtggtga tttattatat     35160
     caaaatcaaa tagtatatgt taaagaagca gcagtagatt tatcagtaga tgaaggacct     35220
     ggtggggctt atgtatattt agatttacca attgaaggta tatatgatgc taagggacaa     35280
     ataataccag aaaatatacc ggtaatagaa tgggctttat ttactaaagc aaatcctaca     35340
     gaaggtgagg ataatgaact tatttgtttc gaagaaatac aagaacctag caaaacacat     35400
     aaagttatcc cagcagattt aacagattat gtagcagaac aaaaaatagt tgtcgactat     35460
     gttatagatg aagaatctgt taagactatg ttaccatttt atacaacagt tgaagaatat     35520
     attaatttag atctatctaa agttgcttat ataagaatac ctattaaatt agtgaataga     35580
     agtgctacta caccagaaga aggtgagcaa attgtaggtt cttatacaat atttaattca     35640
     agaatacctt atattagagt taaattacaa acaaagattt tccaacctgg atataattat     35700
     gaatttatgt taaattatcc atcatataat tttaaattaa taagaaattc aatatttaga     35760
     cttagatctg tagtttttga tgatttattg gattatcaag aagttagaga tagtttaaga     35820
     gctggtgata ttgatatgag cgctatgagt gtttgattat ctaattaaat atattttaag     35880
     ttattttata atataattat gtaaattgaa ataacgaggc tataatgaaa ttttcagatt     35940
     ttttagaaga gcaagcaatt gctaaatcag gtgattatga ttttggtaac ttggattact     36000
     tatatacagg tatcaccggt tatgtttcta agaaggttac taacgttttg tataaatttg     36060
     attttgtaat aaatggtaaa aatacagaat tattcatcat tgaatgcaaa tctaatcatc     36120
     ctaaacaaaa atattattgc atagctaaag aagaattaga tactacaagt gagccgcata     36180
     ctatgcgatt taagccatta gctgctatgc ttttagaata tactacaaaa tatagaggtt     36240
     tgggttatgg cccttttaga atagttaaag gtgttgaaac tttgcaatca tattggggta     36300
     aagggatagg taaaaaatta tatactatct tagtcgatga ttttaaatgg gtattgatgg     36360
     gtgacgaaga acaatatgaa ggagctagga atttatggac ttctttgtct aaatcacctg     36420
     ggtttaacgt tgatatagtt gagctagcaa ctggtaaaat tattgctaaa aatgttaaat     36480
     taaaagatgc tttagaccca agaatttgga ccgatgaaga tttattttta acgggaacta     36540
     aagaagaaag aatacgtggt agatttaata gattggtatt aactaaagtt acaaattaaa     36600
     ggagcctaaa tgaaattttc agatttttta gaagagcaag caattgctaa atcaggtgat     36660
     tatgattttg gtaatttaaa ctatattaat aagtatggtt taacttcaat agaatataca     36720
     tttgataaat caccttttgt gtataaagtt tattataatg gtaaagaata ttatttttat     36780
     cgtagagaat cttatcatat tttagctact aaagtacctg aagattaccc aactaaagat     36840
     aaccctaatg gtactaaaga tagatttagt cctatagcta tgattagatt attacctaca     36900
     gataaaatta aaagaatggg ttataaaaat gtttatacag ttagtgctgt agaagttgat     36960
     agagaccaca gaggtatcag attaggtaaa ttattatatt atctatcaac tgtagttctt     37020
     aaatatactt tattaggtga ttctgagcaa tatgaaaatg ctaggagaat atattattct     37080
     tttagtaaca acccaggatt tacagtagat gtaattaaat taggtcaagg tatcttagca     37140
     aagaatgtaa atctaaacga ccacaacgat gaaagagttt ggagtacaac acctgataaa     37200
     gtaggaacct tacatagagt ggttcttaag agtgttcata tggaatctaa ggtagaagtc     37260
     gaaaaattaa aataatttta ggactaagag ccaaataaat aaactaaaag cataattaaa     37320
     ggtttgctgt gtttaaaagt atagctaaga acttagtacc agaaaattac aaatctaata     37380
     aatttattat ggatgccctt gacgtttttg tggattatat atatgataat tcaagcctag     37440
     caattgacat caataattta tataattcaa aaaatgaagt tctatatgaa gaaattatta     37500
     aaacatatgc tgcaaacttt tataagacta taaccgatgg ttcaaaaaat cataaacttg     37560
     cagaagctgt tagaaaagca cacgaaaaat atggttttga ttttagtgaa actcaattag     37620
     atataaatgt tatacactta ttgtcacaag aacaattaga attatttaaa aattttcaac     37680
     aatctaaagg aactttaaga tctatagagt ttatatatcg tattatagaa caattaaata     37740
     ttgaaagttt tgtattagaa accgatggcc aattaacaat agaacctggt gaaaatatat     37800
     ttgaatatcg cgtttatgga tctatgttac cagaaatatt cgaagcattt gttaagccgt     37860
     tagctcaccc agtgggttgg acttacttgt ttacaagaac ttacgttctt aaattcgaag     37920
     attatttctt atgcaaagaa gtttacgatg taaatgtttt tagagtaact tgtgaagatt     37980
     ctgattgtga agataatttt aaaacaaata ccggatatct ttttgaaact gacattaata     38040
     ataatataat atatgaaaat aataaaccaa aaatgtataa agctgatggt aatccagtat     38100
     ttaatgttac aagatttggt gtcaattacc cagaattaac cttagaatct gaattaaaat     38160
     tagttaaaga tccaactatt agaactattg aaaaatccag cataaaaggt aatgacaaat     38220
     taattgtata ttttgaatct ggtgaaagat tagaacaaaa ttcaaaccct aagaatttaa     38280
     tattatatta ttataaaggt attaactcat taaatcaaga aattaaaaaa gattatactg     38340
     atttcttaag caaatgtgct ttggaactta attatattag aagagttgta accacagtta     38400
     aagacaaata tcaatttcaa gtagattttg gtttagcaag cacaaccggt aaatttgcag     38460
     ctatcggtgc tggtaatatg tatctaggtt cagatacttg gattcttggt aaaaatagaa     38520
     tcaatacaaa tacaccagta acatacggaa ctagagttcg taataaagtt cttcaaactt     38580
     ccgactttaa agcattgtat aagaaaaatg ataattctat tagacaagta tttgataaag     38640
     tttattctgg ctttgacgat cacgtaaaat caagtacttg taattttatt ttagaatctg     38700
     ataatttata tcattataga ttatataacc caaatgcaat attttttgaa ttaattaata     38760
     cttacgggta tagagttcgt gctaaaataa aatacaatga agattcatta gaagttatag     38820
     ctgaagatga acttaaaaat acgcaattat tatatataga taaaacatta ttcagtaaat     38880
     ataactcaca agtttacaaa gattttaaag aatctatgaa taatccttta ggacaatatt     38940
     atacagttct taaaaaaggt gttaattact tgaatattgt agattctaat ggtcatatag     39000
     ttaaaggtaa ttatagactt gtagattctg aatatagact ttatttaaat ataaaagatc     39060
     ctgtaactat tcaatttatt gatgatactt atgaatatga ttcaagacca tttcaaatta     39120
     ttgatgttga attaagttac aacaaagatt ctaaattata tgaatacacc acacctgaaa     39180
     aagaatacta ttttgtcaac gtagctaacc gcgttagtaa tgtagattta gacattacat     39240
     atattgctgg tctacaaaaa ggttttaaaa taacttcaag cactgctcaa aaaataagag     39300
     tatatgttat agataatact tctaaaagat ttccgataac tatactgagt gcaacagccg     39360
     aagtaataca agcaaaagaa aatagtatat tcttaggttt aatcaatgct gataaccaat     39420
     acgttgaagg tcaaatagtt tacgattctg aaggtaaatt agcaacatta gattgtaatg     39480
     caaaaacaaa taatttaagt ttattatact tagattattc tgcaagtacc caaaatccaa     39540
     taactattaa atctacaaca tttgatattg ctggaaattt ctcagaaatt aataataaaa     39600
     gaggtaaatt cctttataat tttagaatcg aaaatattat gattgttaat atatttgata     39660
     aaaataatca aagaatacaa ttagactatg atattgaaaa tactggagta tctttttata     39720
     ctgattcgaa tgaagctatt acaatacaat actttgataa tatagatgaa ggtataccaa     39780
     gaacatatgc gatagatgct gaatttaaat tagatactag ttacattaat tataacgcaa     39840
     aaatatttaa atataaagat atattattaa atatagatac tagtacaaac aaatatgttt     39900
     ataaacataa tgaaatgaaa acttatcctt tagttgttat ggatactgat ggaaatgttt     39960
     tagacgttga aatggatatt ttaaatactg gatttaaaat atcttattct gaaggtataa     40020
     aagtaagaat ttattatttg gatgatacta aaaatagagc taatgttact tataataaag     40080
     ctgaaaaccc agacatcaca aaattattat atgctgttaa aaatggtgtt ataatcaaac     40140
     aagatattga taccgtgtct actgaaaatt tttattcgtt ttctggatta aaaacactta     40200
     aaattaagaa agctgattta aaagctgttg aaagcaacga cccggattca aaactaggta     40260
     aatataaatt tattaaaaat attgaatatg gcttgccagt tatggctggt ttcaacaatg     40320
     atttaaaatt caaagtcaat gaagattcta taacaattta cacaggaact aaaaaagata     40380
     ttaatattag atacgtagaa aaagtcaacg aagaaagttt cttatatact tatagtataa     40440
     gaaaagatga tgatttattt atagatgctc aaaaagattc tataaaatat ttaatagatt     40500
     atcaatatga ttatttaaat aatagaatta tttttacaaa agaagacgat gatatcgtta     40560
     aattattttt cttaaagaat aaacacaata agaaaacaat acttagtatt aataatgcaa     40620
     actttgagga tatcgatttt ccaattaaaa tttatttaaa tgatgacttt gttgaatttg     40680
     aaaataaaga atctatgcaa ttagatataa atccattaaa tcttaaattc aatcaagata     40740
     ttaaaaatag aaattcaaca attagagcta ttaataaaaa tcttgaagtg ttagaacaaa     40800
     tagattttaa tttagcgcca caatatacct ttaaagcact tggtgattat ctctatgaga     40860
     tagatttcaa caagattaaa ttcaaagaaa ataaacttaa tgaagaatct ctatggtata     40920
     gagaaagttc agtttatcat aatcattatg tgggatattt tgcagctaat aacgttcaac     40980
     ccactcaggt atttactggt acatcaaaca aattagatta cgaacttaga gaaacaaacc     41040
     cttggggatt aacagctata gatacttttg agttaactgg aactgctgca agtgatggtt     41100
     ttgatgtcaa ttttgaattt attgattctt ggccagaaat cacagaagtc tataaaaacg     41160
     attacacagg attctatcaa aataaatggg gttggcaatc gggatatgtt gatgtttacc     41220
     aaactaccag agatcttgaa agatttaatg aaaaatatga aagattagaa cacgccagtg     41280
     tatatcaaat ggacgattat attgttatag gatctaatga tataacaaaa gattatatgt     41340
     ttaaatggta cccaactagc aaatcagatg attttagtga tagtttctta agaaatggtc     41400
     aagtctctga accagtaaca cctaataaaa tatatactgg aaaatacgac agagaacccg     41460
     acaatataat taataaaaca aatacttgat tataaaggat ttagatggct gatattattc     41520
     aaaataaaat gaatcaagta ctaggtgatt tagctcgtcc cactaagttt aaatgtcaaa     41580
     tatttccacc taaagaaatt aagtgtgaat tgagtatttt aaatgaaggt gattctgcaa     41640
     catccagcac ttctgaaata agccaatatt tagactattt ttgtcacgct acaagttttc     41700
     cgggattgac tgtagaaaca atagatttta aatatcgtgg taggactcta ccagttaaat     41760
     cagtacaaac ttatcaacaa aaatggtcag caacttttta taatgatgaa aaacatgcag     41820
     ttagaaagtt atttttggat tggatgactt atgatcaagc acatcaattt gaggataaaa     41880
     ctaaaggtaa ttttgaaggt atattaccca gcatttctat atatcaatta gattttgaaa     41940
     tgtctaaaga ttgtgttgta tatactatga tgaatgtatt tccaacaaat gtgggagaaa     42000
     tttcagttca atatgacggg ttaaatcaaa ttgaaacttt tacagttgag tttgcatata     42060
     cccattttga aattaataca atttctaggg aagggttaac gagttctgaa gtcactagtt     42120
     tgattaagaa tactatacag aatactatta ataatgttac caatacttta aaggatgctg     42180
     tatttggtgc tttagacgac ctagtttcac ctgtattgga ttcggtttca gattcatttg     42240
     aaaattttat aagtacaaaa taaggttttt attatataat atatttttga tctttttaaa     42300
     ttgtattgtt atgaactttt tttgagtttt tagtatttta tatatgctag cactgctaaa     42360
     acttaaagga atattaaaaa gtataaaaaa tgcttgagtt tttagagttt atactatagt     42420
     attaagtcta aagcttaaag taatattaaa aagtataaaa aatgcttgag tttttacagt     42480
     ttatactata gtattaagtc taaagcttaa agtaatatta aaaagtataa aaaatgcttg     42540
     agtttttaca gtttatacta tagtattaag tctaaagctt aaagtaatat taaaaagtat     42600
     aaaaaatgct tgagttttta cagtttatac tatagtatta agtctaaagc ttaaagtaat     42660
     attaaaaagt ataaaaaatg cttgagtttt tacagtttat actatagtat taagtctaaa     42720
     gcttaaagta atattaaaaa gtataaaaaa tgcttgagtt tttacagttt atactatagt     42780
     attaagtcta aagcttaaag taatattaaa aagtataaaa aatgcttgag tttttacagt     42840
     ttatactata gtattaagtc taaagcttaa agtaatatta aaaagtataa aaaatgcttg     42900
     agttttttag tagtatatac tatagtataa tgtctgaaac ttaaagtaat attaaaaagt     42960
     ataaaaaatg cttgagtttt tacagtttat actatagtat atacaactta agtttacttt     43020
     aagtttaaat atgcaaatct aaaacttaat aaatacttaa aaatgaagtt caaacaaggc     43080
     atttatatac caaaaaatcc agagaaatat atacatagtt acacaaaaat gaatgaacac     43140
     accgaatatc ctgtttacag gagttcttgg gagcttagtt tcttcaaatt ttgtgattat     43200
     tcacactcta ttactaaatg gtcttctgag ccagtcggca taaagtactt taatcccgtc     43260
     aaaaaacacc aatccacata ttaccccgac gctatgatta ttcgtaatgg tataacgttt     43320
     ttaatagaga ttaagcctaa atctcaactg cccggttcta actcgaaatc tagttatgat     43380
     aaactttcag cagcagttaa cgaagccaag tataatgctg caaaatctta ttgcgaagcg     43440
     aacaatatgc aattcataat cttaagtgat tctttcttta aatcttgatt ttaagttttt     43500
     agctttttga ttttaaaact ttagttttga gttttgattt taaactttag ttttaagcct     43560
     aggattcaaa aaaaaaaatt tttttggcct tttaatatga tatattataa tataaaaact     43620
     tttttcaaaa aaatttttaa tgattttaca gttgcttaga atttgactag aatttaacta     43680
     aaatttgttt taaaatctaa actaaagttt cagtttaaaa cttaaagtaa tattaaaaag     43740
     tataaaaaat gctaggcttt ttagtagtat atactatagt ataatgtctg aaacttaaag     43800
     taatattaaa aagtataaaa aatgctaggc tttttagtag tatatactat agtataatgt     43860
     ctgaaactta aagtaatatt aaaaagtata aaaaatgcta ggctttttag tagtatatac     43920
     tatagtataa tgtctgaaac ttaaagcaat attaaaaagt ataaaaaatg cttggatatt     43980
     tcatatgcta acacctaaag ctcataaata tttaaaacat tctaataaat ttaaggattt     44040
     tttaagctta tatattatat aatatatcaa ttgaaaggat ataaacaatg agattaactt     44100
     acaaacataa attgtatacc aaacatcaag atattattaa tacatatcta cgtttaaaag     44160
     tagagttcaa cttattcaag cttgattaca aaagacttag atattcaagt atgtttacac     44220
     agaatacaag acttaaaact caaaaacaaa tagaagaact tgaaacgaaa ctaaccaaaa     44280
     aaggtctcaa tacacaaaaa ttacgcaagt tatatactaa aattgttaat aaaaaacctt     44340
     tcaacacttt tgaacaaatc atcatcaata attttgcaga aaatggtaaa aaagcacctc     44400
     aattatttaa acacgaacgt aaattcgatg atagattcac aggcttgctg ttagaacgta     44460
     aaaaacgtcg tgctaaagca gctaaagaag tatacgcaag aagaccatta tctccagaaa     44520
     aacaaaaagc tcagcaatta gtcccatata tttttcaatt cattaaactc agaactatgg     44580
     aaaaatttgg atataacgaa gatttagcag tcgaaataac tggtagaatt ttcgggcctg     44640
     gctgcgaaga agctcttgat atatatttaa aagaattcag agatttatat ggtaatacag     44700
     atcaagcttt agaacatttc aaaaaagttg aactattagc taattaaaaa tatatttaat     44760
     atttaatatt aaaactaaag ttttaaaatc caaaggtgat aaaaatgagt gaaacgcgta     44820
     tgaaacacga ttatactaac gaacttgaac taaaatcgct agctattcgt gaaaaaaatc     44880
     ttaaattaaa tctaggctct gaagaccctg atggttctat aaatgaagac ttagacatta     44940
     aaataaaaga atatgttaaa acaaaagatc ctgaccttaa agactatatt atcagtgtat     45000
     ctgagggtgt aaaaatatca ccaaaatctc acgaatattt tggtagcatt gttattctaa     45060
     tgattaaaaa aatattaact aaacctaatt tttctgggta tacttggcaa gatgattttt     45120
     atagtgatgc ttgctaccgt gtatttaaat atattcataa cttcgaccat acattaaaat     45180
     ctaaaattac aaatcaatca gtatcttgct ttagttatat ttctcaaata attcataata     45240
     gtattttagc tattattaat gagaaaaata aaaaagataa agaacttgaa aacttagcct     45300
     gtatgtacaa ttctgaatat gatatccata atgaatccag gaatgtttca acattagata     45360
     ttattaatga atcgtcagtt gattatacaa tacctaattt taatttaaaa atgattgaaa     45420
     atattttaga gactactgaa aacaaatata aaaatgttaa tattaaatac aatgaaggtt     45480
     ttatatcatt tgatgattat gctgaattca aaaatgttct gagtaattat aaacatttta     45540
     atgtaaatct aactaaaggt gattcaaaat gaatattagc caagatttaa tagcaaagga     45600
     aattaaaaca ttaaataaat tctacaagtt tttaagagaa cataaaaatg aatgtgctat     45660
     ggaaataatg caagattttt gtgatttaaa tgatattcct ttagaagaac ttggtttttt     45720
     gatatcagag gatgcctact taaaagatta tatcgaagca aatcttatta aatataaatt     45780
     ctataaaagt cctaaaaaaa ctgtttttag cgacgatttt taattttata taagcaagta     45840
     tcaattttaa cactcagtgt aatttatgat atttgcttcg attctgctaa tactgctaat     45900
     actattaaaa ctctcaaaac tactaaaact aagcttaaaa caaaattaaa ccgattttaa     45960
     taaatataaa aaaattcaaa gaaaggtacc taaatgttag ataaagtttt aagcaacgat     46020
     agctttaaag atgttctaac agaatcagtt aaatcagaaa ttgaatctgt ttttaatgaa     46080
     gctgttgaaa ttaaagctgt tgaaatagct aacgaacaaa tcgaacttga aaaaatcaag     46140
     ttagtagaag agttcaaaga agctaaaaaa gaacttgaat ctaaaattac taaaaatata     46200
     gattcattca ttaatgaaga actttctaaa tttaaagacg aagttcttga aaaattagac     46260
     gctgttgttg agagcgaaaa ggctgctact ctggtaagta tatttgataa cttagtagat     46320
     gttgctggat caaacatact cgaaaactat acaaataaag attctgaatt gcgtgatcaa     46380
     tttgacaaat tagttgttga aaatagagaa cttaaagctg aacttgagat tcttcaagaa     46440
     tctaaaaaaa ttgatgaatt agctgctaat ttaaatctag tggaaagtga aaaattcaaa     46500
     aaattagcta gcttagtaga acgtggtgaa ggttttgaat ctaaattaga agcgttattt     46560
     gaagcttgta aaaaagcaaa tgaagatgat tctgatgcag attctgattc taaagattct     46620
     gatgattctg attctgattc taaagattca aaagatatca aagaaagttc caaaaacaaa     46680
     gcaggtgctg gtattaactg ggctaactac taagttcaac caacaagctc agttaaaatt     46740
     cagttaaaaa ataaatatat aaaaatttaa aaaggttaaa aacaatggac aaaaatgtaa     46800
     gtcttaatga aaaagtagag tcttatatta aagattcaag atatgctgct ttaaatgaaa     46860
     gtgaagctgt attgatgagt acattgctta gcaataccgc tttagcatct caaggcgctc     46920
     ttgtaggtga aagtgttatc tctagtgata tcgctcaatt tactccaatc ttaatgccaa     46980
     ttgtaagaag ggtttaccca gcattagttg ctaaccagct tttaggtatt caacctttaa     47040
     caatgccaac tggttacatt tatgcattgg ttaatagata tacaggtaat aaaaaagacg     47100
     gtgctgtatc tccagttggc aaagcgcaaa ttcttgtatt tgaagctaat gtaactaaag     47160
     gcgatactgt tactggtaca acttcaactg ctactggtaa aattatccac gttgaaaaag     47220
     atggtaaaac agctttagtt caattaacta acgataaaaa attccaaaat gaagaagcaa     47280
     ataaaggaac tagaatcgtt aatgtttatt ctaacgaagc tactttccat aaaatcttag     47340
     aaacttattc aggtccgtat agtacagctg atggtgaaaa acttgctgaa gatatgaaca     47400
     ctgtaggttt tggaattgaa aaagatactg ttgaagcaaa aacaagaaaa cttaaagctg     47460
     aatacacttt agaaatgtat gaagatttaa aaaatcaaca cggggtactt gcagatgaac     47520
     atttagctaa tcttattgct gctgaaatgc aaactgaaat cgatcgtgag attatcaatt     47580
     tcgtaaacaa tacagctact gttgttgccg atactttaag tccaggtcac gaacataaag     47640
     aagctggtag atgggaaatc gaaagatata gatgtaatgc tattaaaatc gatttagaag     47700
     caagaaatat tgggttaatg acaagacgtg gttcaggtaa tacattactt gtatctccaa     47760
     aagttgctac tatgttagat caaatcggta catttaaatt tgcttctagt tcaagtaata     47820
     ttgctactga tgtatttact ggtaatgtag gaacttatga tggtagatat aacgtaattg     47880
     ttgaccaata tgctaaatct gattatatca ctgttcttta taagggttca acagctcaag     47940
     atagtcttgg attcttctgt ccatatgtgc cattaagctt ccaaaaagtg atgaatcaag     48000
     aatcaggaca accaggtatg attgcaagaa caagatatgg tttagctact aatccacttg     48060
     aaccagaaaa ttatgcaaga acatttggtg tagatttaac aggaactatt ttagcttaat     48120
     tgcttcaata atttggggat gttaaatccc caatctaatt tttaatacat aaactgaaaa     48180
     aactcttaaa attcaatttt aaatccttaa ataaataata agattccaat atactttagt     48240
     cgcttagcct aaaggcatcg aaattggttt aagggctcaa caacgaagct tgatgtggtt     48300
     cgagagactc tttgtaatat caaatcatat taaaaggatt aaaatggcaa atttacttag     48360
     ccctggtatc caggtttctg aagtagatca atctcaaatc acaccagttg aaggtgactc     48420
     tgctgctgtt tttggtggtg attttgagaa aggacctgtt ggtgttcata ctttaatctc     48480
     aagtgttcaa gaacttagag acaattatgg tatgcctaat acaaagaatt acaacgatta     48540
     ctatcaagtc caaaatttct tagcttatag cggtgcaatc tatgtttcgc gggcagctga     48600
     tttaaatggg acgcctacaa aattagacgg cttacaattt gaagaaaatg catataaaac     48660
     aaatgttaat gctactaaag ttgaaggtgt taaagttatc gaagctgact ctgtagacgt     48720
     taaattcgaa aaaactgata aatttcaagt tggtcaagtt cttaaattca acgattctaa     48780
     caaagaatat aaaattaaat atgttagaaa cgaagttaaa caaataccaa acccagatta     48840
     tcaaccatta acacaattag tagtagatcc aagccaagca agtgcttatg ttgatgaagt     48900
     tgttagctac gtagtaacaa ccaatgcaga atcttatact gtagaaacag acaggcctga     48960
     tgtagttctt gttaataaat ctaataaatc tttaactgca ttaaaagtag gaactgctat     49020
     tgtaactttt agagctacaa aagaaggttc aaggccaaat acttttgaat ttgttttaaa     49080
     tgttcaagaa aaagaacaaa ctaagctagt agtaacacca gaaactgtaa atattttaga     49140
     aggacaaact gcaatgctta atatagatac agatgctgaa acttatagta tagtatctaa     49200
     aaacttagca atagcaacca tagccgaaga taaaaaaact atcaatggtt tgagaatagg     49260
     ttcttgttta gccgaagtat cagcacaagc taataataaa acagaaacta ctaaaatcat     49320
     aaatgtcaat gttatcacag gtgttgaaac agatttaaca gtaagcccag aaggacctgt     49380
     aactttacac aaaaacgaag aacaaatatt tgaaatcact tccagtgggg cttctatatt     49440
     agaaactgct agtgaagctg ataaagaatt tgtaaccgta gacaaaactg ctaaaaaagt     49500
     tactgcaata aaagaaggta atgctgtagt ccgagtccgc gcaaaagctt taggtgctga     49560
     tgaagttata aaaagaattc aaataattat tttaccagaa aaaataagtg ccactgttga     49620
     gcctactgaa ataagtatta atacagacgc tggcgaccaa accttaacgg taacaactga     49680
     agctacaaat atatctgcac gcgttataga tacttcagtc gcaaatgtga gcacccaaga     49740
     aaaaataatt actgtaacac cattagctgc tggtaataca gagattgaaa taactgtttc     49800
     atcagaaggt tattcaaata atgttatcac tgttccttta acagttactg ctgtaaatgc     49860
     agatccaagt ggtagcacca accaaaaatc taaagctaag aaaggataac aaatggcaga     49920
     tatctacgat ataccagagt ttataactca agaagtaact attgttactt tagacaaaga     49980
     accaggtgaa ctaaatgcag acacttctgt atacttacta gaaggtgaat cacaaccaga     50040
     ttctaactat attttaagtc ttagaggtgc taacactgaa ttaaaacgtg gtgatattat     50100
     agcattttct gatgttttaa ctgatcctag attcagaatc ttagcaatct ctgacagtat     50160
     agtcaatggc gaagctttca caaatattac ttatgaaggc acagaggatt ctgaagccat     50220
     tgttgaagca actaaaggat ttccagttta tttagttaaa tctactaaat cagcttgtgt     50280
     tgaagttcct gtagaaggtt ctgaaaccaa atacgactca tcagaatatg aactttatga     50340
     tcataccatt agtaacttca atacatttga tgaagataaa ttatctaaac catttgttta     50400
     taaagatgca aaattaaaaa tatttgctaa aacaccagga acttggggaa ataaaattga     50460
     tgttgcaata gcacaccctg atgattttaa caaaggtaaa tatatcactg atggtatacc     50520
     attagattct caatttgatt atattcctta cggtgatcaa tttgctgtta ttgttatcta     50580
     cgcaaacgaa attcaagaat catttattgt aagtctagga ttgactgata aaaatgagaa     50640
     aaatgaattt acttatatag aaacaatgat taatggtaag tcaagctata tcttagtttc     50700
     tgtaaatgaa gcagttcaag gtaaaccaaa aacttgttta ggtgaagatt tacttaaact     50760
     tgaaaatggt atggattcag ctccaggtat tgacgacatc atagacgctt atacaatttt     50820
     cgacaacaaa gaagaaatcg atgttgatat cttaatttgt aacgaaactt atccaaaagc     50880
     agctactgat attgcgatta ctcgtggtga ctgtatagca tttatgggtg ctccaaaaag     50940
     ttgttcagtg ggctataaat ctacaattgc taatcaaaaa acacttgatt ttagaaaatc     51000
     tttaaatata gattctaaat atgtaacttt gtgtagcaat tacaaatatc aatattgtgc     51060
     tgagcttggt ggttacagat gggtgaatct agcagcagat attgcaggtc ttaaagctca     51120
     aacaaattat aatcaagcta actggtatgc agctgctggt cttaacaggg gtctcattaa     51180
     aaactgcgag gcgttgtcat atagcccaac tggtgcgatg cgagatacac tttacaagaa     51240
     tggtataaat ccagtggtta tgtttccaaa cactggtgcg gttctttggg gtcaaaaaac     51300
     attacaaact aaagcttcaa gcttcgatcg cgtaaacgtt gttagcttgt ttaaccattt     51360
     ggaaagatct ttaggtcgta tgtcgaagta cagtctattt gagttcaatg atagttttac     51420
     aagaaattac cttgtaagta ttatcaaacc tttcttggct caagtaaaag ctggtcgcgg     51480
     gatcagcgat tatttagtca tatgcgatgc atcaaacaat ccagcaagcg taatcagtgc     51540
     aaaccaactc gtcatagacg tatatattaa gccgacttat gttgcagagt tcattcatct     51600
     cagattcgtg aacgtcggca caaacgactt tagtgttgtt gtaagctaaa cccaaggttc     51660
     aatttacaaa agattcaagg attttacgat ccttggatcc actgaaactt catatttcca     51720
     caatcgtata ttattctata actatttagc atcatattag cactttctga aagactaggg     51780
     tcgaaaatct ctaacttttc ttttagctta tgtttttgaa attgatgtct agccagcaat     51840
     tttaaatctt tgaagtaaaa ataattcggt tctgtgttct ccacgaactt aaaacctaag     51900
     gttttatata ttgacccttt actaaatctt ctattagcat aactcactat actttttggt     51960
     ttataattgt ctaagaaata cttaaataat ttagaagctc ctcctataac tgaacaatat     52020
     tttaaagtac acaatcttat taattcatat tcatagttct tattaaatct aggcttacca     52080
     aatgtcataa cttctactaa ttcgttatta taaaataaac ctaaattaat ttttgaaact     52140
     gtcgatttct gtaaatgatt ctcatttaaa aagtcaacta cttcattata atttaattct     52200
     tttataatac attttctagc ataaattttt ttatttaaac ctaatttatt attaatcata     52260
     gaaaaccata tatctaaatc atcggattca aaaatatgga ataactgtat tcctagagct     52320
     tcacacattt ctgtcttttt taaatggtat ttcttatcat aatctggtgt attaaacatt     52380
     ttatgtttat gtaaacctct actatgaaaa aataaaccat cgtattcaat tgctaaatta     52440
     taatcaggta aaaatatatc taattcataa ggtgatataa tagatcgtga gttaacgact     52500
     aggttatcta cttcgataga ttttacaatt ttactttgta tttgcgaacg acacgattta     52560
     tcaggagctg atatattaaa ttttttcttg tattttgcgg ctgttacgtg agatatatta     52620
     aagtaacaca taaatgcttc tttatcaaat aaagaatcgc taataaagtt ttcttctata     52680
     aaagctttat ttaaatcatt ccatttagtg atatggctag ctccacattc attaccatag     52740
     atttctaaat ttgtttgttt tcttttttca ctaagttctg ctagctctct tgcagattta     52800
     gaagcccagg ttttactaac agcttcttta aattcctttg tttgggaatt acagataaca     52860
     ccatattttt ttagatttgt ttcaattgtt ttatttttaa caacttcact ttgtgttgca     52920
     tattcagtat tatatttact taaattggtt tcttttcttt tattgtttat ttcagtataa     52980
     tctgtgttgg ctttggtgtt tctaatttta tcatttactt cgggtatttg cgatacattt     53040
     tctacattat atttttcttt tattgtttct ttatgtttat ctatattatt atagttagca     53100
     tcaccgtatc tttctaattt tgtagatttg attttagcta cgcgtatttt gtcgtattct     53160
     gatgatttta ggcattcttt gcaatattgt gtctttgtct tagttccaca aatcacacaa     53220
     aaattaggat tgttttgcaa atccttgtag tctttgtata ttgaatgaaa ttcctcatta     53280
     tatttagggt cttttaatag aatatcaata atttgttttc tataaagtgg atactgtttt     53340
     aattcaatga gtatttcttt gaaagtttta tttagatcta tcgttatatt tttataagtt     53400
     actttcattt aaatcctatt tttaaataat gttattatat aatattaaaa cttaaaaata     53460
     tattaaaatt tttagatata ttttaaaata ttaagtaagt tttaagcttt aatatattat     53520
     aattacaaaa aggagataac aatgttgggt ttaaaaaact taaaagattt aaatcacgaa     53580
     tatattgatg ctttatatcg atgtttgaat ggtactgaaa atacaccaaa caaataccac     53640
     ttagaaccaa acgttggtgt acacaccgaa atggttatgg ctaaagtcaa tgaattatat     53700
     aaagatgatc ctgattataa agtattaata ttaggggcag ctttacacga tattggtaaa     53760
     ataataacta gaacaccatc taaaaataac ccagaaaaaa tacatttttt aaatcacgaa     53820
     aatgctggtg tgttctttgc attagatgtt ttacacgatt tggatttaaa tctatccaaa     53880
     caagaaataa tagatataat taaaatagta gcacatcacg acatttataa attcgattta     53940
     gaaaccctta aaaaacgtta tgtttataga gatttaaaat tattatccaa gttttcagtt     54000
     gctgatgctt taggtagaat cactgaagtt ccaaaagaac ttccagattt aaatattgaa     54060
     gcttatgata gatctaatgt tgataataaa ccagttttag aagtattagt aggattacca     54120
     tgttctggta aatcaactta tgtttacatg aatgataaag tagctatatc aagagacgat     54180
     attttaatga gatacggttt taaaaaatac aatcaagttg aatattcaga tatttggaga     54240
     aacttaacag attctgatca aaaagaaatt gattctttat ttaatgataa gtttttaaga     54300
     gcactccaaa agaatcaaaa tattttaata gataaaacga atacttcagt taaatcgagg     54360
     cgtagattat ttgctacttc gagcttggtt agaaattatc ataagaaagc agtagtattt     54420
     ttaacacctt atacaatgat attaaataga cttgaaaaaa gaaatagtac tggtaaggta     54480
     attaataaaa gtgttgtgga tactatgttg aaatcgtttg cgatgcctac ttatgaagag     54540
     tttgattcga tagagtttag actttggttc taagcttaaa agcttaaaag cttaaaacta     54600
     gagttttaga tttttaacat aagattcata gaactttaag ttcaattata atataatata     54660
     tgaaaaggag ttatatgcta gtttcacacg aagttccact aagtcttcta gaaaaatcaa     54720
     gatcatttaa tgattatgat tatgctttgg tacatctatt tgaaatctat ccagcataca     54780
     agcaatttta tatagattca ttaaaaaagc gtagaatagt ttatttagat aattctctat     54840
     tcgaattagg aacattatat gatcacgata agtttgctaa agaagcaacc gaattaggtt     54900
     ctatcaatcc tagtaatttc tattatatag ttccagatgc tttaggtgat actaatgcaa     54960
     ctatacaatc ttttaaagat ttttctaagt ttagtatacc tggtaagaaa ataggtgttg     55020
     ttcagggtaa tactttagaa gaattaacag attgctttaa gtttatgaaa gaaaatgcag     55080
     atatgatagc tatttgtttt tcaggagact acttctatga atacgaaggt gatactaaag     55140
     aagctaaatt aacacaagca aggatagatt ttataaaaca tttagataaa ttaaatctat     55200
     taaaagattc taaaatacat ttattaggtt gtcaagttcc tcaagaattt aaaaattata     55260
     agaacattcc agagattgta tctttagata cttctaaccc aattgttcac ggtatatata     55320
     atgtaagata ttccagagat ggtttaagaa ctaaaataag aactaaatta gtagatctta     55380
     tagattataa aggttccgtt aatactattt tattaaatat tatggatttt agaactatta     55440
     atggcctttg atatggttta aatagccaaa attaggtttt aaaggggttt aaatgaaaat     55500
     aggatttaca ggtgtttcag gttctggaaa gtcgactata gccaaattat taaaagaaca     55560
     atataatttg gctattattc caggccctgg aagaaaatta aaagatttaa attttaatat     55620
     aaatgaagat ggtgatattg aaactcaaaa agcagctttg aaaattcata tagaagatct     55680
     taataaagat ggtatattcg aaagaacaat attagacgct gtagtttata ctaagtattt     55740
     ggtagagatt aaaaaagcaa tacctgatgt atttttagat ttaaccgaaa tagtttctat     55800
     tgaattaatg aaaaaatatg atatagtttt ctatattaga ccagaatttg atttagtttc     55860
     agatggtgtt agatctactg atttagaatt tagaaatatt tgtagtaatt actacgatta     55920
     ctatatagat acctatggta ttaatgtagt taatttaagt ggttcgatag atgaaagatt     55980
     taaagcagct accaaaatta tcaacaaaag atttggaaat ttaaggaact tttaaggata     56040
     cttagtatat aattataaat ataaataaaa ataaaaataa aaataaaaat aaattagatc     56100
     ttttaaatat tattgttaaa cagatttaga atatagccaa aattgtgagc atttcggatt     56160
     tcctaacaga gaaaatcata gtagagttgc tcctttttct ttagattaca atgtaactta     56220
     attgaaagct taaaaaattt aaaaaagttt aaaattttca aaatctgaac agagaagatg     56280
     ctcacaattt tggctatatt tcagttttaa attctaaact tagaatgtta gaactataaa     56340
     gacttttatg tgcagaacac catacatact tcttatttaa tcgggttttt gttagtataa     56400
     acttagcaca tctgaagtct ttatagttct aattaatgtt cagaatagtc tctaccttgc     56460
     tgagataagc gaacttgtgg atacttctat aatattttta tgaaggactg gaggtagaac     56520
     actaccacaa actcaagaca ttctttagaa ctcgtacatc ttttctatcc ttatattttt     56580
     gaaggaccat tacttgctcc tatcagaaga tttcacacta tagtgttaca tttcgatttt     56640
     agaacttaaa ataatcttaa accataaaaa tcatcaaaat aataaataaa acaaaagcaa     56700
     aggaatggtt taacagttat gtctaacaaa attgaagaaa ttaaaaccgc actaaaatct     56760
     ggtgcaaaag ctacaaaata ccgtgttaaa ctttcatttc caacagaagt gcaacataaa     56820
     atggaattac aaagcttgaa ctgcttagct aaagctacta gttttccagg tgtaactatt     56880
     ggacaaattg aagtatttaa ccaaggaaga aagcttccta tacctggtga tacttcgtat     56940
     gatacacaat ggaccgtaac attttatatg gataatgcac accaaactcg taaagacttc     57000
     ttaagttgga tgaaagcttg tgacaacttc caagcaaata cccattctgg taacccaggg     57060
     ggcttattta cagaagtttc ggtttgtcaa ttagattcat tagaaaatga agttgctgaa     57120
     tatactttaa gaaactgctg gccgagtggt gttggtgaaa ttagtgttgg tgctgatcaa     57180
     ttagatacat tacaagaatg tgatatcaca tttagcttct cagattggat tatttctaat     57240
     ggatctgaat ttaatatgcc acaagatggt aaatcggctg ctactaacgt agtttctgta     57300
     gaccaataat tcttaagagt ctggattttc caggctcata aatacttcaa aacggacaaa     57360
     atggatagtt taaagttagt taaaaatctt attaaaacca aatcggttga aaaaggacag     57420
     attttaaaac ctggtaattt agtaattttt aaatataatc ctaaggacac cagtgttaaa     57480
     tatgatagaa ctccattgtg cctagtactt agaaaatcta aatcttatac cttaggtata     57540
     aattttcact ggtgtccaat accaatgaga aaaatgcttt taaatgccat atttcgatta     57600
     aacaaaaaga atattaaaga gaataaacca ttagatatag attggtatag aattaagcct     57660
     atgctcaaaa agtttggatt ttttccaata ataagacttt atattaatag tagaatatat     57720
     agaagagcag tcaaaatacc taatgaaaat atgaaacaaa ttatagaaac taaaacagaa     57780
     acttttatag gtgtttctgc agaagttttg tataagaaag ctcttaagga ttcaaaagtt     57840
     tcaagtaaat ctaaaaaata aaacattttt taatttaaag cttataatat tataacatat     57900
     aaacaatcta aactaaagtt taaagtttaa aacacaaagc tcataaataa atcaaaagac     57960
     aaaaggctcc aatgaaaact tatgtcgttg ataccaacat cattttagat gatgtaaata     58020
     atctctcacg tttatacgat agtgaaaatc gtattataat ccccgaaaca gttatcgatg     58080
     aattagatgc taaaaaatca ttattcgatg aagttggata ccaagctcgt aattttgcaa     58140
     gacttttatc gaatcttgat gtcattgaac ttaataaatt caacgactat actgagacaa     58200
     cactgggtga ttctctttta aaagtaacta ttactagtaa aaaagaatat aaacacgcag     58260
     atgaacctat taatattcta aatgatagaa aaattataga agttgctaag ctatacccgg     58320
     attgtatttt tataacatat gatagtatgt gcaaaataag ggctatatcc gaagggataa     58380
     aaactgaaac atttggttta aaaaaagatt ttaatgaatc accagagttt tttaaagttc     58440
     tcgatgttga agaattacca gaaaacctta gtagtatttt aagtatagat ccagattata     58500
     aacacgaaaa ttacaactac ttaattcaaa gtaaagatgg taataaaaaa ctagcaagaa     58560
     tacaaaatct tagaatcaat tacatagatg aaaaacactt agaaaaacaa gatgttaaac     58620
     ctattaatat acgtcaaaaa tatttcgtgg atgctatgtt agatactaat gtagatttac     58680
     aagttgtttc tgcagtttca ggatctggta aaagcttatt agctattgcg actggtatca     58740
     gattagtcaa agaaaaacaa tacagtaaaa ttgtttatat acgcaactca atcgaatctt     58800
     tagataaagg tgaggatatt ggatatcttg ctggaaatga tgaaaagttt gcggttttta     58860
     atcacccact atatgattct ttagaatata ttgttagaaa aagacttgaa agatctaatg     58920
     ataacaaatc caaaaaaact aaaattgata atttaaaaat acaagaaggt atcaaagaac     58980
     tcattgagtt agctggcatt gaaactatgt ggattggtgc tttgcgtggt agaacaattt     59040
     cggatgcgtt tgttattgtt gatgaatcgc agaatttttc atctaaatct atgagcgttg     59100
     tattaacaag gattgacaag gattgtaagg ttgtgataat cggatcaaat acacaaatag     59160
     acaatcaata tattaataag tataacaacg ctttgacagt tcttcaaaac gcagttaaaa     59220
     atcctagtat aattaatact tggggtggtg agttaattaa tgtggttcgt ggacctataa     59280
     ctgagtttgc tgagcaaatt tttaataaag attcaataca agaaccagag actgtgaaat     59340
     cttttgtaga ttctggcatt agcgcacttg aagtgaatgc aaatactgag aacttagaaa     59400
     caaaattaga ctctgctagc taatttaata ttattttaag tttattacta tataattaca     59460
     ttaataaatt gaaggaaata aaattaaatg attttgactt cagtatttag tacaatatta     59520
     aaaagaagta tattaataca taatttgtaa taaataagtt tattataagg taatctgttg     59580
     caattatggt ataaaaatca aacgattaaa aaggatggta aatgacattt acagaattta     59640
     ttaatgaagc tattgttgat gatatgctca gtgtggttaa ggtggccaac agcaaaacag     59700
     gcctggattt taaaaacgat tataaaactg tagaatcgtg tgggaagaaa gctttaaaaa     59760
     ttctacgcaa gcttgcagat ggtacacata gcaacaaaca atattataaa ctttataatg     59820
     acttgctgaa tgaagtgtgg aatataaatc aatatctgct ttattataaa gacaagatgc     59880
     cttggtatag agaggaactc caatcacaaa aattgaaaac atacaaagaa aatatccgtg     59940
     attatataga tgatattagg caggctatga aagaattaaa atccgattat gcttctgttt     60000
     ctcacattag taataaaaat ctggaaacca atatagaatc tattatagac gaatataaaa     60060
     gattgtataa aatagttgaa aaaatcgcaa aacaagccaa taaagccaat aagtaaaatt     60120
     attagaaaat aaatctgttg gaaaacttta tcgtatcaca agagtaggtt agaattaatg     60180
     tgtatattct atcctataaa aatcaaaagc acagcaaaag gcagctatta catatcatac     60240
     aaatttaaat ttaataagta ttacgttttc ggtgatagag gcggagaagt atttgttgaa     60300
     aattataagg atgctttaag agtagcagaa tggatggata acaattcata attaagtata     60360
     ttttaagtct ataatgatat aattacatta ataaattaaa ggagataaaa atgaaattag     60420
     tagaaaataa attattagaa ttaatcaaac aaaatggtaa tattgttagt gaaagtgatt     60480
     ttataatgct agaacaaaga cttgatatag atgataaaga tttaaaattt gcttttaaag     60540
     aattaatcaa acaaaataaa attatgagtg tttgggtcaa tccaagtact catttgtgtg     60600
     ttaataaaaa agatttcgag cattatgaaa taggatatag tgtaatttat ccaaaatatg     60660
     acttagagtc attattagca taaatactaa aaacttcagc ttaatttgag tctataatga     60720
     tataattaca ttaataaatt aaaggagcta aaaatgaata aaaataaaaa attttgtgat     60780
     aaacaataca ataattgcac attaaatgat aattgtcatt gcacatacag tgagtgtcag     60840
     tttggtatcg aatatgttat tgttatgact acagttatgg ctgttgtgtt agtgattgaa     60900
     tatttttctc gataaaagga ttaatttatg gtaaaagcca gtggtgtcgc tattgtacct     60960
     gatggtatcg agtttagtga agagacgaat gaattttggg atgaaataac taataaattt     61020
     ttagaagagt atcctacgaa atattctaag caagaaagaa tgaacttcct aagagcttgt     61080
     ggtataagag tagatttaga atgtgataat gagaataaag aaaggtttgc tatggacgtt     61140
     aaaaaattaa aagaatcgtt agaaggtaaa gatcaaggaa aatatttctg tgagatattc     61200
     aataataacg ttgatatctt ggttattgat ggtggtatga aaaaacacga agctatagtt     61260
     caagttttag aagatgttaa aatattatat aaaaatgatt aagtaaaaat ctgaaattaa     61320
     ataattttga tttcaggtaa taaaatattt tttttaatta aattaaatag agaatcataa     61380
     aaattaaaac aaaaggagat tgattgaaat cttatttaga agactactta gaatctatct     61440
     atgaaaacga ggacaaaatt cctaaataca atgtaaatca atattttaga tcaagtgaag     61500
     aaattgaatc tttagatata gattatgaaa ctattcttat agctaaggat attttgagaa     61560
     acccagatgc ttatacagaa gaagaaatag atttagtttt aaacggtgtt ttttatattg     61620
     caaataattt aaataaaatt tgcgaaataa taaacacctc agaaacaaat tatctcttag     61680
     acacagaaca cttaattgat atgcttatgt taggtgaaaa tagactacaa aaattagacg     61740
     acgttacttt aaaatttgcg ttgaatgcta tagtgggtgc tactatcgat ttagtagatt     61800
     ctttattatt tggtttagaa actttagctt caattaaagc tgagtctaag accaaaccca     61860
     agattgaatc taaaactaaa actaaaacta aaactaaaaa ttaattttat tttaagtaat     61920
     tttaatatat aataatgtaa atccattcaa ggaatattaa tgaaaacaga aaaagttatt     61980
     ttaggtgtag acataggtta cagctttgtt aaagtttgtg taggcactgg tgatggtcaa     62040
     ataattaaaa agtttaaatt tccaagtgtt ataggccaaa ccaaaaaact tgaaggtgtt     62100
     caaaatgata atatagttca ttacaatgaa cgttattata tggtaggtga agatgctaaa     62160
     catttaccaa gttctaatat catagattta gatacttata agaatttaga atattttgga     62220
     ccattgttat tgaatcacgc agtgaaaatt gctaaactca gtaaagtaga tttaatagtt     62280
     tcaggattaa gtattgcaga aattaaacaa tctggatatt ttcaaaatgt actaagtcat     62340
     tttgtggttg atggtactga atacaattat aatgtaatgt tattacctca aggtgctgga     62400
     gctaagttaa gttatgaaaa attcggaaat gattttccaa atcttcaaaa agaatactta     62460
     ggtgattcaa catattgtat tgtggatatt ggattcaata cattagattt agttcttgtt     62520
     aataaaggag ttacttcacc agaattattc gaaggaattt cacaacacgg attgatgaaa     62580
     atagcttcgc aagttgctaa attagtaaat gaaaaacaca acagatctat ttcattgcca     62640
     gaggccagag aaatcttaga tacgggtgtt tataaactaa gaggtcaaaa atatgattat     62700
     gctaaagaaa ttgaaggtat taaaaaagaa tacttaagag aaattttagc attagtaaat     62760
     gaaagatata gcaatatatt ggataaacta gatttcttgg ttgtgctagg cggtggtgca     62820
     cacattttca aatcttcaag tgatggttat attcgttgcg ttatcaaaga tactgagtat     62880
     tataatgcta ttggagaatt tatatttgga actaataata tagattctat tgaaacaaat     62940
     gattaagaca aggagatttt atgtttaata taagcaaaac atttgaatgt tgttacggcc     63000
     atagggtttg gaatcaatag gattatttaa ttgaataatt tagattttga agaattcaaa     63060
     ttaaaatata attttattga tcaagctgat gaagtattta aatcttatgt atatgaagta     63120
     acttcaaata ttgataataa aaaatacata ggatttagaa cttctaaaca aactgatctg     63180
     atattcggat ttttggagtt acggttcttc aagctgtaga aaaatgatat tttaaaaaat     63240
     cctgacaatt acagtttaaa aatacttaaa gtttttaaca acaggttaga agcactttat     63300
     tacgaagctt ttctacataa aaaattaaat gtggttataa acgacgatta ttttaataga     63360
     gctaatagtg aatgtgaatg tgggtatgct gacgttactg gcacagtttc cgttgttgta     63420
     aaaaatacag gtgaaagaaa acgcgtaaat cttagtgaat attataacaa cctagataag     63480
     tatataacat acactagtgg ttatgtaacg gttagattta aaagtaaaaa aaactttttt     63540
     aatgtaacaa aagaggagtt ttataaaaat agagaattat attttacaac taatgaaggc     63600
     atttatttca tcaaggatgg tgatggcttt agaaaaataa aagattatga atatgattct     63660
     acagaacata tacttttatc aacttcaacc acgtgtgttc tatgcagacg acgaaattca     63720
     gacgatctct ggataaaatt gcctaaagat ctttacaata aaatagattt tgaaacacct     63780
     agagaagtag taaatagaca ggagaataaa aataaactag gtgttgaaac attagatggt     63840
     aagtttgtgt atataaaatt agaagaatgg gacgctgaaa aacataaacc actaaaattg     63900
     aacaatgtta agaggttgga tgaaaataag agaatagtag aaaaacaaaa cataataaaa     63960
     agaaaacgcg taaacgtttg taatagaaaa ttagagattt atgaaagtat attcaacgat     64020
     tctttagaaa attaccacga gataataaat gaatctttga ttaaatgtat gttagacggt     64080
     aaaattttaa aattaccatc atctatatat aaaaaattta aagaacaaaa acgtaatatt     64140
     gaatacttag gtgcgcctaa aggtgtagtt ccagtatttg atacattaac taataaaaat     64200
     actagaatac ataaggatat cttttatgct aatcgtgata gatatattgc gttaagttct     64260
     aagaaaatgc gaaatttaaa tagaaattaa gatttgttat attataataa agaaaattaa     64320
     ggagtaaaaa atgaaaacat ttaaatggac tatagacaaa caatttgatt tttgtatggg     64380
     tcacagagtt tggactcaaa cattagatcc aaaatatagt atcgatagta tttgtgcttg     64440
     cagacatcat cattcgcaca gtggtgtaat aaaactattc ttaggttcag atgaactaat     64500
     caataatatg gttttagatt tcaaattttt aaattgttat aaaaaactag ttgatgaagt     64560
     tattgatcat aaatttgttt gggattttaa tgatccaggt catattcacg aattaccaga     64620
     attatattca gaatctttag atggtttaga tccacaatat ttcgatactc aagaatatgg     64680
     atataaaact attaaacaat ctgttattga tgaaataaaa tctaaataca gccaaacaaa     64740
     acataaaaat gctatacaag aaaaattaga aggttttgtt ttcgttgatt tttgtcctac     64800
     tagtgaaaac ttatgtaagt ggtggttaga aatagctgaa aaaatgttaa aagatttaga     64860
     cgtcaatgtt gtagcagttg aatattggga aacaccaaaa tcacattgta gatttttaaa     64920
     ccctaaattt tcataatgta aattcaagga gcttttatag ctccataatt aatttttaag     64980
     cttttttatt atataataaa acaattttag attcagacat ataacaccaa ggtgtaaaat     65040
     ctaaaaacta agtgttacac actagaatct aaaatacagt cataatcacg caaaaacacg     65100
     gtcaaaatcg actttaattt tttgttatgt aaaagtatta atttacgttt aaaggagttt     65160
     aaatatgatt tctgcaattg aattatctaa tattaccgtc aacccaagta ttcaaattat     65220
     tcgtttcttt aaagacttcg aagaaacaag tccaggtaag ttcgaattat ccgatgattt     65280
     tgatctaagt actgaattat tttttataga tactaaagaa tctattgata atattattaa     65340
     attaattatt ttagatccag aattaacaca aagtgtaaag tttggttcaa ttaaatatga     65400
     ttttattata aacaataaaa atttatatag aaaaattgtt attaactcag gctctattat     65460
     tgacaagttt agtactatac catttgaata tggttatgaa gaaccatcta aggatacact     65520
     aaaagaattc aatgaattta tagaattaac tacacgcaat tatttattca atacaaagaa     65580
     cccaaagggt ataattatta caaatacaaa agatttaaaa ttcgatgaac ttaatgattt     65640
     tttaagaaat tcaggatcgc aaacattttt caataccgat actagagatt ttgatattct     65700
     tagacgtgaa tcaactatgg taactccgga taatattttc tttaatcgtg gggtgaatta     65760
     gtttgtgtta atgattttat tgacccatta aatgttttta aacgtactac agtaatgctg     65820
     ttagcatctt aagtatttta gtatttagaa tgtgctagca gcttaaaatg ttataaatat     65880
     attaattaag gaacctaaat ggcccagata ttgagtcaag aagaaattga tgcattatta     65940
     gatgatgcgg aagtgcctac attcaaatat atttctgata tattggatgt aaaaaatcga     66000
     aatattagtg aagaaataag cgtcttaaga tcgcaagcat ctaagatacg aagtttaaat     66060
     atattactta aaacagattt attcactact tcagattatg tgggtatcgt cagagattta     66120
     ttagaaatat tagaatcaaa agtagaaaaa tctgaaatga tttcagaaat tagttataat     66180
     ggtgaactat ctaaaaagga tattttaaaa gaaataaaaa gtttaaaatc cagtttagac     66240
     atagcctata tcaaaatgac ataacctatc aaaacatttt gataatataa ttaaaggata     66300
     tacatgtacg aagcagctat caataatttc ttaactttaa atcccggcat tagaaaagaa     66360
     acacatttag aatctgcaaa atctatatat ccttggttta aagatctctg gaatcttgta     66420
     aaagattttg attataaatt aattggtaaa ccatatggat gtactcctat gttagaagca     66480
     atgggaatta caaattatga tagacctggt atagaacacg attttataga ttgtatagac     66540
     tatgcagatt ataccttagg taatgcctta ggtataggca taggaatgaa gctagcaaaa     66600
     ccagaagcta aaatctttgt tttaatttct gatgctcagt tatatatggg taatgtttta     66660
     gaagctttaa ttttatttaa ggagtttgat tttaaagatt ttttaatttg cattgattat     66720
     aataataaag gatctaaaga atataactca tttgagttta ataatttgaa tctttttaaa     66780
     atcacagaat gcaaattaga tttagaacca aatgatatta ataataaaat tatagttttt     66840
     aaacattaca atcataaaat tcttaagtat attttaaatt aaactacatt taatctatat     66900
     ttaaggcaag atatcgtata atacacaaaa ggtaattaaa atgaataaat cagaatttag     66960
     aatatatcgt ggtattgttg ttaataatga tgatcctaaa aaaggtggta gagttcaagt     67020
     tcgtatattt gaacttcacg gaatgagtga aaatgctacg cctggtcaat acccagtaac     67080
     ttctggtgaa aaagacacta aatataatca aatacaggaa agcgatttgc cttgggcaga     67140
     agttatgcaa agcattgatt atattggtta ttacccagca ccttcagatg gttcagatga     67200
     atacgctaac aatatagacg gtaaaggttc taaatctgga tacaaaacta taacaagatc     67260
     tggaaaatat ccaggatttg gttataacgt tatattgaca ccaggaactt gggtattttg     67320
     tgtcttagac aacaataacc caaacttacc tattgttata ggctgcatag ctgcagataa     67380
     tgaaatacac aaaaatacaa aacctaaaaa tactagagta tatgatagta ttacaggtca     67440
     ttacgaagaa tggagtgatg aagatggtaa tattattttt caccacagaa ctggtactac     67500
     aattactatg aataaaggtg gtgaaatgac tatcaatact gtaaagaata aaaaagaata     67560
     tacacaagaa aataatttat tacacgtcga tggtgaacaa aatgaatacg ttaaaaaaga     67620
     cgttaatgag aaatacgatg ctaaccacaa tttaaatgtt aagtcaaacg aaaagttaga     67680
     agtcggctca gacagaacac gtaaagtagg aggtaatgaa aatgtgacaa tttctggtaa     67740
     tcagaatata aatgtgtctg gtagcgaaac aatttcagca ggaccaagca ttactatgac     67800
     tgctggagtc atcaagctaa actaaattaa accagctaaa ctaaattcaa cgaaaggaat     67860
     taaatgaaaa tattcaaaaa tattaagttc ttattttatg taatgctagt aatagcaatt     67920
     atttgtgatg ccgtgtcttt aattacggca ggcaaggtta ccgtagagcc agcaacttat     67980
     gctttgattt tagtagctat ttgtatagaa gaagttatat acactcgcaa taaaattata     68040
     gaagaaatta aaggtattgg tgttcatatc aaattaaatg attatttaat atctgctagt     68100
     aatgccaaaa ctagatattt aaatacaaag cctgaaaccg aagccggggt aactaaaact     68160
     aaaactaaag ccaaagatgt taaaactgag tctaaagcta aagatgttaa aactgagtct     68220
     aaagtatcaa aagctaaagc taaatctaaa actgacaaag agatattaaa agatatgtta     68280
     aacggggcta aataatgcct cctttaacta gagttggtgt tgattttagt acaggacatt     68340
     cttcattccc acctaatgta gtttcgagtg gttctacgaa tgtcttgact aattcaatta     68400
     gtacagttag acaaggtgat cctataatac cacacggaag tcctagcccg tcaccaccac     68460
     acggtgggag tattgctaca ggttctggga ctgttatggt taattcaaaa cctgcttgta     68520
     gaataggtga tgccattagt tgtggccaag ctgtagcaca aggatctgga aatgttattt     68580
     gtggataaag atttctaatt aaggagtaat atatgtattt tatttctttt agtgaaagta     68640
     taagcaaaga tgttgaatta atgttatttg acaataattt tcgacgtatt gctaataatt     68700
     tttatataaa tgcttctact aaaagtatgt cagatacata taacttcctt tctgaaaatt     68760
     atttcgaaaa tataaaaata tattatggta gacttggaga tctttcagtt tgcgaagatg     68820
     gtaatcttaa atttttagaa gttgataata taacaaagtt ctaacctatg cttgttatac     68880
     taaaaatgct gaaaatacta gacttataaa gctatgaata cgaatgctat tttaatagga     68940
     ccttgtaaat cgagaatccc catagacggt tcactttcga atgcttttga atatttttat     69000
     ttcgcttggt tgcacaataa aaatattatt cttataatag atactacttt tgaatctctt     69060
     acgattgtta aaaaatatct tgaaattaaa tataatatta ataaagattg ttttaagaat     69120
     attataatat ttaaaaaatc ttttgtgaat gttaataatt taattttatt tgaaatgtac     69180
     tgtatagatc atttcgacag atataaacca tttttaaaat gcaagaattt atatgcttta     69240
     agtggctcaa aaaatcatac actcgagtgt aattattttg tggaatacga gcatttaaaa     69300
     cctgtcggca aatcagtcaa ttatagaagt aaaatatttt ttgagatatt gaataaacct     69360
     agatttcaaa agaatcaaaa atttattaat accagagcaa aatacattaa aaaagaatct     69420
     gaaataacga gaaacgatct aaatattatg tctaatatat tcgaacaatt taatgaaatg     69480
     ttatatatac aagatcctgt attttttgac gtaaaaccta gattatttca agaatgtcaa     69540
     tattttggta ttccttatga gtttattgaa cataaagatt gttttgatgg agctaattta     69600
     agagcatttg actatgattt agaatccaga gctatgggac ttgaagaccc tataatatca     69660
     ttattagtgg attctaataa tacagacaat tcaagcagtg caagcaattc tagtaatgtt     69720
     aataatacta gatcataaat aaatcaaagg agtttaatga aacttataga ttgttttaaa     69780
     gataataatg attctgctta tatttttaaa ggttttatat attattatat ttttaaatac     69840
     agaatacaaa tgcttcaagg caaaagttat attatcataa cttgttatcg tggtaaagat     69900
     aatgaatacg tagctataaa accaaaaaaa ttcaaaaaaa ttattaataa attaatggaa     69960
     gaaaaacaag cagatatatt cgtgatggaa ggaactatta aattaaactc agtgaattct     70020
     aaaaatttca ggtttacttt agattctgga atgtatttgt atataagaaa caaatcctag     70080
     attaatctgg gtacttttgt gcccaagatt ttcacaaatt atgaacagta tttgctattt     70140
     actagccaca agctgataat ttaataaact tttaagttat ttctttatat aatataattt     70200
     taataaagat tttaataagg attttaaaat gaatttaaaa agtcaaattt gtaatatttt     70260
     cagtgagttt tcttttgaga agttaataga aagatttttt acggggttat ttgttttgtc     70320
     aatagctata tttgtagttg ttttatatac gtttatgttc ttgtatttag tcagtgtcat     70380
     aggttctata actattgcta tattattgtg cgttgttttt acaattatag tgttgttttt     70440
     aggttcactc ttagctgtat aatatataaa taaattaaag ttgtttatat aatgttgaat     70500
     ggatttgagt atattaattt taacacacaa tagaccaaaa ttatttaata ggtgtttaga     70560
     atcactcaaa aaaatatcga attagatacc ataggcatta attacgaaat acttgtgggt     70620
     aatggttctg atgctaaaca ttaggagtta aatgtgcttt atacactaga cgatattaag     70680
     gttgttgata tgggattgtc taacagatgt aacttgcgct gtgtattatg tccctatgtc     70740
     cataaaaaaa tatatgaaca atcgccacac tatgtaaatg tctctaaatt aattgatttc     70800
     ttagataaat taaaaaatat tgaagttata ataattgaag gtaattattg tgaacccaca     70860
     ttacacccag aattacctaa attattagag tatataaaaa cacgccctat agacattcgc     70920
     ttgtctacaa acgctagcac acacaatacc gaatattggt ataaaatggg gtcactatta     70980
     aaatctaatg atattgtgag atttgctatc gatggatcta cgcaagaatt acattctaag     71040
     tatagagtta attctaaatt agacaaagtg cttgaaaatc atagaagttt aaaatcaaat     71100
     ccagattttc gtggtattac tgtcttacaa aatatacaat ttacttacaa tcaaaatgat     71160
     aaagaaaata tttataattt atttaaaaaa gaaaagtttg attatttaag ttatttgaag     71220
     tgttacccta ctagcataca aaatcaaagt gaatttaacc caccaacaaa gattaaaaaa     71280
     tatatggatt tctatgagaa attacttaaa acacaaaaag atatcagtgt tatatgcgat     71340
     tcatttaaca gacacgaaat ttacgttaat catatgggta atataaacat atgtggttct     71400
     ttagatgaag acgaagtcca tacaggtgtt aatatagaaa gttctaatag cgatattgaa     71460
     aaatttttaa atacacgttg gtgtgcaccg aaatgtggag ttacttgcca gagttgttgt     71520
     aattactatt gttatacttt gggtgaaaaa tatccagata ttttgataga tcaaaatggc     71580
     gtcagattag aaatgaatta ttttactaaa gaattaaaaa acgaagaata taacgctggg     71640
     cacaggataa ctagaagtaa gactaattta atatgactaa aatttactcg attaacgaag     71700
     attataaaaa ctacgatttc catatagagt gggtgttgac tgacgaatgt aatttcagat     71760
     gttcatattg ttttagagca tcaaaaccta gaaaaccaat accaaaagat accattatga     71820
     gggttgtaaa acaacttaat gattttagtt tacgatacaa gatcaaagtt ataatgactg     71880
     gcggtgaagt aactacttta ccttatttcg aagaagttgt aaaaagttta aatgaaaata     71940
     tagctttaga attaaatact aatggtatgt tactcagcaa tgataattta ttcaagagat     72000
     ttgaatttat atctatgtct ttacatagtg aatatttcga aaaacaaaaa tctaagttag     72060
     ataacatact taatttaaag gatactatac atttaaatat agtatataat tataaaaatc     72120
     ataaaaaagc aatagaaatg gcatcgtggt gtaaaaaata tgatttatat ttcacattag     72180
     tgaaagacca aaatgatgat tatttacttg actctaaaat attaggtgat tccagttctt     72240
     attatcataa agatataatt ttagatgttg acggcaaaaa aaataattta tcaatagatg     72300
     atatattaaa taataaaata tataaattat ttaaaggtag tttttgttat aataatttta     72360
     ttacaataga atacaataaa attaaatatt cttgtggtat aaaatttttt aaaaaactta     72420
     gtgatatatc agatgataat aaagtttatt gtaatcaaga ttgtgctgat atgtatgctt     72480
     ttattgatac cacaaagata ttattaagaa aagatataca taaatttatt aatctttaag     72540
     gtacaattat atataattaa acaaaggtgt ttgatgattg ttatcactac tatagaacca     72600
     gatttaaaag atgttaatac gaccaacaaa atatttacta gatattttga aaaagaagca     72660
     atttgttgtt ttaaatgttt acgtgattat tttgatggta atatatattg tttgaattta     72720
     aacaaatgtg atataagcaa tcaaactaaa tattattttg agaaattgaa tattaattat     72780
     attcattcat ttgacgatag aataaaaaat cataagtgtg gtttttggaa tatcccacta     72840
     agtggtatat atttcgaaag tatgtttcaa gatattaatt cagttatgct tagaatagat     72900
     ttagatatga tgctattgag agcattacct gacttagata attttaaaac acctgcagtt     72960
     tcacctcaca cacaaggctc acataagtac ttagaatcta aaaaaggtgt attgtataat     73020
     actggtatta tgatatctaa accttctgat gaattttata aaaagcaata tcaattatta     73080
     aatcaatttg ataaattatt aaattataaa gaatatggta aactatatga attaaatata     73140
     acaaaaaatc catcactcaa ttctttagaa tatcctttgc ttgaagaatt gtgtgtaaat     73200
     tatatagaag gtgttaacaa acttgaaata ggtagcatag aaggtgatga atacgaggct     73260
     atccaagatg cttattttta tcattgtcat tacgaaccag aaaaatctca aaataaatta     73320
     aaaattttga tacaatattc taaaaaatat aatttatcta aacatattaa ggattatata     73380
     aatgaacaaa tacaacatag tagacgaaac taaaactata gaattaggtt tattaaataa     73440
     atgtattttg agatgtccta tgtgtttaag acaagaagct aatgatatcg atatagctat     73500
     accaaaagga tatacgaact tcgaaaaatt aatagaaact ttaaataatt ttaaaaatat     73560
     aaatcgtatt gatatggtgg ggtctgtagg cgaacctaca ttatatccac atatatttga     73620
     acttttagaa tataataatt ccaggaatat aaaaagtata ttgtctacaa atggttcaac     73680
     taaaatagat tgggctaagc taggcaagac tatgaagaaa ggagatataa ttagatttgc     73740
     gacagatggg tctacccaag aattacattc taagtataga gtaggttcta agctagcaga     73800
     cgttttagaa catcataaaa tattcaaaga gaattcagaa gctactacaa taaatcagtt     73860
     tataattttt aagtataatg aaaatgatat agatgaaatt attaaattat caaaacataa     73920
     taaatttgat tatttagaaa cgacacatac tggtgatact atttttatac acgacgaaat     73980
     tagagcttct aattcattat gtaagcgcta cgaacaatta aataattatg ttaataataa     74040
     accatttgaa aatataaaat gccttatgta ttctttaaat caattatata taaatcattc     74100
     aggacatata ttaccttgtg atgatatgga agagtttgct ttcaacttct tggataaaac     74160
     aattcataat agtacatttg aagaatgtat agaacaaatt tcaagaataa ttaaaggtat     74220
     caaaatgaat aaaacttgca tacgttgttg tggtgattgt aataaaaaaa tcagaagtga     74280
     ttacccagtc ttgcaaatga gactagacat tgataaattc gaagttttga accactacag     74340
     attaactata gatgataatt aaggataatt atgattgtta ctactcaacc aacttatatt     74400
     aaaaattttt ttaaaaatgg atatactgaa aaaacattaa aaccagaaga tattgaagtt     74460
     gttgaattgt cgttaataaa tttatgtaat ttaaaatgtc ctatgtgttt aaggcaaaat     74520
     atagatttta aaatgaaagt aaatcattta gatttaaata atctaaaaag atttttaaat     74580
     gacttaccta atcttaaacg tgttgtatta atgggtgctg tttgtgaacc tacattatat     74640
     ccacatatat ttgaactttt agaatatatg aatactagaa atattaaagt tcgtttaagt     74700
     acaaatggtt caactaaaat agattgggct aagctaggca agactatgaa gaaaggagat     74760
     ataattagat ttcctgttga tgggtctacc caagaattac attctaagta tagagtaggt     74820
     tctaagctag cagacgtttt agaacatcat aaaatattca aagagaattc agaagctact     74880
     acaataatgc aattcataca atttgattac aatagagatg atgaaggcaa tattaaacaa     74940
     atgtataaaa attccacatt tgatttgtta gagatatgtc cttgttacga gccgcctaat     75000
     ttagacccaa aagcatctgt aaagcctaga actgaattac ttaaattttt taaaatgaaa     75060
     gataacttgc gtaatgataa atcagaagtg cttggatgtc ctgaggcagc aatgaacgca     75120
     atttatttaa accatatggg tatactagtg ccttgcaacg aacaagaaga ttatttttta     75180
     gataaacccg atactattaa tattaataaa aatacaacac aagaatgctt tgattttatg     75240
     aataacatac ttaaaaatat tagatgtaat gaagtttgta aaagggcttg ttcgaaaatg     75300
     ggattaaagg aatgtttttt atatcctatt tttcaattaa atagagaaaa tacaaaattt     75360
     gaacttgtcg attttaggga gtgtatgtta aatcgatgaa atttgaattc tattataaat     75420
     ttaataaaaa ttttgaatta ataagctatt ccaactcagt atacaatgat tctaaatcaa     75480
     aatgtattga atataatctc aataaagaaa gaattagtga atatcaagat aattattcta     75540
     tagatttagc tactaatatt attgattcat attatataga acttgattat gatagaattt     75600
     ataatattgt taaaaaccta gataaaacta aattaaaaaa taattcgata ttttatgaac     75660
     ccctaaaaag agtaccaagt gggtgtcgca gttcaattaa gttgacgctg gatgttgacg     75720
     attcgggttt tcaattaatg gttcgtaata cagagatatt taaaaaatta ctaaatattg     75780
     caaaagaatc agggatcaat aaatggttat ttaaaaaata tgaaaaaaat ttatatgatt     75840
     catttatact atatatatat atatatgata ataagataac aaaatattgt ttactttttt     75900
     acggagaaat taaatgactc agacagaatt tggtgaatta aaagaagtca tagttggtag     75960
     agaactagaa atcagtacca gaagttttga taccacgttt aaaatttttt ataaaaataa     76020
     tataagtgat tattattttg cagattttaa agaatatagt attaatagcc aattagttgc     76080
     agaacgtaat gaagatcttg ataatttagc taaaatacta gaacaaaatg gtgttaaagt     76140
     atacagacca gaaaaggtta aagataagat ccaaatacaa acacctaatt ttaaatctat     76200
     ccattctagt gcttctaatg ttagagatct tgtatttaca tacaaagatt tgatcgtaga     76260
     aactccggtt caaatacgca gtagatattt tgaaaatgat tcaatgtatg atatattcaa     76320
     agaaaaaatg tttaaaggtt ataaatggat aaaagctcca ttacctatgc taaaagatga     76380
     aactatggat cttaaggatt gggatgcgcc tagagatttt gataatatct ctatgaagtg     76440
     ggatttaggt gtagatgcag ctcaatattt aaaaattggt gacgatatac tttgcaatta     76500
     ctctacatat aaccattata tgggtgctaa atggtttgaa aatataatga aagattatgc     76560
     taaaatatgg tatactgaag ctatgataga taatcatctt gatggtaata ttttaccact     76620
     ggattttggt gtgtttttag taaatgatgc agcactacat aaacctgtta aagaatatct     76680
     gcctgaaaaa ttccataatt ggaaatttat aagtactaat ggtgatttta aatataaaca     76740
     aaaagattac agtgattaca acacaccatt tgtccaatta tgttcatatc gtggtatgga     76800
     tatgaatgta ttgagcatat caccgaaaaa aatattagta aataaagatg ctatagctgt     76860
     acaagacata ttatataaaa atggttttga tgtgatacca gttcgattaa gacattgtga     76920
     attattcggc ggcggtatac attgttcaac tttagattta gtgagacaag attgaaaata     76980
     cctaaaagat ttactataca cataacatct aattgtttac tcaaatgtaa cttctgttgg     77040
     ttacaaaata ataatgtaag tcgcgatgtt atgagcatag atttatttaa aaaaatagtt     77100
     gcttggttgg aagaacaagg tgttgaagag attgatttaa cacctatggt tggtgatttt     77160
     tttacagtca agaaccatta tgaatattta gatatagtag aacagtctaa aattaaagaa     77220
     tatcatttga ttacttcgtt gacgccttct gctaattata atttaattaa atataaaaaa     77280
     ttatttttat acatatcttg ttatggtaat aatgaaaatg aatttaaaga attaactaat     77340
     gtagataagt ttaatgattt tgttaacaat ttaaaaaact taaaattata taacagaggt     77400
     gaaattataa ttcgtaataa aaattttaat ggtattataa aatcattgat taaaataaaa     77460
     aacttaaaaa tagttgattg cgaaatagat aatagagtaa acagatttgg tgaacctata     77520
     ggctttgaat cgggttgccg ttttttaaat gaacctatca tacatacaaa tggtttaagc     77580
     ctatgttgta tggattttca aaaagataaa ctcattatag gcaatttatt tgacccgtta     77640
     gaaactatat ataataatgt agaatgtagt aaaactttaa atatatgcaa taggagttgt     77700
     gggtggtatc aaaagcgtta attactacaa tagaaggtaa tggtggtatc aataatatta     77760
     aattaggttg gtgtagagat tatgagagtg aggctattaa atgttttaat gaatggcgaa     77820
     aaaatgctgg tgaattaaaa gatattgata tatattgtta ttgttttact aaaaacatta     77880
     ttagtgaaaa aacgaagaaa aaattagaaa aattaaatgt taaatatata gagtatttta     77940
     tcaacgaaac tgattcatat gaatgtggtt tttggaatat acctttatta ttaaaatatg     78000
     tgaaagaaaa attaaattat gactggttta tcaaaataga tttggatatg tatttaacaa     78060
     gaccattacc accacattta ttcgaatatg aaacttcgtg tggcagatat acatttactg     78120
     aaatatttaa cagacataat aatttcaaag atatagttat aaaatctggt atagattttt     78180
     gggatacggg tttggtcatt tatgataaaa actcagcatt ccccgaatta ttttacaaat     78240
     attgtaagaa attaacagac ttgcattata ataataaact attagattat ataaattctg     78300
     agttaaatat taatatagat aaaatagatt ttgatattat tgaagaatta gcttgcatat     78360
     ttgtttcaaa agaaatgcca attaaatcag tgtataacta cgctttaggc acttatcaag     78420
     atcctattca caaagtcaaa aaagaaaatc ttaaaaatat atgtttcaat cattatcatt     78480
     taggtacaaa tgaatgaaaa ttgcatttat atgtgtagtt gaatctaaca atacttatac     78540
     cgataagaaa aaacataaaa gattgtacga aactgaatca ctgaaatgtg ccgaactttt     78600
     aaaaaaatac acacagtgtg atatttttta tatatgtcct acaaataatg gtgttgatga     78660
     aaataccaaa aaaatatata gtaacttagg tgtcaattat atagaaaaaa atatttataa     78720
     tgatttaaat cttgaaccaa aagatggctt ttataataag atatatggtt gcactttttt     78780
     agaatctatg ctaaaaaaca aatacgatgt tttaattcat atagatttag atatgttttt     78840
     agtgagagat ttttctaatt atttaaatga tttagaatta gttgattctt gtttaatata     78900
     cgatgatata caagctcaag atgaacgaaa acataatata tcaaaataca tatttaatac     78960
     ttgttttata gttgacgctt cgaagaaatt atttgaaaat tgggctgaaa tagctaatac     79020
     cataaaatat agtacttata aaaatatagt aaaagattta gaaccacata aattagaaga     79080
     gctgtcgttt gatatactat catcaaaata ttacataaaa cctttaaaag atttaatgtt     79140
     tggtgaaact tatacaaatt tagatattat taaacaaaga tataatatac ataattttta     79200
     ttttcatcat tatcatatag gctctaatta taattataaa aaagaagagg ataaattttg     79260
     gactctatta taaattatat ggatgaaact gaagtaaaat taataaaaaa attttttgac     79320
     gtagatttga tcaatactca taatagtgga gttaaacata tttatgttgg tgaatccaac     79380
     ttttataata tatgtgattt ttatagtttt gaatgtaaaa atgaagaaac tgattttttt     79440
     aataaaatag agcaaattaa attattattg actaacaaaa taattaagct ctatgttaat     79500
     cgagttgatc atttaggtta ttattggtat gattatataa caaaaataga tttaaaattt     79560
     aatgtagttg ctagacattt aataattaat tatgataaaa caagtgattt atatgattgg     79620
     gttttatgca atatatgcat tagaattttt ttaacagatt ttaataaaga ttacccagat     79680
     gttgatacaa cattagccaa aaaaataaat cataatcata ttgttgaggt gcttaataca     79740
     cttttaaata aatagataga aaggatcata gtgttacgcg aagcaagggt attaaaattt     79800
     tataaggata ctttgggtaa aaccaatgat tcacacgaag atgatatatt agctggtaat     79860
     aaagtatata gagctgatgt agatttttta tgttattcac tatttaaaat atttaaaatt     79920
     gaattgggag tgtacgaggg ccagcaaaat acaggctttg tattcattag accagcttat     79980
     gaatatcaca cacctcctat aacttctatg agttataaag atttagtcca agtcaggttt     80040
     gcgttgcggc gtgtagatga actagataaa tattaccaaa attttttatt tgataataat     80100
     tgttattata caactaaaaa tggtgtagag catatatatg gtagtttatt aatcaactgg     80160
     tgcatcgctg cattgatgct tgaagatatt gctaatctca aataaaaacc aaagatttaa     80220
     aaatgaatat aaattatggt tcaatcaaaa agttttttgg gctagatcct gatgaaattg     80280
     acgtaatcca agaagtaggt gatatctttc aatttggcac tctttggata gctttatttt     80340
     ttatagcttt gtatcctacg aatatgacaa ttacacctat ggtgtggctt tatgtagctg     80400
     caggacaatt attagtatcc gctagtctaa agaaattggt ttctaaatac tttcctaaat     80460
     tatcagttag acccaatgga ggtaaagatt caatgccttc gggtcatacg tgtgctgctt     80520
     acgctggttt tggttgttta ttttttggca taaatgaata taatacaatt ttaattatag     80580
     ctactgtgat attattagct ttagctgttt ttactggatt ttcgagaata gctgcgaaaa     80640
     aacatcattt tagagatgtt tgtgcgggtg ctgctatagg tttaataagt tcttggatta     80700
     ttattaatat attttagatt cttttgttaa acccgccaaa ttttagctta atttaaagtt     80760
     attattatat aatattgaaa acaaaggaga atacaatagc taactttaaa gaatttttat     80820
     tgctacaaga gtctttgact aaaaagacta attatattaa gctcggtgag aaatatatta     80880
     atatgtttaa tcaagttctg gatgcaaaga aatatctaca aatatctctt tttaatgtag     80940
     ataataaaca atactattgt atcctaataa tgaaggattc aaagttggaa ccacattttg     81000
     gtgtctttta tgaaaataaa ttcaatgagt tggtagaagc ttttaaaaat aaagacacga     81060
     agaaaatcag cgatttagtg aatagtgagc tttttattca aaaagatggt tatctaaatt     81120
     ctgatgtaaa ttttctaaaa gtattatcat atgtgttttc ggttttagtg gattacctag     81180
     caataaagcc aataggattt gtaaaaatta tggggatacc gagaaagttc aatctttatc     81240
     aaaaggtagt aaaaaatatt atccaaaaaa atgagattcc atatcatatt gtagtagaag     81300
     agcaagatga tagctattcc agtaaaatta ctggtcaaat aaaccccgct aagtcaatga     81360
     ttttaaagta taattttgct tagtgtgtga aattctaaaa tctaaaatat gctaaattta     81420
     ctaaaatcta ctaaaacttc agtttaattt aagattatta ttatataatt atataaatta     81480
     aaaaggagat aaaatgtacg ttgctagatt taatgaatat tttggatatg actaccaatt     81540
     aatggatgtt gaaacagttg atattttaga aaatatctat gatagtttag gatatatgcc     81600
     tagagatcca gaaccaattg atttagaaat tgttttagaa gaattctata atacagataa     81660
     aatctatgtt ttatgtgaag ctgatgatga agaaattgaa ttttgttctt gtattgatga     81720
     agtagaacca gaaattatca tagatttttt gaaatctaaa ggtcatactt ttatgaattc     81780
     aaatgcttga ttgtgtttga ttataaaatg aaggagaatt atgttattag cattttttat     81840
     atatttagca agtgtttttg atacacttaa tagtgtggct aaaatagcac tttttatatt     81900
     atttgttact ttttgttttt cttttgtatt taacgtagta tcacactatg atggagacac     81960
     atttttctat aaagtaacat caaaaagtat aaaaatttgt ataataagta gtataatatt     82020
     tggtgctata gttattttag tacctaaaag tagcactatg tatttaatgg cgagtgctta     82080
     tgttggaact gaagcaagca aaaacccaga cgttgttaat aaattatcta aagtcaataa     82140
     aattatagat tataaactcg atgaaatatt aaacgagctt gggtctaaga atttagattc     82200
     taatatttca agttttaaag attttaaatc taaatattta gattctaaag attaaaacaa     82260
     attaattttg tgccggctaa tactagctgg taccagtttg tggtcatcag tgtaaaatta     82320
     cacaaaataa ataatcacaa aaagagagat tatggactac ttaaacccag gctacgaagc     82380
     tcctaaaaaa ggcaatatta aaattacact agcatctttg gtagatagct ttcaagaatt     82440
     tttaacaaaa cgtaattatt ttttatataa tataacaact aaaacacaaa taaatgatat     82500
     caaacaaaca aaagtttata atgatttaca cgaacaatta agatctataa cttatagtca     82560
     tttttatgac gattatactt tttatgctaa agataccttt gatgttgagc gtgttaaatt     82620
     aatttttatg gcttgttatt tagatttact tgaagaaaat gatattgatt tatctaataa     82680
     tgaattagtt acaaataacg atgttaatat cgaacatttt gatttagctt ataaatggtg     82740
     taatttcaat actgaattaa taagaacaaa agcatatgaa atgggtatat ttaaatctta     82800
     agctaaaggt tctaaatgga tgaaattaat tatgatgtat tagaatatat tattcaagag     82860
     catttaaatt gttctttgac tcgtgaaaaa tctgtattag attacttgaa tttagaagca     82920
     accaaaagaa accaaaaaat cacgggtgag actgaatcat ttgtggtcta caaattcaaa     82980
     ccatatatgt taagtgatga tattttgaaa ccttttattc tgtatgcaaa taaaaataat     83040
     aaaggttctt aatgatttat aatatcgaca aatacgatat aaaactctac aatgaatttt     83100
     tgaataattt atctaaacat aacgtagatt actcagaata cgtgtgtacc cgagataata     83160
     agttctattt gtcaactcaa ttagagcctt ttattctgga ttatatccct attcaaaatg     83220
     cttctaaaat gtttttgata tctaaaacaa aaggggttaa taaccaagat atataccaat     83280
     acagaagaca aaaagtaact gcttctaaag ataatttaaa attatgcatt aatgatgctt     83340
     atcaatattt catagattta aatcaaaaac aaaaaaattc tatattttac tttattaata     83400
     taccaaataa agaacgagca gaagctttgt ctaaacaatt aggtagactt tattattttg     83460
     gtttttatta taataaatac agagtttatt tgactaataa tcaatataca acaaattata     83520
     tagatcctga aaatatttta gtaagttcta gcgatttatt tgatgctgag atgcaattga     83580
     attataatat atttagattg caggatagac ttaaaaaatt tagtcaaaca ccctatagag     83640
     aaaatggtac tacagtgtta ccaaaatata tagatccatt ttttagaact caaaccaatt     83700
     caaatattaa aaactaaaat ttaaaactaa aaattaaaat ataatatata atatataata     83760
     taaaatttaa aactaaaatt taaaacaaac attcaaagga ggcaaaatgt ctaaagaatc     83820
     aagatataca aaagttaaaa aagcaccaaa aatgatttca gatgaagact ttgctgaatt     83880
     cttccaagca gccatagatt ctaatcttaa tgaagatttt aaaagaccac tcatagaatc     83940
     taaatataaa cttaaatcta atattttata cttaacagat gcttgcaatt ttgattgtga     84000
     ttattgttat caaaaaaatg atagagatcg tttaataaaa aacacgtata tatctgaaag     84060
     agaaattaat gaatttttta aagatcttat taagagagaa cccgataagc ctagcactgt     84120
     agttatattt ggaggagaac catttttaaa cccagatatt gtttattata tttttgattt     84180
     aactgataaa ataacatttc atactaacaa aaagtttaac ctatcattga ctacaaatgg     84240
     ggcatatttt aaaaatacta aaaatgctga ttattttata gaaagaaccc gcaaattatt     84300
     aaaccatttt tctttagaaa tatcttatga tttatctgga aacaccagaa gagtctacag     84360
     aaatggtaaa gattctacaa aagatactga gtttgtttta agttatttta aatctaaaga     84420
     ctataaatta actatccgtt acactgtaca taaattaaat tatatgaatg ctttaaaaga     84480
     tttaataaca ttaagtttag attctaatta taaaaaaatt gtagttaatt tctatgaaac     84540
     tgaattagaa caatatataa atgtatctga gtttaaagaa accctgaaaa gacaaacttg     84600
     tgaagtattt aaaagaacta aaatgcctat ttgtcatttg aattgtttgg cttgtatggg     84660
     ttgtaatttt gcagattttg atggtatata ttatcaatac aacgataaat catttgaagt     84720
     gcaagaaaat gcaaagatat ttgaatcttt tacagaacat tcttgattta gatttagtac     84780
     acaataaata agctaaaagg caagatctat gaaattatct gaattaatgt ttattttaga     84840
     gggtggtaat actactacaa tcaataaaaa aacaggtgaa gctaaaagtg ctgaaaaaat     84900
     agattttaat agattgtcaa tagaatcttt tagatcagaa ttcatagatt tattcataag     84960
     tcttaataga ttatttttta acaaatacaa agaaaaactt tgggctaatg attctttgat     85020
     taaaaaaggt cttgttttta atggttctac aagttatatt atgaatccta agatggaccc     85080
     aaaagaaatc tttaaatata aacaaagttc tggtgatatt gatattgtta tacctgctga     85140
     acatcaagaa aaactatggg atttattgga ttctttagaa ggtaaaacaa taggtaattt     85200
     tgaatatcac ggttgttttt cacaaaatcg tgaaaaatta ggagatcaat tattaacaat     85260
     attcgtgtat aaacccgaaa acatagcttg ccaaatagat tttgaaaatg ctgactttaa     85320
     agatggaaaa ccaacggaat ttgcgagatt tagtcacggt tcaagtttcg aggatgctaa     85380
     agaatctata aaagcatttg ctcataagtt attattaaga gcgttagtag gagctatttc     85440
     agcaaatcct aatatagttg tagctactaa gagttctaaa cctgacaata tcaaattaaa     85500
     agcagataaa agcaccccta gaatggccca attcagtgtt actagaggtt taagatttgg     85560
     tttagttcct atgttagaca aaggtgaacc agtttattac gaaggtaaac aagtatatca     85620
     agaacaagat actagtgatt ctgaatttat aacagattta aaagaaatat ttaaatatat     85680
     gtttaaatca agtgtggggt taaaagattt acatagtttt ataggtgttg ttaaattaat     85740
     gaaaaaacac tgcgatgaaa aaactattaa attaacccaa gaaagattct ttgatatcat     85800
     ttttggaatg ccagcacaat tcatagagcc aaatgatttg aaattagata gacaagttaa     85860
     attaacggct tataattatt tcttaaaaga attacatttg agacacccag gattagaagc     85920
     agatatagat agatattata ttgttaaagg ttctaaatct aaagctaaag cttaaaagct     85980
     tgaactaaaa tagcccaact cagcaataaa tatacaaaaa gtagggttaa atggctgaaa     86040
     taaaaactgg tattttatta agacgtaatc ttaaaaaaca ttttataaat gatgcaaaac     86100
     caacacaagg tgaaatcgtc cttgctaccg atacaaatga aatcggtatg cttgtaaacg     86160
     atgaaataca atggacgcct attcaaggtg ttgttaacac agttgctggt aagcaaggcg     86220
     atgtcatact aaacaaaaaa gacgtaggtc ttgaaaacgt tgacaacact gctgacattg     86280
     ataagccaat ttctaattct acaaaattag aatttcaaag acattataca gccgaaaatc     86340
     cacataatat aacaaagaaa acacttggcc ttgaaaacgt tgataacacg gctgatatag     86400
     ataaacccgt atctaacttg actcaaattg agttaaataa gaaaatttct tgggatgatg     86460
     ctaggaagca agccggtggg aaagacccgg tttttacaga tactacttat actattaaag     86520
     atggtgagct ttcagaattt aactttaatt catattataa gaatttcata gatactttta     86580
     atactaactc cagagttttg ccaagcacac aagctcttat agctaatggt aggacaataa     86640
     ccttaagaag agctgatggc tcgagcgaaa gtatagaaac gcaagatact ttatatgatg     86700
     attctgaact tagagcatta attgaacaag ctaaaataga tttgcatata aacatacaag     86760
     ataatttaga atcagattct actcaagatg ctttaagtgc taatcaaggt aaagttctta     86820
     aaggtttaat agacgaaata aagaaagtaa ttaatattac agatgatgat tttagaaatc     86880
     ttcaagatat tattaattat atagaagaaa accgcgaaaa atttgatgat ttgacaatta     86940
     ctaatatcaa aggcttgcaa gctgctttag attctaaatt aaatagagat gattccacat     87000
     acattgcgcc aaattctgca ttattagaat ctcacccagc tagcgatttt gtattaaata     87060
     caaattataa tgctaagtta atagaaatac aagattcttt aaattctatc aattcacaaa     87120
     ttaaattatt tgaaacgcaa gctggtgtgg attctaaaat aaaccaagca atcagagatt     87180
     taaatttcac tgaaactata cagagtatta atgaacaaat tacaagacta caaggctctt     87240
     tagatgatat tgatttggat gctataacag aaaatctcca aaaagttcaa caagatttaa     87300
     ccagtaaaat agaacaatta gaaactaata catctaaaaa attagaagaa tttgaagcta     87360
     ttgttaataa ttttgatatg tctgaaatac aaaaaactat agaagacttt aaaaatcaaa     87420
     ttaaccaaaa tattgatagt atacaaggtg ttgtagattc tgtttctgaa tcattagcaa     87480
     acattgaaaa taatatccaa accagtttag aaaacaaagt ttcaaaggat gaattagcta     87540
     ctgaggtcca aactattaat ggtaatattg ctgatttatc aaacatagca aatgaagcaa     87600
     aatggcaaga taatttttat tgtaaagttg atagaaggcg ccaagcttta tggtcgatta     87660
     tatctctttc aaaagacttt ttcaaaggtt catataaaaa accaaatacc tataattact     87720
     gggaagcaaa atataaaaat cttaagtata tcaatgataa ttttgatagc ttagaaacaa     87780
     tatctaatgc acctacatac gatgttgtta ctaatcaggt tattagatta acttttaatg     87840
     atatttcaca agcatcattt ttaatcggaa gtcctaagaa taaaattcaa atagctaaaa     87900
     ttatagcagt aaatgctaat actaaaaaag ctgtgtttat atacgggtat cctagttttc     87960
     tgacagacga tttatcaaaa attatggtaa ccatagaaaa agattcgagt tttggtaatt     88020
     atctatcaag agccaataaa acagatccag aaacttttca aaaaattgtg actacacaag     88080
     aatttgattt gccggatgat actgacgact attcatattt tgaagttagt tatgaaatat     88140
     ctggaaatac aataacacta actatggcag aaaatgtatt tttagaattc tatggcaata     88200
     tgacagcagt agaaacaact gttacgggtg ctggtgcagc tcaagtctgg tcatcgactt     88260
     taagatccac tgattttgaa ggtaagaaat tattctcaaa tggggtgttg ataggaaaag     88320
     atttaactgg tgcgatctta actatatatg atgataaatc aacatacata aatgacttag     88380
     atgaagctag aactaattat aatgattttc aaataatacg ggaagaatat gaggatatta     88440
     tgtacacaag agatttttta ccaggaacta tagagccagg cgacggcgac ctagtatggt     88500
     aaaaactttt aaactttagt ttaaatattt aaaatctaag atttaaactt tagtttaaac     88560
     attaaaagct ctaagattta agaattcttt aagtaaaaat ataatataat tcaattcata     88620
     aaaaaagaaa ggaattatat atgttagaat taagtaattt tcttagatca tcattctcag     88680
     agctaccagg tatgccattt gataataaaa gttatcaaga tttattaaaa aatgtttcta     88740
     aaacgattga aacataccca tcgtcaatga cttcgtattt aacaactgaa actagttcgg     88800
     gaattgatgt tgttgtgtta gcaccaggag tgcaagaaga tggttctaaa acaattgaat     88860
     tagactttaa acccgatgaa attgtaatta ggtataaagt tcataatgac gctaagtcat     88920
     tttttataac tggttataat acaatcagag ttagtttgga ttctgttaat aattttaaac     88980
     ttaaacaaaa ttcatttaaa gctagaaatg gtattataac cttttcgtta gaatctatta     89040
     aagaaactaa aaatacatac acattctaat aacttaagcc tttagtattt ggctaaaggc     89100
     ttcttaacta caattcataa ataaatatac aaaaagcaag gattgtaatg gcttttacac     89160
     acaaaaatca aaaaaccttt tatactgatt atgctattaa acacggtatg atacccactg     89220
     aagatactat aaatctattt caagttcgtc tcaaaaaaga aacaactgat atctacaata     89280
     aatttcaaat ggtaaatgga aaatcaccac tcgagtggaa tcaatctgaa aactacgaag     89340
     tcaatgaaat tgtaagatat aatgaagtag attataaatg tgtgcaagaa tgcattaata     89400
     aagttccaag cgaggaacct agtttttggg ccgttacaaa atatcaagaa tacacaaaat     89460
     atcctgctag caattacctg gctaaagaca atcaagatcc ttatgatcct agttcgatac     89520
     aagattatga agcatcaaat acataccatc caacaactgt taaacacgtt gaagatcgtc     89580
     taaaatattg gtttgataat gaaactgtta caaatgcgga tagacttgat ggtgaacata     89640
     aagactattt ctgttctaaa caagaatttg atgattttgc cagaatagca ttgactgaaa     89700
     aatctgtcgt tgatagttta gaatctgata atcgtagatt accattaagt gcttaccaag     89760
     gtaaggttct caaaggttta gtagatcata ttaatacaat tttaacttcg aatgatataa     89820
     acttagacga acttcaagaa attgttaatt ggattaaaac aaatagagat atgattgaag     89880
     ctttaggcat tgattctatc aaaggattaa gagattattt aaatcgtata gattctgatt     89940
     taggaaaaag agttacttac gattattgga atgccgaatt tctcaataaa attaaagcag     90000
     tagatggtca tttatccgga gttgatgcgg atactttaga tggtcaacac gcagattatt     90060
     tcttgcctgc aagtagattt acaccagaag aaattgcttt attacttcaa aaagtaccag     90120
     gatctttggg taaaatagat gctgataaat tagatggatt agattctaaa gatttcttaa     90180
     gacgttcaac cagtgataca cctactcaag ataataaatt tagcttaggt tctacagctt     90240
     taagatggtc caatatatat gctgttaatt ttcaaggaac tgctttgcga gctaaatatg     90300
     ccgacttagc tgagtattat gaagttcctg aagctattaa atcgaatata aaagcaggcc     90360
     atatattagg tatagatgct tgtggtataa atttattcaa cccaggtatg aaattatttg     90420
     gtgttgtttc aaaaaatcct ggtataattc tgaataatga atgtgatggt gtaccaattg     90480
     cattaaaagg tagaacgcca gtttattgta aaaataaacc tagtataggt gattatatct     90540
     atgccgattc taatggtttt ggtattgcaa gtgaaactga attagattta ccattagtgg     90600
     gtatttgcat aggttctata ataaattata aagatttttg gatttgcgag atcaaaatct     90660
     aatcaaatat aaggagtatt ataatgaaat taatggttta attactaaaa actcgagttt     90720
     aattttttaa actcgagttt ttaattctta tatattatat aatattaata ttttaaattt     90780
     aaatttttaa gttttaaatt tcgggtaata atatgcagcg agttccaaat tcaacacctt     90840
     gtgtatcttt ttggaattga acacttgaat aaaaactatc tttaaaactt gaacctacta     90900
     taggaaatgt taaagtatct ttatacgttg gatttcctct ccattggaaa gtttgtcttg     90960
     tggtgtctac ggtagcatct tgtaaaacac tccattttgg aataccacaa gaatctattc     91020
     tatactcaga agtcgttctt gtgcttgcgt tattatactt agctccagca tccttaaaat     91080
     aacctaatgg gctatcagag tcactgttta tataagttat aatctctgct ggtaatgtag     91140
     tttcatcata attattagta tctactaaag attctaaatc taaatccgtt atattaatac     91200
     tttctttgat aacaccaaaa taacttctat ctaatatata gccatacata gcgcctatag     91260
     ccagattaaa taacccgcct actaaatcaa caacgccaca cgcgtggcca ttgtgactaa     91320
     ttttacccat tttagaatct gaaacactgc ctgttctgta caacgcatta gtaccatctg     91380
     tatacccagc agttttataa tctaaattat gagcagcttg aatatctctt tgcgtacttt     91440
     gcatagtatt cataccttga atgaacgcaa atctatctgt ccttgattta gcaaactcaa     91500
     tattattgaa attatttgaa ttataagcat tttgatatat acatttagac aacaaaatca     91560
     aataattata agcaaataca gttaatactt gaaattcagg gcctctattt ttaacagctt     91620
     ctaagaagct tgaatttcta ttcttaatag attttaaatc atctaaattc aaatcagaat     91680
     cttctgtaat tttatttccc aaagcaacct ttgctgaaac tcctgggatt aaagctacag     91740
     aattaaactt aacatcacac gttaaaggca ctgtattacg cctagaacct aaaatacccc     91800
     cttgattaga tgctagatat ttgtctataa aaaatcctgg gatttcctca ttattgttaa     91860
     taaatgctct atgacaccaa aaaccagatt cttgagtagc agaaacttct acttttaatc     91920
     cataatatgg tgcagcgtct acatttgaag tcttaatata aagtttaggt atccaaacca     91980
     taacattacc acgaatatca gtataatttc cataattcat atggcctgga gtaaaagttc     92040
     ctagcatagg atacatatta tatttgttag taatttcttc aggagcaata cccacaccaa     92100
     aaccaatatc accaagattt ggatcacttg gaagtgcacc agcaacttct ccgtttccgt     92160
     ttatccagcg atttttattt tttgttttat ctatgcaagt ccaaataacc ccagtagttg     92220
     tatttaaaaa agttgcacta tcgattgtag gatttataga agttgtagga tcatttggtt     92280
     gcttataatt tatagtataa ttatcaactt gtgtatgtaa agctttaata tcttctttaa     92340
     caggatctaa tttttgatct attaagaaat tggtggtatc agtatctata gaatttttaa     92400
     ttctttcata attatcttta agttcattta tagctcctac tgctgtagtt tttgcttcgg     92460
     tttttaatgt tgttacatca ccaatagtat tgactttttc agttaaatct ttttgggtat     92520
     aagcaccaag agctaaatct ttcataatga accttttagc ttatttattt ggatctatat     92580
     aagaagcctt taagatattt tattatataa ttatcacaaa ggataaaaat gaaaggtaaa     92640
     aattttagtt taaactcaaa taaacgtaat aaaaatgact attaccaaac accttatagt     92700
     atgactaaac aactattaga aattgaaaat ttcgaaggaa gtatactaga accttcttgt     92760
     ggtgctgggg caatagtcaa agttctaaaa gattataata aatctgtaga ttattgtgat     92820
     ttaaacaatg attttagttt aacaggtatc ttcaaagatt tcaaagattt catcaatggt     92880
     gattttgaaa aatatgataa tattataaca aatccaccat ttagtttagc aaaagaattt     92940
     atattaaaag ctaagcaaat agcaaataat aaaatagcaa tgttattacc attgaattat     93000
     ttacacgggg tttcaagata taatgaaata tacaaggata ctgattttcc attaaaaact     93060
     gtttatgttt tttgtagata tggtttactt gaagatacta ttagagaaga tgggacttat     93120
     aaagctggta tgatggtata tgcttggtat atttgggata aatcttataa aggagaacct     93180
     ataataagat ggctaaataa caacgattat atagtcaaat caaataaagg atcttaatgg     93240
     ctaagttcgt tactcccgca gggaatttac ttaattcttt aaattctaag aaccttagaa     93300
     atgttcaaaa ttatagacaa acaatagttt ggtcttttga aactaatgaa gagtttatat     93360
     ctgctagaat agttgatgaa ggtgtagaac acgtccctaa aggtctaaag aaaacttgga     93420
     cttccacttc tttaactctt tctggtctgc cagatgatgt tgatttgtat cacccaaaaa     93480
     tgattacata tctttggagt ggttttaagt tggatggaac tgaatttaag gatactaatt     93540
     acgaagaaaa agctactata gaggatatta aaaatcaaga tatgcactat actggcaaat     93600
     cctggggaac taaaggtatt gctggatatt atagagataa taatatacta acatttcctt     93660
     ttactgtaga agttacttat tgggaatatt ctaattcggg ttcaaactca agttctggct     93720
     ctaaaactaa ttcagtatct aaaaatactc gtgaatctgg ttctgatgga ctcaaggttc     93780
     aaagaactat aacccaagat tattatatca cagtagttcc taatatggat ccagcattat     93840
     tttgtaaaaa atatggtgat gcgcatggat ttaaagggcc taatggtgaa gactttaatt     93900
     acgatcaata taaagcttat atggtttctt taggcttaga tttcttaact atagataggt     93960
     ctcaagccac ttaatacatt gcaatatact taaatattac cttaatccta aaatcgattt     94020
     aagccgcgtt tttgtgagat tatgaccaca tttaaaattt acaaaaaata tctgaagctt     94080
     cagcttaatt taagtttatt attatataat tatataaatt taaaacaaaa ggagattcag     94140
     atgttacaag acaaagtttt aaaaaattac agagattctt taaaccaaag attatcaatc     94200
     ctaattaaag acccagaaaa taacaaagat gttatatctg atgttaaagt tgaaataaaa     94260
     aagatcgata atatattaaa tagatcttac aaccgcggtt aatttaaaca agactagtaa     94320
     tgattagaca aaggaaatat aatggtagat tttaaaaatt ttttaacatt aaacaaagtt     94380
     tttatagata aatcaaataa aaaaccaact caaggaaagg taaactcagt tctttataag     94440
     ttgcttttaa aaggttataa accaagccag atattattag aagctattaa taatgcttcg     94500
     gattctgatc ttaaaacatt tgaagaatct atagtattag ctgcaggcac aacattctat     94560
     aaaaaatata ctcataaatt aagagatatt tcagattatg aagatcaatt ctatcactat     94620
     gtcttaagat atatttttaa cttagatact cacgattata ctctaagtat taattttagt     94680
     gatctgatac caaacaaaga actagttgaa ttagatttaa tacaagaatc tgaaatcgaa     94740
     aaaataacaa aaaatatcct tgaatctcaa ttcaatccta cggataatga aaaagatatc     94800
     ataataaaat atggttttaa atatatgcca aataagattc caaataagtt agctttagaa     94860
     actttaattt ctaatttaaa tcctagtgaa gctcttgaat tctctaaaaa atacaaacca     94920
     gaaaatgtta atgcagtcag aactattgtt aaatctttaa ttaaaatcga atataatata     94980
     gatcctgatc gtttggatag aatctataca aaagaattta atttacctag atatattaaa     95040
     acttttgtta tgaattccat taatgaatta aaattagatc acgaaactat attaaatgaa     95100
     atgttaatat acaagaaatt ctggcaaaat atgcagtact taattgttac aacacaaaaa     95160
     agatataaaa atctagtagt tgcaaactat gtttttaata gaatattaaa aagagattat     95220
     aaacaaacta gtacttataa aattagagct ttactaaata atccaataaa ttttaataat     95280
     gcttttattg aagtttataa ttataatata aatttagctt ataaaaatat ttttaattta     95340
     gcagctaaaa ctaataataa tgattttagt attttattgg attataaacc taaaacactt     95400
     aaacaattat tagatttagt tcttaattat aaaagaacta gtaaagttcg tatgtctaat     95460
     atcaaaggaa atattttata tttcaacgaa actaaaaaac cagaaggaaa tctttgggaa     95520
     gttctaagta aattattttc aattttgtta caatctaaaa aagatttaat tgatttcggt     95580
     ccagctaaaa gaatagcaat ctctgatgat ttagaaacta tagtaccacc agttaaatct     95640
     aaagaatctt taaaaactga tgtattcttt ccaaaaggat ctagcatcaa aatagcttct     95700
     aaatttcaag tatttgttgc ttggaaaaag aaggataatt ctcaaggttc gttagactta     95760
     gatttatctt gtttattcag atctgtttca gggtcactaa aagatgtttt agattataca     95820
     aagcttgaaa ctagcataga tggcaagatt caaatacact ctggtgattg ggcaagttca     95880
     agaagttttg atcctaaaaa tccattaatt acagcagagt tttgtacttt ggatttagat     95940
     cctaaatcag atttagaagt atatgtaaat gttcatagtt acaacaaagt accactcagt     96000
     gaatatgatg taattgttgg tgttctacca ggcgatacta aaaataatga tggtgttata     96060
     aatcttcaag atgctatttt tcaattcaat gttgatatag atttcaaaga tatatgtgcg     96120
     tttagaattc aaaatggttt actacaagtt attggtgaaa catttaattt aaaaggttca     96180
     cactcaaacg gacacagttt tgatcaagtt gctccaatat atgattatta taaagtttat     96240
     aatcaaatga gtttaaaaag attatttaaa ttaatcataa aacataaagg tttagaactt     96300
     gtagatatta atgacaatcc agatttagtg gttagttcta agttgagttc taaatctagc     96360
     ccagaatata aagtttataa tgtaagtgaa aaagtaaacg aactcaaaga gttaatgata     96420
     aaagattaac tctttggttc tattaagttt gattctggat ttataggtac tatcatcgtc     96480
     tcaattggat ttgactctgt aggtacattt gacatactag gagtgttggc tccaggatta     96540
     gaatcaaact ctaaagattc tgcacctctt gggtctatat aatatacttt aaaatgtctg     96600
     tcgtttttaa ctgcttcatt taatacatta atcaaatctt tattattttc tattctatca     96660
     tctattccat ttttattaat atctttttca ggtgcgaact tgctggcttg gtaaacaatt     96720
     ttttgaccag aaacgtataa gattattgac ccaccaaaag atactaacaa aggttccaat     96780
     cctagatttg catcaaaaaa tctattaaga attaaagcca aagcacatat aaaaaagttc     96840
     tgtattataa tatgtctatt tctttctgga ttaccataat tagcagaatc tttagttcct     96900
     ttaaaagtgg caataacaga agttgttcta tccacaccta catacacaca acataaagta     96960
     gcatataatg tggttagcgt ttccattggt acttgaaagt ttttattaaa gatacgcgaa     97020
     cctggcatat aataatctat gatataatct aaacattgaa atattaaaca aactgctgta     97080
     aatataccaa agaatatgac gtagccagca gtacctttaa tatttttatg taatttatta     97140
     gtaaaataat cagatttaat ttcttttgct gtatatgtaa attcattagt ttctttgttt     97200
     aaatacatat gaaccttttg tattatttat attgtttagg gtttaagttt atattaagct     97260
     ttagacttat acagtgtgtg gaatagccta gcatttttta tactttttaa tattgcttta     97320
     agttttaagc atatactagg atattatact atagtatata ctactaaaaa ctcaagcatt     97380
     ttttatactt tttaatattg ctttaagttt taagcatata ctaggatatt atactatagt     97440
     atatactact aaaaactcaa gcatttttta tactttttaa tattgcttta agttttaagc     97500
     atatactagg atattatact atagtatata ccactaaaaa ctcaagcatt ttttatactt     97560
     tttaatattg ctttaagttt taagcatata ctaggatatt atactatagt atatactact     97620
     aaaaactcaa gcatttttta tactttctaa tattgcttta agtttaagca agcatttttt     97680
     atacttttta atattgcttt aagttttaag catatactag gatattatac tatagtatat     97740
     accactaaaa actcaagcat tttttatact ttttaatatt gctttaagtt ttaagcatat     97800
     actaggatat tatactatag tatataccac taaaaactca agcatttttt atacttttta     97860
     atattgcttt aagttttaag catatactag gatattatac tatagtatat actactaaaa     97920
     actcaagcat tttttatact ttttaatatt gctttaagtt ttaagcatat actaggatat     97980
     tatactatag tatatactac taaaaactca agcatttttt atacttttta atattgcttt     98040
     aagttttaag catatactag gatattatac tatagtatat actactaaaa actcaagcat     98100
     tttttatact ttttaatatt gctttaagtt ttaagcatat actaggatat tatactatag     98160
     tatatactac taaaaactca agcatttttt atacttttta atattgcttt aagttttaag     98220
     catatactag gatattatac tatagtatat actactaaaa actcaagcat tttttatact     98280
     ttttaatatt gctttaagtt ttaagcatat actaggatat tatactatag tatatactac     98340
     taaaaactca agcatttttt atacttttta atattgcttt aagttttaag catatactag     98400
     gatattatac tatagtatat actactaaaa actcaagcat tttttatact ttttaatatt     98460
     gctttaagtt ttaagcatat actaggatat tatactatag tatatactac taaaaactca     98520
     agcatttttt atacttttta atattgcttt aagttttaag catatactag gatattatac     98580
     tatagtatat actactaaaa actcaagcat tttttatact ttttaatatt gctttaagtt     98640
     ttgctttaag tttgaatctc acctagtgct tgtatataaa taatcttaaa agagggacta     98700
     tgcaaaaata tgtagccatt gctttcatca ttgttgttat gctaggatat ataggatggc     98760
     ttaaatacga caacgctcaa ttacaaacaa ccatttcgag cttagaagcc aaaaacaaag     98820
     gtttagaaac ttctctaaac atccaggtta atttaaataa aatacaagac gaaaagaatc     98880
     gagaacttgt taacaacatt aaagaacttg aaaacaaacc cattagaact gaaacaaaat     98940
     acatagcagt caaggattgt aaagttcaaa tatctaaagt agacaccaat attacctcag     99000
     ctaaaggtat acctttattt ttaggaaata taggtaaaat acaattatct aatcaaaaat     99060
     aaggaatcac tatgaaaatt aaaaagtttt tattggcctt aatacccttt atttttgtgg     99120
     gttgtactgc agttagaacc gagtttattt acccaaaaat accagatgtt aaagaaccac     99180
     ctatgacaca agattataat ctaactgtaa taaaaataaa taatgtagaa tattattctt     99240
     taagccctga agatgctaag attttatcag agaactggat caagtttaaa tcttgggctg     99300
     agacaaatta cgaattatta aaaataatta aaaataagga cttaaaatga gtttcaaaga     99360
     cacattatta aacctagttt gtgaaggtgc tagccgtgaa gatttagact ccaaagactc     99420
     taaaatcaaa gaaacagatt ctggtgatat agatacaaca cctactacta aagcagatat     99480
     tgttaaacgc aaggattcta aaatcgatga agatactgac ggcgaaattg attctggtga     99540
     tgattcagag cttgaaccat tgtcaaagga agaattcgac gatataatta attctttaga     99600
     tccagatacg gttgcattaa ttataagtat tcttaatgat aatggatata tagttgctac     99660
     taaagaagaa attttatcag cagaagattt tgaagatatt ggctatcttg ttttagaagt     99720
     tctcgaagaa attgctgagt atgaagctac caattatgaa caatacggtg caaacccagt     99780
     agacgaatca tttgatgatg ctgaagttct tagagaagct gctatgattt tagaagctaa     99840
     tgatttaagt gatttgagtg aacaattagt agatattgcg catactaaac aattaagacg     99900
     tgatagaaaa agatcagctt ggaaaagatc agcagttcta agagcaagat ttagaaaaac     99960
     tggtgaaggt agaagagaac gtaaaaaagc acttaaatac cttaaaaaat acagaagaca    100020
     acataaagca cgtctgaaga gatattcaca aaaatatacg caagtttgga aaggtaatac    100080
     taaaaactaa tgatattttg tgaagattta gaaccaatat atgaggtagt gaaaaagcta    100140
     cctctttata aacagagagc taaggaagaa gtgtttttag gtattttaaa atcaaaatct    100200
     aagaaatggg ttgggtggaa atacctaaaa gaacttaaaa aagataaaag ctttaccaac    100260
     agtactattt ttattgagct ttatgagctt gcattaaatt actactggat taaatctcaa    100320
     aacgactcca tcaaatacga taacttgata aaaaactata aattttaaat ttattaatat    100380
     tctaagattt taagattcta ttattgtagg gttgaaaatt tttaaaaaat ttttttgccc    100440
     tttaatatga tattataata taaaaacttt tttaaaaatt tttttagtga ttttattggt    100500
     gcttaaaaat gcttaaaatt tgctagaata tttcatatgt tatatatcct agtatatgct    100560
     taaaacttaa agcaatatta aaaagtataa aaaatgctag agtttttagt agcatatagt    100620
     actgctatat atcctagtat atgcttaaaa cttaaagcaa tattaaaaag tataaaaaat    100680
     gctagagttt ttagtagcat atagtactgc tatatatcct agtatatgct taaaacttaa    100740
     agcaatatta aaaagtataa aaaatgctag agtttttagt agtatatact atagtattat    100800
     atctaaaact taaagcaata ttaaaaagta taaaaaatgc ttgagttttt agtagtatat    100860
     actatagtat tatatcctag tatatgctta aaacttaaag caatttaata acattttaag    100920
     ttttaataat atataataac aatatttcaa atcaaaagga tttatatgaa agatacagtt    100980
     ttaagcctaa gcggcggatt agactcgagt gctttactat ttgagtataa agatcgtatt    101040
     aagattgctg taagttttaa atatggttca aatcaccaag acaaagaact agcagctgct    101100
     aaaaaagtcg tagaagaagt aaataaatta ggtgctgaaa ttgaacacag aataattgac    101160
     ttgacaacag ctttcagtac ttttaaaagt gctttattaa gcggttccaa agcagtccca    101220
     gaagctggtt caactgaagt ttcaaatgta attgttccat ttagaaatgg tatattttta    101280
     agtattttag ctggtatagc agaatcggaa ggttgtagat ttattgctat agcaaatcac    101340
     agtggtgatt ctaatgtatt tccagattgc agatacgatt ttattgatgc tatgtttaaa    101400
     gctattggtt taggaaccga agataaagtt caagtatttg caccatatac aaatattaca    101460
     aaaactgatt taacaatccg tggtatgact aatggtttaa atccagattg ggcttatagc    101520
     tgctataaag gcggcaacaa accttgtaat gtatgtccta cttgtgttga tcgtaataaa    101580
     gcagtacaag aagctacaac agttttaaaa cattttagtt cttaatttat agactattaa    101640
     gttttaatat attataatat tctaatcgtt tacactaaag tgcaaaacaa caacacttta    101700
     gtgttaaatt tagaacttta gtacgagaca ctaaaattag aatcaaagga gaaatatgaa    101760
     actatttgaa gcttgtttta atttaggtaa ttttgaaact tatgaaagat tctacaatac    101820
     agaaactaat aagtctgaaa tccaaaaagt ttttcttaag aatcaagttt ttattgagga    101880
     tcctaaaggc gaatatacat ttttattaga tccgaatatc aaactaacaa aagttcaagc    101940
     taaccaagct aaagatttag aaacttatgg taaaactaat attgctgctg aacacattag    102000
     acaaaattat tggaaactca atgattcaaa atacaataaa aatataagta ttttttatct    102060
     ggatatagaa actacagcac attcacctat tgatacagaa gcctgcagag aaagaatagt    102120
     ttcaattcaa gtatatcata acttaacaaa tacgaattat atttttacaa atgagttctt    102180
     tgatactgaa gctcatacta aagattctaa atacattttc gacgatagga cttatgattt    102240
     taaacttaaa tactatcaag tagaaggtga acataattta ttgatcgctt tgtttaaact    102300
     tatagaagct ttaaagccct tattagtatt ggctcacaat ggtgaaggtt tcgactttgc    102360
     ttatctttgg agaagaactg aaaaattagg tttaactgaa ggatttagcc catttggaaa    102420
     atctgaattt caaataaatg aattagataa tggaactaaa aaatacagta taaaagcgcc    102480
     cggtgttttc tatatggata ctatagatat ctataagaag tttagactca aaccgagaga    102540
     atcttattca ttagattata ttgcagaagt tgaattaggc gaaagaaaag tcaaccacga    102600
     ttgttttaaa acttttgatg gttttagaac aggtgaagga tttattagac cagaagttga    102660
     acctagtgaa gaatctattt tagaatataa actttataat gctaaagatg ctgaagaaat    102720
     aaaaagaatt tctaaagaat attttattca ttatagtatt atagatacat acttattata    102780
     tagaatagac aatgcaatta aattatctga tattatgatt agtattgctt ctattatggg    102840
     tattcaatta ccacaaacac ttggaacaac aactccttgg agtacattta tccgaaatta    102900
     tgcaatgcaa gataaaatag tattaccaaa tccaagtgaa tttagtggtg atgtagaatt    102960
     caaagggggc tttgtagctg aaccattagt tggtagatac gattgggttt tttctgtgga    103020
     tgttaccagt atgtatccta gccaaattat ggcatttaat ttaagttctg aaacatttat    103080
     accattttat aaattaccaa atgatttaca agaagctata aatgaattag atcttaatga    103140
     agatgaacaa tatcatatta ataattatta taaaaatccc gaagcttata aaaaatacac    103200
     agatttactt ataaagtata attattgcgg atcattaact ggatctgtgt atgataaatc    103260
     taaaaaaggt attctaccaa tattaacaga attagttttc aatcttagaa aagcagctaa    103320
     aaaagaaatg ttaaaatatg agcaaatggc tgaagatgct aaagaacctg aattaataca    103380
     aaaataccaa gcattagcaa ctgaattgga tgtcaatcaa ttgacattta agattttaat    103440
     taactcatta tatggagctt gtggaaataa acattttatt ctatataata aagaaatcgc    103500
     taaagccatc acaggaaatt caagatttta tataaatctt atgagtaaaa atatcaataa    103560
     ttttttgtgt gatttatgcg gttctggaaa ttacatcaag tacggggata ccgactccaa    103620
     ttacgttcag gtcccaccaa aaatatgtga aaaattacca aaagacccac aattagcaac    103680
     agatataatt gataaattca ttgaaactaa aatacaaccg gtaattaaca caagctcaca    103740
     agaactaggg tctattttta atgctttaga tgcttcaaga atttctgcaa aacgtgaagc    103800
     gattgcaagc tctgctgtgt ttgtagcaaa aaaaagatat tttatgaaag ttatagattc    103860
     tgaaggtgtt aggttcagtg aaccttatct taaaacaatg ggtatcgata ttgtcagatc    103920
     tagtacacca gcattttcta aaaaatatct taaaaaatca gtcaatatta tattagaaag    103980
     tacagaagaa gaacttaaag aatggttaaa aaatattaga tcattatacc tgggtcaaaa    104040
     tctaatggat attgctaaga tatcttcggt cagttctagc aaatataaac ttggtgtgga    104100
     caaatccata ccgattaatt caagagcttt cttggtatca aatcattata taaatagtct    104160
     aaatacaggt gagtttcaac cattagaatt aggcgaaaag gttcgtatgc tatatcttag    104220
     agaacctaac ccattaaaat ctaacatttt tgcttttaat aatgaaaaat ttgcaaatgt    104280
     atttaaagat tatatagatt gggatactaa ttttaataag ttctttttaa aaccacttga    104340
     aataatgaca gacccactta attataattt acataaagaa actgaaactt tggaggaatg    104400
     gtaatggata tactcggtgt ttacaattat attaaatctt atattttaaa aggatacaat    104460
     tatttaaaaa gtaattattc ttttattact ataatgatat tattatttgg cactatttgg    104520
     ttagcttata atttattatt tgctgtaatt tttattgttt tctttttaat aggttcgttt    104580
     gttttatttg catatcttga ttctacagta gacaacattg attttaaaaa ataatgatta    104640
     atagagctgt tataactagg tgtttcaaat ataatggctc tatgtttgat gcttttgaat    104700
     atttttatag actttgggaa ttagatcctg atactaaatt tgtttcattg catagccata    104760
     tcaataaaga ttttttaagt attaaataca atgtagatcc aaaatgtttt gataatttta    104820
     tatataaaga tccatatgat ttagaattta acaaagcttt attattcgat actcacgatt    104880
     tctacaatat aaatcattca aaatccctta aattaaataa gttatatgta attgcaaaca    104940
     gcaccatagg gttcaaagaa aatactgaat attttgatga atatttttta aataaaaatt    105000
     ataccaataa aatatattac cagattcaca gaatattcaa ccatttagat aatgtatatg    105060
     ttaattgtat ggataattgt tgtaagagtt atttaaatat tcttaaaatg tatccgaaag    105120
     caattattaa agatcctaaa aataattttc aacattacac aatgactaag aattttatac    105180
     cggatattta caagtatttt aataagtaca tatatgttaa aactggtaga acttatgata    105240
     gacacccaag acaatttaca gaatgtgctt accaaggcat tgattgtgaa tacatctgtg    105300
     aaggttctaa attcacaaaa aatgataatt catattatag attcgaagat agatacgatt    105360
     ttgataagag atctatatac aacgatatag ttatatctaa aatgctcgat taataccaaa    105420
     aataaataag ttaaaaggtt tataatgaga ttcttagaat accatagatt aaaagaagct    105480
     gaagaattta gtagaaatga cattaaaacc atcgttaaac aatacaataa agtattcaca    105540
     agaatcctaa atacaaaatt ctatttagtt aatgaagtag agtactgcac ttcaaatggt    105600
     tcaaaattaa taggcatcag atttgctagt actgatggct atatgataag atttaattac    105660
     actgcaaaaa atgctaaaca aattcagaaa attaacaaaa ctactaaaga atttcacgtt    105720
     gaaagtatag atttttggaa tccaataaca ggacatttaa ataaaccaag tatcagagtt    105780
     tctgtaattt caagtttatc tctcaaatat tttatagaag atattacaac ttctattaaa    105840
     aagaatcttt taggaacttt ttattataaa gatcttaaat ttacagacga tttacaagcc    105900
     gatacaagat atacgattag cccagatgaa atcatattca ttaatactaa aggatttaaa    105960
     gaatccaatg attttacatt aagttcacaa gatcctaata ttcaacttat acttaataat    106020
     atcaaagaag tttatggaga agcttgatga aaagaatctt aaccttatca gatcttaggc    106080
     aatatatcaa agaagaactt ggatatccac aattacaagt agaacttaca gataatcaat    106140
     tagatcactg tattgaaaaa acagttcaaa tgttttgtaa tgttgcctat gatggagaat    106200
     taacaagata tataaaattt gaatgtcaag gtcaaggtaa ttattttgta gatcctgaag    106260
     ttgaagaaat attacaaata tgccaaagtg gtatttttgt aggttctgat ttaaatggat    106320
     taatagacca aaacctatct aattatatac tatctacttc tggtgttgct ttaagttact    106380
     tagttacttt aagttctaca agatccttag ttgacaaata ctttggtcga cgtgttaatt    106440
     tcgagtttaa ctcacataag ggattattat caatatatca aaattaccac gggcctttgt    106500
     taattgaagc taaatgtaaa tacataccag atgaacacga taaaatatat gaccaagaat    106560
     gggtcaaagc aatgtctgta gctcaagcca gattgatgca aagtgtagtc ttaggaaaat    106620
     attcagcacc tttaattaat ggttcgcaag ttaattatag tgatattaga caattagctc    106680
     aagatgaaat acaaagatta aacgaggaac tttcaaataa atttacagaa cctgctgtct    106740
     ttattgttgg ataattcatt ttatatttaa ggagctctta agatatttta tattataatt    106800
     atcaaaagga gataatatga gagtttctaa atacaaaatg ttaagttcct taaaagactc    106860
     agaatgcaac ttagttttaa caaattacaa atacccacaa tctaaaatag atttagaaga    106920
     atttaacgag tttggagaac gtttcttaaa agataatgca attatcgatg ttaaaaaact    106980
     caaagatcct gaattaaatc ttagatacga ttatgtttta atacttagat caaaacttac    107040
     tgatactgct ttagaaatta taaaagaagc ttatcctatg ctaaaaacta ttgatgaata    107100
     taaagcttca ttaacaggag attttaatga attacgataa actgaataaa atgggaataa    107160
     ttttgattat tattttatca gttgtttatt ttatgcttga tattaataat acaaaagtta    107220
     aaaatttaga atttaaaatt caagatcttc aaatagaact taataaaacc aaaaaagaat    107280
     taaatgatac caaaattaat ttaaatcatt taagttctaa agttcaagat ttaaaaatat    107340
     ctttaatgaa agatatgtcg tcaatgtatc acttaagtga taaacaacaa tctctaatac    107400
     ttgctgaaat atggaaacaa tctaaaaaat acaaaataaa cccagcattt ttatacgcag    107460
     tattatggaa agaatcaaga tttagaaacg acgttattca taaacctact tatgttagaa    107520
     cacttaaaaa agagatacaa gctcaaggta tgggtgctat tgtttgggat ttttggggag    107580
     ataaacttaa gtctaataca agtttaaaat ctaaaaaaga tcttaaaaat tggaaaaaga    107640
     atatagaagg gactgcatat atacttagtt atttgaaatc tttaccaaag atatctaata    107700
     caaaaaataa gtacgaatca gcagcttcaa gatactacgg aaaatatcaa gcaaattacg    107760
     tgaataaaac aatgtcaaaa tttaataaac taaactctta atactgaaat taaagtggat    107820
     ttaaacaacg attttgagtt actataagcg cctaggattt aagtatattt taagtgctag    107880
     tatattataa tatcgttaga ttttaataga aaggagaact atgaatggat taagttttat    107940
     accgaaatca gaaatcctta ataaatcaca agaaacttgt attaaagaat gccaagatat    108000
     tatatttcaa gaaacaaaag aagtttctaa agatcttata ttagatacat tattaggtat    108060
     gatagattct gttaagattt cagattctgc agttcatata aaattcaata aatctttaat    108120
     tatacagagt gaaaacattg ttttaggtgc agataattta aatatacaac ttgcaggaaa    108180
     ccgagtagaa ttacaaccaa gaatcaaaca aaatccaaag gagattaaat gatcacaaaa    108240
     gatttcatta aagaactttc aaaaatgtcg agtataactg ataaagttat tcttaagtat    108300
     ccaataacaa cattaaattc tgaagctata gatatgcttg taaatataga tgcgtctaaa    108360
     ttaggatgtc aagaattccc agatactggt atatatgaat taaataagtt tgttcatatg    108420
     ttcgcattat ttgataatcc agaaattaca agaactaaca atgcaataga atttgaaaca    108480
     ccggggacaa aaagtgttta tacaatttca gatttgtctg taatggaaaa ctttgatcaa    108540
     aaagcttcaa ttattgaaag tttagataat tttccagaag ttgccagagt tgacattagt    108600
     attgaagtca taaaacaaat taaacaagct tcaagtattt acaacgaatt aaatgtttta    108660
     agtatagaag gtaaatcaaa tgatttatat ttatatttag atgcacataa tagatttaat    108720
     tcttctaata atacatttag caaagagttt ttaaatcatt caactatgga ttttaaactg    108780
     aaaatcaata ttgaaaattt tgttaaactg ccggtaacaa attatacttt aaagattaaa    108840
     tataacgaga gtaaaaacgc atttagaatt ctctttgaat ctgagttttc taagattttg    108900
     atctcaaaaa ttgcagatta aagattgacg tgtgtcaaaa atttttaaca ccaaggaaca    108960
     ataaatggat aatttaaaac aactttcagc tacgtgtatg caaatcttta ttaaattaaa    109020
     tggaatgcat tacttagcca aaggcaatca atttcacaga cttcacgaaa taacacaaga    109080
     atattatgaa ttttttcaag agtcgtttga tacattcaat gaaagattag ttcaattgaa    109140
     tttaacacct tgtgttaata tacaagaaat ccacgatctg aaaaatccat atattttaga    109200
     tctacaagct acaaaacttg atttggatac tatagctagc acattaataa atgattttaa    109260
     attagttgac aattcagtag cagttcttat tcaagaagct attaaaattg aagatactgt    109320
     tacagaagac atcttaagaa catttagaat tcgtctccaa aaatatattt ggatgctcga    109380
     atctatgcaa agttaaggag gtataatgtt aaaagaagat aaatttattt gggaattatt    109440
     tcagaaaaaa tttccagaag tttcaagaga agcttacgaa gattttgtag aagaatactt    109500
     aagcatcaaa ccatttaaag ctagtgaaaa tatatttgaa actaatcaaa gtatttcaaa    109560
     cgaagctcat tttattatga gaacattagc tactaaaaaa ttacaagaag tttttgaaat    109620
     acttaaaatt gatttagaag acccaaatgt taaagcagat tttgaaaatg gtaatttagg    109680
     aacaccaggc agagtcatta agctaatggc tggtgctggc accgatgatg atactgagtg    109740
     tggctctggt agatttatga aacctgttag aatagcaact tttccaaata aagacgcagc    109800
     taagatccca attactaaaa ggattaacat agcaagtaat tgtagtcatc atttattacc    109860
     atttaataca gattttgaca atgattccta tgcaatagtt agttatatac ctaaagatta    109920
     tgttctaggt atttctaagt tgcaaagatt agcagatttc gtctctagac gttattggct    109980
     acaagaagac ttaactaaag aaatctataa taaaattaaa gaagcggcac aaactgaaga    110040
     tgtttatgtc aagttatgta atattaaaca tacttgtgaa tggattagag gtgctaggaa    110100
     tactgaaggg ggatttactt cagaattcta tggtggtgct tttgaagatc ctgaattaag    110160
     aaaacaggtt caaatccgag tttaatgtta atacactata gatcttagca tttaacactt    110220
     tagtgtaaaa attaacacta tagtgtaatt tgctagatct ttagtaaaaa atttaattaa    110280
     attttaattg ttctttatat aatataatat taaaaatttt aaatcaaagg agtttaattt    110340
     ggataatttt gaatctgttc ttctaaaaaa tatcatagaa tctaaagatt tttttaatag    110400
     agtaagacca atcttaaaac ctagtatttt cacagacttt ggtaaccaaa aaatctatga    110460
     attaatagat aatttttatt ctaattataa tacaactcct agtattcaag aaatagcact    110520
     tcaaattaaa gatattccca ataaagaagc aagaacccag attgctacta aacttaatga    110580
     tgctagaaac tcagaaaata tcaataaaga attcttagat gatttaactg ttaaattcat    110640
     taaggatcaa atgtttacaa aagcattaat gttaggcgct gagttcatcg acaaaaaaga    110700
     tgaaacttat aaacaaaaag ccaaagatct tatagatgct tcacaacttg tgaatattca    110760
     caaagatctt ggcaatgaat ataataatat agaagagcgt attgattatt atcaaaatcc    110820
     aagaaaaggt atcaaatact taagattcaa tactttaaat gagtatattg gtgaaggctt    110880
     tcttaatgga actttgaata tttttatggc tcctgcaggt attggtaaaa gtttattaat    110940
     gagtaccagt attggtgatt ttctcaaaca aggtttaaat gtattattag tcagcttaga    111000
     attatctaat tttgagttct taaaaagaat agatgctgac ttattagata tacaaattaa    111060
     tgctttaaaa gacgtagacc ctagtgttat tagaactaag tttgaagaac taaaaagatc    111120
     tggtattggt agcttatatg ttcaaaactt cccagctggt tcttttagtt caaatgattt    111180
     aaaatcttta ttagaaatgt ataaagctaa taatataaaa tttgatgcaa tattcttaga    111240
     ttatttaggc ttaatgaaat ccgatagagt ttctgcaagt gcaggtttat atagttatat    111300
     taaggccatt ggtgaagaag ttcgtgctat tgcagtcaca gaaaatattc cgatattttc    111360
     ttgttctcaa ttaaatagat cagctgtaaa taatacagat tctaacaatg aagctatttc    111420
     agattctatg ggtactgcta tgactgctga ttggatttgt ttcttattac aaactgaaga    111480
     tcttaaaaag aaaaatacta ttagatttaa aataactaag aatcgttata atggtagaac    111540
     ttcaagtttt gatatgcata ttaattatat gaatatgaga atcgaggact tagctacacc    111600
     tacgatgcaa attcaagctc cagcagaagt tccaaaatta tcagataaac caaaaaccga    111660
     ttggaacttt aattagttgc tcaaatattg acactatagt gtaaaatgtt ttaaatttaa    111720
     ttaaacttta agtttatata ttatataatt atattgttta agagatttaa agctttacac    111780
     tttagtgtta gttcctggct cttaagtgaa gtttaaaagt tttttaaatg gttagattct    111840
     aaccaggatt ttcaaactgt aatgtaaaag ttgcagtttg atttttaaat taattaaact    111900
     ttaagtttaa atattatata attataaaaa tatttaaata catttcggga tgtagctcag    111960
     ctggatagag cgacagcctt ctaagccgta ggtcaaaggt tcgagtcctt tcatcccgac    112020
     cattctaaca ttagtaagca ttcgggtaat tgttaaccca ccagactgta aatctggcgt    112080
     ctcttggcac tgcaggttcg agtcctgctg cttacaccat tattaaaatt tatatataaa    112140
     cataattaag atttatttgt aatttttact tatgtttatt aaattgtgat gttatatgtt    112200
     tacgtaacca ataaatatat ttaaatatat tttgaaggat taagatgaca tttaaagatt    112260
     atttaaacaa tattactata aatgaagcgt tgaagacaga cgcgtctgct atagaggaac    112320
     tcagaaatag atatcaagaa gtagccaaaa aaaaagatga attacaagcc gaaataagca    112380
     aactagaagc tacacagact acagcttact ttaaactagg tggcttagct gcacagatta    112440
     cacccgataa cgttgacaat gaaaaactca acaaaggttt agaacaatac gacagtgaaa    112500
     ttgagaatat tgagaaaaag ttagaacctc tttataaaaa acgcgaatct ttactagacg    112560
     agcttaaaaa aataagcaga gttgctaata acttagtaac aagaaatgct aaaaaagcgg    112620
     gcgtaagccc tttgaattat gtttttaaac ataatttatc attttaataa agttgaagag    112680
     tcgccgtata gaattaaact ctatacggcg tctgaatatg ttgcttgatt ggcacaatat    112740
     cagcgtattc accttgtagc tcaaacctta taagtagaca taaaccttat aagacggtat    112800
     agctttatat atctcacatt ctactaacaa acttaattat tcccatttaa ttttatcgac    112860
     agatttaaca gtttcagatg aattaatttt ttcttttaat gtattcgctt taaatattac    112920
     ttcctgcgta tattcggtta cttttgaaac aaatgataaa aattcttgag gtgtaaaatt    112980
     aaccttttca tcattcaagt caatccaagt aatctcagtt attgaattag taccactttg    113040
     tatatctaac aatatattag cggccattcc attaatatta agtttatcct tttccctagt    113100
     ttggaatgta tggcctttga atacaaaacc tgattctaaa gctatgtccc ttttagtttg    113160
     tatttcaaac ttcttctttt ccttaattac attgagtttt tcggattcac ttgcagtatt    113220
     tagcacatat tcataatata aatccataag attattagct aagcagtatt cttttactgc    113280
     ttgtgttcct gcttgaattt cttcaggtgt aatgtcgtct atgtactgat tattttcact    113340
     cgtgtttaaa cttctattta ataaagctat acttgtgttt gaagctgcag cccaactaat    113400
     cgagttttta tttaaatttc ctaaatcact taaaaatttt ttacttatat acatttatac    113460
     tccgtcgtca aataatatac catttgcggt cacttggtta gtgggtatat tgaatttagt    113520
     attaccacaa ttagtaaatg tcgcactaca gacaaatgca gttccgccta ttaaatcgac    113580
     acataaattt ggggtatcaa gaaatctagc actttttaaa tttatatttg aatttccatc    113640
     tactcgcacg gcgctaccag tcactctcag attaccccat tttgagccta aagcttggca    113700
     ttgtgaatta ccccataaat atatcgcagc agtacaatca aaattatacg cacctttatt    113760
     agaaccaatt acaatattag aattacgacc cacgtcaaat accttagtta ttgcacgtcc    113820
     gttcccatta agtaaaattt cccacgcagg acctcttgaa ttgtccaata aaaataaaat    113880
     tccagaaacc gaagtgtcta ccattacttc gatatcctcc gaaataatcc taataaaact    113940
     tatatttgta tttataattg atatattttc attccaaacg aacccacttt ttaattttag    114000
     tgtgaagtat gcaccatttg ttggtatata tcgagtacag tattgtattc cttcccaaag    114060
     tgtttcaaaa tcaccgcctg caccaactgt tttttcgata gattctgtca atatttgagg    114120
     cactatcgtg gttattggta aatatctatt atcagcttgt gtcaacatat cttgcaattt    114180
     agtatcaatt tcagatttat cataaacaga ttcggtattt gctttaagtt ccataaaaga    114240
     atctacagta gatttattat aatacgaatc aaatttagta ttaatttcag atttatcata    114300
     aacattattt gtgttggctt tagtgcctaa tttagaatct acttcagact tactataata    114360
     attagataaa tctacactta gaactgcatt tttccatttt ctagtgtttg agtcatactg    114420
     caaaatatga ttatttgctg gaccaacaat acttgtgtca attaagttag caatgcttgt    114480
     tttatgtgga ttattagttg ctgctttatg tgtattaatt aaatctgcat taaaattctt    114540
     cttggcataa gctaagttaa tagcgtgcca atcacttgtt gggtctgcaa cattaaatac    114600
     ttgcgtttct gaaccaccca gatttgcttt tgtatttaag gtattattaa taccaagaat    114660
     gttattttct atattttttt taaattgagt atattcatta tgcctagtat cttctaattc    114720
     tttgttggta gtaatgttgt tttcagcagt tgttactctt ctttctaatt tataatgttt    114780
     atcttctata tctttttcgt tagtacctac tgtagtttct aatttagcaa gcctagaatc    114840
     gttagtcccc ttataagttt caaaaattat ttttcgaaga aaattatctt ctatatattt    114900
     agaactgtat aataaatctc ttgaagcttc atctgggttt tcagtcgtat gtctaaaaat    114960
     tgattgaagg tctattaatt cgtctgtggt gcccatagtc tctttagttt cagaatccat    115020
     acaaatccaa tatttaccat taactatatc gtgaatatta gcgatataac taatactagg    115080
     atttgattct ttgcttattt tattaagttc tgctagaact ttttctttta attgttcttt    115140
     tgtgagattt tctgatatta aaacatcaac ttttttaaat tgcatttttc acctttaagc    115200
     taaagatttt ataagtctat ctattctttt atcctgaacg atattattac tagtattatt    115260
     tatgatctta ccatcagagt ttattaaaat aactctgctt tgatccacgt ctgttactct    115320
     aacatatact ggtttaccat catttttagc aactaatccc tgcatttcag taacagcttc    115380
     ttctgtaatt tgacttaatg ttttagttgt ttcgtatacg aaatctatta tttttatttt    115440
     agatgcttct aatgccattt aattttcctt gtatattttt taccatttag atactaaatt    115500
     ttcaaaagta tcctgaactg cattctgtgc tgcacttaat ccatttttta acatattact    115560
     aaaatatgaa cttgctttag attgtacact atcattgccg gtcgtattag aagtgccagc    115620
     taattgaatg tttttaatat ctgtgttgtc gtgatttggc tgattcattt taaaactaac    115680
     attaaattct ataatttcat tgttgtcttg agataattgt atttgcgaga catctgttag    115740
     taatgcgtcc tgagtttcca ttactaagat gtttttagaa ccattgctta aataaacctg    115800
     aattagccaa gcacagacat cattgtagtt accttttgat atttgaaaag cattgacaaa    115860
     tctacgatac atactggcat tatcaaaatc tctgaaggtc atatccactt ggtatactgg    115920
     gtctgcacca cgtgctaaaa cccaagttcc tccaattaat aattcttcaa atctaccggt    115980
     atattgcggc aaattaatac tttttaaaca aatatctata ctattttgcg tttcagtggg    116040
     atttccccag tttataagat tttggaaagt agcattaata ggtttcataa tgactataaa    116100
     atcagaggtt ttactccatt tgatagtatt aataacacta gcaagtttgt ttaaggtaac    116160
     agttgccatt tatcctgctt tttgtatatt tattcgtgta ttcaacataa tttaagttca    116220
     aatatattat aatctaataa ttataaagga atgtaaatga aattcaaaga ttatattaaa    116280
     agtttgagag attttaaaaa tcttgataat attgagataa acaccaatgt caaatttaat    116340
     gaatcttcat tagctagatt atacaagcac tataaagaac atgattctgg tactattagt    116400
     gcatatcgtg gtgaaaatac taaagaagaa aaccaagaaa ataataagaa attaaaaaac    116460
     tatttactag ccaatggtta ttctgtaaca caaatccaag gaacatatga agaaacagac    116520
     tcaaaaggga ataaaaagat tgtaaaagag atatcattta tcgttataga tattaatgat    116580
     actggaaagc ttaaaaaagt cttaataaat gttggtaaaa agttcaatca agaagctgtt    116640
     acattttcca ctaaaagtgg cgattattat ttgataatgt gtttcactgg ggaagagttt    116700
     aaattgggaa gtcctatgtt tggaaaagat ggtaaaataa tttcaaaaat tagtggcaga    116760
     ccttttattt tcgcagaatg tgaagacata gataatcata cttataatga tactttagat    116820
     gcttataatc ctttaattct aagataccac atcaaaaata gttttagcaa cctagataca    116880
     atataatttt tctacaatct aaagaagctt aactcaagct tcttttcttt taacatattc    116940
     aatagcttct ttataaatta aacttatttt aagtaatgtt tagttataat attcttaatt    117000
     aaaaagttaa ggaaattaaa tgaaatttat agattatctg aagaataaag ctctaaatga    117060
     aatggctgta gaaagaaaag ttgctgtttc agtttgcgac tctcaattta attctatcat    117120
     tactcattta ttgaaagttt atatcggaca agacttaaaa tcagcccttc caggagaaga    117180
     atgggaaaga caaataaatg gatttttaaa tgagatttta agagtaaaaa tcaaaaatac    117240
     aaataaacat atccctgata gtatcttaaa gtcttctata aaagctttga ttgatgactg    117300
     cattgaagac tcaagaataa aatcattaca aagtgaaata aagtcttata actacaacgg    117360
     aactccacta aaaacaccta aaaatgagaa aaagttacta ttatacataa aagctttttt    117420
     agaagatgtc agtcaaaaga tcacaaaagg agagttgaat tttaaagaag attttaaaag    117480
     atatttaaag aacatcaagg atttttaagc taagtttaag ctaaaataaa ttataattat    117540
     tttaattaaa agttaaggaa attaagatga cttttaaagg ctacttatac gaacaagctt    117600
     ttagcaaaga tgtgatgata tctaaattta ctaacaactc agacaatatc tttaatcata    117660
     ttttaaaagt cttagtatat gatgataatt taaacaataa aaaacattta agagagatgt    117720
     caggaatagt aagatcttta caaaacaaaa ctattaaatc aaaaataaca cctgaagatt    117780
     gcatagaatt taaacggatt ttaagctatt tttagttata attaaaagga gataaatgtt    117840
     tctggatata caagaacaaa ttaaaaacca gaagctatca gattatgaaa taatcgactt    117900
     tattttggat tatatgaata atcatataga ttctacacaa aaagattccg tagtagatcg    117960
     gattatgggt tgtattaaag atgtaaagct tcaatatcat aaatatttaa ccaacaatta    118020
     aaggatataa tttgaattta gacactatac atattgttaa aaataacgga gaacgtgaaa    118080
     tattcgatgc tgaaaaaata cataaacacc tacattttgc ttgtcaaaac ctcgatgtag    118140
     atattattag cattattaaa gatgctaggt taaaaatatt cgatggtgca aaaagtgtag    118200
     acatacaaga ttctttaatt aaatctgcac aagaaaaaat cagcgaagat tctccagatt    118260
     atgagttagt tgctggtaga ttattaaatc aaaaactcag aaaagaagtt tataaacaat    118320
     atacaccatt agattttaaa tcacaagtta aagaacgtat taaaaaaggt ttctataccg    118380
     aagatcttaa tgcttatagt gatgaagagc ttgactattt tgggtcttta attaattatg    118440
     aattagataa cgaactacct tacagcgcat taaatcaaat gtattctaag tacttgatca    118500
     aacataataa aaaatgcatt gaggttcctc aagaagtttt tatattgata ccaatggcta    118560
     ttttttataa tactgatata gaatatagaa aaaaatatgt taaacttggg tatgaattat    118620
     tatcacagcg taaaatttct ttacctactc cgattatgaa tggtgcaaga acaagttata    118680
     agaaatttat atcttgtaat ttattaaact ttggtgattc agttgaaagc tttgctaggg    118740
     gtttagaagc tgttttaaaa tgtacaagtg ctaaaagtgg tttaggtatc aatacaagtt    118800
     tcatcagagg tttaggagct ccagtaggta aaccttcaag gttagatcat accggtatgt    118860
     tgccgatcgt taaagccatt gaatctgcta cgtctgcgct ggttcagcac ggaagggggg    118920
     gagcaagcaa tctatcaatg cctttctttc actacgaaat agaattattt tcacaactag    118980
     gtgattctaa aggatcttta gaaaatagag ctagacatac tgatcaaact attatcatca    119040
     ataaatggtt cttagaaaaa gctcttaata aagaggatat atttttattc catatgaatg    119100
     ctgtaggtaa taaggatccc aaattagatt tatatgatgc cttaggtgat tataaaagat    119160
     tcgatgaatt atataaacat tatagcgcta aagttcctaa taaaagtaaa aagaaaatta    119220
     attcttatga tttattatct ttaattataa atgagagaat gattactggt agagtttata    119280
     ttgtttttgc tgataacttc gttaattcaa gttttaaaga aaatctatat atgacaaatt    119340
     tgtgctgtga aatatctgtg cctagtcata gtttagataa ttataggggt ataccaggag    119400
     aacttggaac ttgtatcttg ggtaatataa attttggaca ttctaaagaa tctgacattc    119460
     caaaagttgc tgatttctta gttaggttct tagacaatat gattgatatt tctgattttg    119520
     ctatgccaga aattgaatac tcggctacaa aacgtagaac attaggtatt ggtgtttcta    119580
     acttatttgg atatcttgct aaatcgaaat tattttacaa tacaaaagaa gcacgcgaac    119640
     atattaatga tttaatggaa ttattttatt ttaacttagt taaaacttca atagatttag    119700
     caaaagaacg gggtgcttgt gaattatata atgaatcttt ttatagtgat aataagttta    119760
     tattcgaaag atatttagaa gctggaatta aacctgaatt taaaacaaaa ttagattggg    119820
     agtcacttcg tgaagaattg tctaaatacg gtatgcgcca ttcaagcttg tcagctgtac    119880
     cgcccgctgg gaattgcatt tctgaagatc atacaataga gacttacgaa ggtaatttta    119940
     atcttaaaga tatttgtaat agagaatcaa tagattacaa tgatttaaaa ataggttggt    120000
     atgatcttaa atcaccatta aaagttccta catttgaagg agattcgata tctaatagat    120060
     tttattataa cggtgaagtt gatgtaattg aaatagaaac agattctgat gttagtgaag    120120
     tgacagctaa tcacgaatta ttagtagaaa ggaatggtaa taatatatgg gtagcagctt    120180
     cattgttagg accgggtgat acgataattg ataagtttat agaacacaaa attgttaaaa    120240
     acattaaaat cggtaaaaaa attaaaacct gggatttaga agttgaaaaa tatcataatt    120300
     attttcttaa tgatggtatt atttcacaca acagttcaaa gccaagttca gcaacacccg    120360
     gtatcgaacc tccaagagaa ttagtaacta ttaaaacaga aaaaagttct actgtaaaac    120420
     agttggttcc tttctataaa acagccaaaa aatattatac gactgcttgg ggtgttgact    120480
     ttaataataa agattatctt aaattagtga gtacaataca aagatatgta gatcaaagta    120540
     ttagtacaaa tcaatattat aatatcgtag aaactaaaaa agttaatatt gaagatgtta    120600
     tagaagaatt tatagaatgc ttcaatttag gtgtcaaatc attgtattat gctaatttta    120660
     gaactacaga tgatgcagat ggtgatcaag taattgaagg ttgtggatct gggggttgta    120720
     gtgtttaaaa acttttaggt ttaagctttt aagacttttt aagcttaaac actaaaatca    120780
     gcttgtattt cagaaacttt tgagttattt tatattataa ttatttcatt aaaagataaa    120840
     ggagataaaa tgaaacacat tacaaaaata tttttaggat ataaaaacaa caaagtatat    120900
     ttcaatagaa ctcaaagtca aattacaagt gctatcaaaa atcttgaacg tttaaaacct    120960
     tcatttaata ttaacgaagc tagatttgaa gaaatctacg aagctaaaca aattgaaata    121020
     aacccaaata tactttatat tgctgttaca gacaaacaat atgtaattgt agccaatagt    121080
     gattggcgcg gtaatatcac attagattat aaaaatattg attttggtgt agaaagaagt    121140
     ctgcaaatat caaggcttaa aagattattt agagctggta ttagaatatg gaaatgtaat    121200
     acttacttat atgatagaaa acgcaaatcc ataggtttga aacctagtct tgaagatcgt    121260
     ttagcagaat ataaaaaatc taaaatcaat gattttaaca aatattgctt aaataaatta    121320
     aaaagtgtta gtaatttaaa tctaaatgta aacaatatcg aagatttaga ttttaataat    121380
     ttagaaaaac aaattgattt tatgaaagag ttgttatatt atactaaaaa atatattacg    121440
     aatgaaaaat ataaattttg tgatgaacct tattttgaat acacaaaaag aaaaactatg    121500
     aatgctatta taaatttaaa gatttgaaat acattcataa tcacacaaaa acagggatta    121560
     aacgatgata ttagatacta aagcagatat attagtgact catagttttc actttaataa    121620
     tactaaaatg cacggattat ccggacattt atttgaagta ttagattatt actggtattt    121680
     taaaaataaa ggtgttaatg ttaaatgttt aattccagaa gtagtaacta aagaaacttt    121740
     taatgatttc gtaaaaggac actatagtgt agattttgat ttaaatgata tgtatttttt    121800
     agatactaag atattagcaa ttaaagctag aaatatacta gtaaccgatg gtgggtattg    121860
     gtttttaaat caatataagt ctaaattact aggtaaagta ttttcgtttg cttgtggtcc    121920
     tagtttttta gaatccgaag ataaaccaga atatgtgact tttttagcag atcataaaat    121980
     atatcctggt ttgggaataa attatactaa gaaagtgtta ccccatttaa atcatatacc    122040
     aggagataaa ccttttgctc atattactaa aaattgtagg gcattatcag aatctcaaat    122100
     aaaagatcta ataagagatt atcctgatat tgtaatgtat agtgattatt tgaatataca    122160
     gaattcaaca aataaaccta tcaagaattt taattttagt aagtatgtat atacacctat    122220
     tatgagacat tttgattgtt cacctagact tataatagaa tgtagaatct taggtataga    122280
     ttttgattta tggaatatta attataaaga tcctggttta gaaagacgct tagaaacaga    122340
     tctgggtcaa tttatattgg atgagtccga taatataata aattatttag tttaaagttt    122400
     aaaaggccac aaaggtttaa aatgaataaa atagacttct cgggttctga atgttcatat    122460
     gaaaaactac taaatggaac attagagttt gaaggtattc gagctgcgat aatgacaacc    122520
     aataaatgtt gttttagttg tgaatattgt tgtaattcag gttttacaga ttttaatgct    122580
     gctaaaaata ctaaaagcga agcagattta aaatgtttta atttggttaa agctatattt    122640
     cctagattaa aatccgcagt tttatgtggt ggtgaaccac taatgtgtga ttatctttat    122700
     aattatttag acttatttaa ggatctaaaa gacgtaacaa ttttaacaaa tctattatat    122760
     ataaaagatc attataaacg tctaaaagaa tatagaaacc tagatttagt tacaacttat    122820
     cacgcttctc aaattaattc taatcaatat attgaaaggc ttaaatattt cttagacata    122880
     gatttaccaa aagaagttaa attatttttt aaccataaaa aaccagattt aatagaaaga    122940
     actcaaaatg ttaaagattt cttagaatct caaggattta ctaatattat ttgtactcat    123000
     atttcagggt ttggttttag taatccaaat aaaaatgtag caggtgttga ccttaatgca    123060
     gatagagact acgtattgat ttcccgagga actaagaaac atataaatga atctgagttt    123120
     gcgagtcaaa attatctcgg tatggtctgc aatggtttga gacttcacgt ttacccagat    123180
     agaatcattg aaaattgttc aagaaaaact ttgactgtag aagaagttct gaagttaaaa    123240
     gattatcaag tttgtaaatt caaaagttgt aatgttggca tgtgtttgaa ttatttcaat    123300
     aaatacaatg tcaaatactt aaagaaccaa ctaaactatt aaaaaaatat tataaagaac    123360
     tataaaaatt ctttacattt ttaatagttt ttcttgcttc attgtccttc tctatttcta    123420
     gcgttgttta agaactccac aagctttaat tttttagagt ggttcctgta gttgttacag    123480
     tagccactat attctttaat ccaagattta aaatattgat actagcattt aaatctctat    123540
     caatactaaa tccacattct tcgcaattat aggttcgttc agataaactt aaattttctt    123600
     taatacaacc acaattagaa caggttctac tactagggta gtgcgtatca atcttaatta    123660
     aacagccttg gttttcggct actttataac ttaatttttc tatgaaagaa ctccaactaa    123720
     catcagatat tgctttagcc agttttttat tcttaaccat attcttgact tttaaagtct    123780
     caaggcaaat agttctatac ttatcagcta tctctcttga gactttgtgt tggtagtcat    123840
     ttctttggtt cttcactttt ttatgaagct ttgaaacttt taatctttgt ttttctctat    123900
     tattagaacc cttttgtttc tttgataact ttctttgaga aatctttaat tttcttagtg    123960
     atttttcaag aaatctttta ttttcatata ttgttccatc gctacaaata caaaaatctt    124020
     taatacctag atcaatacca accgcatctg atgtttcttt actttctata ttacaatgaa    124080
     aagtgaaaga gataaaatac ttattatttt cttttgaaat ggtaaatcca gtcaccttat    124140
     caaaattata ttttatctta tgtcttttaa atcttatctt taaatcttct ttagtgtaat    124200
     cagaacatct tggttttatt agaattatat gatcaccttc tatttttgct ccagcataac    124260
     aattaaagct ttgaatactg ttctttttag ctttaaattt aggataattg aaagttctgt    124320
     aaaaattatt aaatcccctg ctaagatttt tcattacaga ttgggtgtaa gtagctggta    124380
     ataaagataa aaagctgtat ccatctttta atttaggtat agaattgttc aaatcaaact    124440
     cagttggaat tcttggaact atacaacctt tgtttttacc attttgaatt tcataagttc    124500
     caaattttga attctttata ttatgtaaag aaatattgta tatagtccta gataacccaa    124560
     agaatgattc aagtatctct ctttgtttaa tgttaggctt taatacaaat ttaacacttc    124620
     taacagtgct ataaatattt ttagttttag acatattata cctatgttta aaattagaga    124680
     tttaaaagaa ctggaattct tttaaatctc gttttattat atttaaattt caaaactttc    124740
     aatttttgaa aattctaaaa taatttctat atttatttag tttaatatac ttttaagtcc    124800
     agaatatata atatttgata taaattatat agtttttctc attaatttct taaggttgtc    124860
     ttagtaacac ctataattct agaaaattct ccaataatat acatttaaag tctttttaag    124920
     aaaaattata cataattata gatatttata tattcttata atatttcata tattatataa    124980
     aagaaataaa aacacaaatt cataagtaat atagaatttt aagcttattt taaagttatt    125040
     attatataat attagaaata aaaggagata aaatgattaa aaacgcaaaa atacaagaaa    125100
     taaaagattt taacaatgat ttaatagcta aaatgttaaa agcttgccca gattttaact    125160
     taaaagtaaa ctatagaact caattcataa ttattaaaga caactccata agagaaagtg    125220
     cttattatcg tactgaaata gacgcttatg aagctggcat gattgaaata gatgaagatg    125280
     ctttagatgg tatctcaata tctcataata aaatagaatt ttttagaaat gatagacgta    125340
     atggtttgtc aatagaactt attgaggata atgaaactag aatcaaaatt agatttgatt    125400
     tacaagatcg taatattttt gatgaagatt attatgctta tgattgtttc gggtccagag    125460
     ctttcatttt tagaaatgat ttaaatcgtt ttaatgatag ttttactact aagattaaac    125520
     ttaagaattt tttaacaaaa aactttgatt tatttaaaga ttttattaaa agttctaatg    125580
     aatatttaaa tcttattaat gaaagtttat aattatagtc aaaggaacta aaatggaaat    125640
     aattaaatct gtggcctcag gattttttaa atatactata ataatatttt tactaggatt    125700
     tttttctggt gtatccttta cattttttat gactaaatgg tatttcgaag atcgcggctc    125760
     aaccataggt tatgaaattc aaagagccaa tatgataaaa aattgtataa aagaagttga    125820
     cgttgctttg gaaataatga aagaagaaaa ctcagttata gatgcaacac aacctttaaa    125880
     ctaaatatag gatttaaaat gattatagaa ataaaagatt ttccattaaa tgttaagaga    125940
     gtagttttag aatttgatga ttcgggtgct tgcgtggtag aaccagaaac taagattaaa    126000
     aataaaccta gaaatgataa aattgttaaa gaacccgaac ctgaaattca aaacgaacca    126060
     gaaccggctt tagatattaa ttttggttct aaaccagtaa aagcagcaag catagaacct    126120
     attgataagg ttgtaatccc ggatatagaa agagaagcta acgtttcagc tacaatgcaa    126180
     aatttgaagc tttaaaaata taacactata gtgttagatt tgcactatag tgcaaaatta    126240
     ataccatata gcactatagt gtaaaattta aaaattaagc ttcggtaatt gtaaacttat    126300
     acaacatcgg tgtggttggt gaatgtaaag ggtgtattgt atatgcattt cttgtaaata    126360
     tacctacagt tctttcacca gattggtaat tataagcagt tgttaagttc atacaatatg    126420
     ggctataaat cagcgaatta acaccctttt ctttatgaga ttttaaacct acataagcat    126480
     tattatcatt aggatttgga tttaaataat atcttgtatt attaatctta cctaagaaat    126540
     aatcattcgc tctattttca tctgttgagt cgtctattct tgaataagta aaacttaatg    126600
     ataatatacc gcctatgcca gtttgtggaa ggatacaaaa actatcatat gttctaaaat    126660
     taggtgaatt catcttaata actaaatcac ctactttttt agatatataa aataagtttg    126720
     tttcagcatt ttgtttagaa tcgttggtat catctaatgt aagattacca gcatctacag    126780
     cattttcttt aataagattt ataatttttt cagtttcttt gtgtgccgca gaagacttaa    126840
     cccagttaat gaataattct ggagtttgtt catttccggc tttgttaaga ttacttaaat    126900
     ttaataaatc ttcccaagct tcctgtgata ttttgataat agatttatta gtatccacat    126960
     caatttgctt tttaataatt ttaaatgtgt cttgggtttc ttgtcttgca aaaacatagc    127020
     cagatggttg cagcataggt tgaacttcag caatatgatg tcctataaat gatttgattt    127080
     tatcttttaa gatatcaccc aacataactt ggtaaaaatc tgcatctata ccttcgttaa    127140
     ttaagtttgt agactcttta agagaatttt ctaataatag tttatacatt ttggcctcta    127200
     tgtattttta gagtatttat tatcttgata aactttaata tttaatattt aagaaacatt    127260
     taagttattt tatattataa ttatttcatt aaaagataaa ggagattaaa tgaaaaactt    127320
     caaatcaaaa ttaggtgata atagatttac atttgactta gtttacgcag gcgtagccgt    127380
     agtaatgatg gtagcatacc cggcttattt tatttggggt taaaatgaac ttcgtaacta    127440
     aagattatat gttaactgca gaaatagcgg ataaattaaa tataagtatg acaaatattt    127500
     caaaatggta tacagaattt tcagagtctg ttgctaataa acatttagta agaatatgta    127560
     attgtgtatt cgttcacaga gactttccta atttaactaa gaatatgaaa attatttttg    127620
     atgaatctag aatagattgg agtaataaat taccattgaa ttatatgatt aaaaatttta    127680
     aaattaatgt tgcttattgt gaaaaatata atataggaca taaaataagt tatgatttta    127740
     aaacacacag aaatcgtgta attcaaaaag acttttttga gtttaaccct agtattttaa    127800
     aattattaaa agatactgaa ttagaatcaa gtaaggtcgc tagtttaaaa tcaattcaag    127860
     tttcaaagaa ttacttcatt tgtttttgat tatttaaagg ggtaaaaatg gattcaaaaa    127920
     gctttattaa aaaacaagtt ctaaaaatct taaaagtaac taatatagaa gaagaaattc    127980
     ttcataaaat gttcgtagat gaaggtgttg atgccgattt cttgatacaa gttctgaaag    128040
     atctacacaa agaatataaa attaaagttc taattaaatc tgatagttgt ttgtttgaat    128100
     gggattctca taagccttat gttaaaggtg tttatttaat agaaaggatt ttcagaactt    128160
     aacacaaatg gtgatagaag gaaaaaatag atttgatagt gatagagaat aaagatagat    128220
     tatgtagatt tggattcgag atgttacagt ctatttttag atacttcggt acaagaatta    128280
     ttgttataag tgaggatata cagaataaat cgtatgaaca ggaacttact gaagatcttc    128340
     tagtaattat tcatcatttt tctatgaaat cttattctca cagaagaaaa ctgaataagc    128400
     ttaaaaaatc tatagaacta ggagagtctt tatgataaaa gatcaagaaa atattataac    128460
     aatcaagcta gactataagt cttctgatac agaaagaata cttgattgta tcaaaaacta    128520
     caactctctt tttagatcaa catattcatt ctatcagcaa gttcctgact taaaacaagc    128580
     agaaacaaca agacttcaat ctaaattaaa taacatcttt ttagataaat ggtttttcgc    128640
     ttcagccgtc tttgatgtta aaagttttaa gaacaagaaa aagaaagatg aaaaagttat    128700
     atttggtggt aaaaagaatt tctttgatag actaaaagga aagatcagca aacaagaata    128760
     ccaactaaaa agactgcttc ctctatatag tgtaggtgaa gcatctaaga gtggaaatag    128820
     aaaattccaa atagaagatg aaaatacaat aatttttaaa gtctcaagaa aagaacatat    128880
     cactctaaaa ttaaatggaa cttctaagag atatagagat tatttgaatc agctgattac    128940
     tttacaaata aacaaatata taccgataac ctacaagcta gataccaaat atgtttatat    129000
     cagcttcgac ttgaataaac tcaaacacaa tttaaaagta caggataaga ttaaagacag    129060
     agtatttggt attgatctaa atcccaacta cattggatat tcagtagtag attggaaaaa    129120
     cgatggatct tataaaatca taaaaacggg ttctatttct ttaaaagctc taaatgatta    129180
     tgataattct ttaaaaggac aagagtattc tagtcaaagt aaagaaagaa aatacatttc    129240
     aaataaaaga aatcacgaaa tcatacaaat agctcatcag ctacctaagt tagcaaatca    129300
     ttttgggtgt gagattttta gcttagaaga ccttaatatg aagcaaggag ccaaagaaaa    129360
     gggaactaag ttcaacaaac tctgtaataa tcaatggtgt agaaatcttt tggtttctca    129420
     aataaaaaag atgaattgtc tatacaagat tagaactcta gaggtccaac ctcaatatag    129480
     ttcatttatt ggaaatcttg tatatagagt tcatcagctt cctgattatg ttctagcaag    129540
     tatagaaata ggaagaagag gatatgaatt ctaccatcaa tatatcttaa aagataaaaa    129600
     gatggagaag aatattatct ttggaaacta tggaaaagat aaaaatcttt ataacctatc    129660
     attggaagaa atcggtatta aagagtcttt taatagtttt atggagatgt attcttttat    129720
     aaaaaactct aaaacgagat atagagtttc tctagatgat atagattcat ctagagtttt    129780
     caggaaactt tttataaaat cttatacgga attttataat tttttataag ttttatatga    129840
     agtttatatc ttatataact agtaaaatgt aaacaaaggt tctaaatgac aatatatagt    129900
     ttttcgaaaa tagatacata taaaaaatgc ccaaaacaat attattatag atatattgaa    129960
     aaagtaccag aaactcaaaa gaacccagca ttaaaaaaag gttctgatat acacgaaata    130020
     cttgagtttc ataacactga aaaatatgat ataattttca actcaaaaga tccagaaata    130080
     caaaatattg cattaagatt tattgattct gaattaggaa aagaaatact atccagaaaa    130140
     tctctgaggg aatttgagtt atttttggat tctaactatg aaccttgtag caaagatact    130200
     gctatttttg tgggctatat tgatagaatt aatacgactg aaaatggatt agagcttata    130260
     gattataaaa caggtaaata taaagaacca tcttatcaag attttacaca attaatatta    130320
     tatagtttat atatgtttaa aagacttaaa cttgatgaaa taaaaataag atatgtttat    130380
     gttgaacatc ttttagaaaa tactttaagt ttgtctcaag attctgcaat ttattggcaa    130440
     gataatctta ataatcaaat aaaatctatt gaaaattcta ttgaatctaa tacttggaat    130500
     agcaaaccaa ataaattatg tccttggtgt ccttatgcag gattatgccc agattttaaa    130560
     ggtaaaccta aatgccagaa aacgatttca aaaaattaaa cgaatcattt agtttgatat    130620
     ctttgacgga taatcaaaaa gctaaattaa tatttaagaa agatattcgt tataatatat    130680
     gggctcaaat gaatccaaaa ttagcttatg aatacttcta taaagatttc aataaccaac    130740
     aaattgtacc aaatggtgtt ttagaatacc tgggtataac aactaaacca gaaattaatg    130800
     aaaaattaga ttcgcaattg gaaataatta taaaacattt agaaccattt ccagtttatg    130860
     attatcaaaa acaagctata aaagatgcta tacaatttca taagttattc attagagcag    130920
     ccacaggtgc tggtaaaagc gtcattattg gattaattgc taagattcta acattaaaaa    130980
     aattaaaagg tttaatactc gttcctaata tttcactaac aaatcaattt aataatgatt    131040
     taataaatta taaattgaat atcgaaacaa gattaatagg tggtgaaaat aatattaaat    131100
     cttttgacaa accattaaca attagcactt ggcaatctgt taaaaacttt aaagaagctt    131160
     taaatgattt agattttatt attgtagatg aagcacatac agccaaagca gatcaaatat    131220
     ttgatatttg taataagtgt gttaatgcta aatataagat aggtttgacg gggactatcc    131280
     cagacaatga aatagatgct atgcgattaa taagtatttt tggtttacca agaacatata    131340
     ttacacccag aggtttaata gatagaggtc tggctacaaa tgctattatt aatataatag    131400
     atcttaaata taaatttaat tttgaaggtg aatattcaag ccaattgaaa caattaaaag    131460
     aatacgaccc aagaaataat ttaattcaaa gaataggcga tactgtagtc agcaaaggta    131520
     acactttagt attattttct catactgaac acggtctaac tttattttat aagttcttga    131580
     aatccagagg attaaactac gataaaaaga cttataaaga tttagcgttt caacaaagaa    131640
     ataatgtatt ttttattaat ggaatgatag aaggttctca aagagaaact atcagacaat    131700
     taatagattc agtaaacaat gctatcatag ttgccaatta tgcaacgact tcaaccggag    131760
     taaatattaa gaatttgcat aatttagtgc ttgctagccc actcaaaagt tatgttacaa    131820
     taactcaaag tattggcaga ttgttaagac ttcacgattc taaagatatt gttaatatat    131880
     atgatattgc tgaccacaat ggttttttta agaaacaaat aaatgctaga ataacaaaat    131940
     cttatgagcc tgaaggttat gaaataaaaa gattcgctta taatatataa tattttaatt    132000
     ttaaactgaa gttttagaac ttcagcaaaa attaagttca agtatattat aattctacat    132060
     agctgtttaa aaggggattg atagtcaagg tgacggtaaa tacaataagg gtattgcaaa    132120
     cctaagagct tcctagtagc tcaaaccttt tttacggctt gatctaattt taagtttagt    132180
     tctaaaatta acactgtagt gttagatctt aaaagttcta aaattaacac tatagtgtta    132240
     aatatgcact ttagatctaa acttagaatt aattttaaaa ggagatataa tgttgataca    132300
     agttaatgaa aatacgactg ttaaattatc agcagtttgt aacattaatg ttttgaaaga    132360
     caagcaagtt tttaatatgt gctatacttt caccgataaa aaaggagcaa tgagtggtta    132420
     ttattatgta gataatagta acataaacta tcaaaattct aaatacttca aagaaaaatt    132480
     tatagcagtt cgtggtatcg atagattaat atatattaac acagactttg taagctttat    132540
     taaaaaagat tacgcaaatt acccaaaagt ggtaattggt tttagtcata gtgtactaag    132600
     acataatgtc gaatcatttg catttgcgcc cgaatatatg tatattagaa ctaaacctga    132660
     agatctcgat aatacatacg ccgaaatctt agaagctatt acaaatattt caaaataagg    132720
     agataaaaat gagagatgaa tttgatgatt tgttagcaag cttagcaata gaacctatta    132780
     agaaacctga aatagaatat caagaaccat tagttgttaa acctacaagt aacatagaag    132840
     ttaatgaagc aaacaagcaa aatacaaatt taaatgattt tagtgacgtt cttaacagca    132900
     tagaatctga cgtcagtagt accaacaata acgaaaatat agtagctagc tcagattcag    132960
     aagcttttaa ggaatatata gatctcagga atattaaaaa tgaatcagat attgaagttc    133020
     ctgatttagt agatacaatg cgtttagaag aagcaccaag tttagtgtca gacacctcaa    133080
     acattcccac aaatcaaaca caagaatcaa aaccaagagg ttatgaagtt ccagatatca    133140
     aaggaactac taaaagggtg ccagatattg atgattctga aaataatgtt tataaattag    133200
     aaactgaata tattgatatt atattaagtt atgaagaaga attaaaagat cttaaacgtc    133260
     gttttaaact taatacatta gaatatcaag caaaaggtgt acaaactagg ttagttatta    133320
     aagcagttaa acaagcagcc aaagacgcta aaaaagaagg ctatatcatc aaagatgaaa    133380
     atagaatcca agaaagaatt aataatgatt ctaatttatt aggaaggatt tgttcggtta    133440
     ttaattcgtc aatctaaaag tttaataata ttttaaggta ttttatatta taatacaata    133500
     aagtttaaaa ggagatatat ggttcataaa agtattcaag attattttct aaatgaatta    133560
     actaattatt cttgttacag tactttaaga atgatagcta gttctattga tggtttaaaa    133620
     aattcaagta gaaaaatcat taatacagca ttagacaaaa aactaaacac agaaactaaa    133680
     gttagtatat ttgataatat ggttcaaagt tatacacaat acttacacgg ttcgtgtgca    133740
     ggtgttattc aaaatatggc tgcgagctat actggttcta ataatattcc attgcttgaa    133800
     ggtaaaggta attttgggtc gaggtttatt aatgagccag cagcaccaag atatgtttat    133860
     gttaaaaata aaaaatatat taatgattta tttgatatta aagatgtctt gatttctcag    133920
     aatttcgaag gttcagaaat agaaccagta ttttatgtac caagtttacc tatactagtt    133980
     ttaaatggat caatgaatgg ccttgctagt gggtttaaac agaatatttt accaagatct    134040
     ttagactcgg taataaagta tattaagaca ggtaagaaag tcgatttaaa gccgtatatt    134100
     gcgggtttta aaggcaccgt tgaattagta gaagatgcta gttctaataa tacacaatgg    134160
     aactttatag gtgttgtaga agtcaataaa aataaagcaa ttataacaga aataccacca    134220
     tttattgagt atacaaaata tcttgaaata ttagataatc ttgtagagtc taaaaagatt    134280
     aaaaattata aagacttgtc ggatcaaaga aaccaagaat ttaaattcga agttatattt    134340
     ttcgataata tctctaaaga taaagctatc gatatattaa aattatctaa aagagaaaca    134400
     gaaatatata atgctttaga tgaaaataac caagttagaa cttttgaaaa tattgaatct    134460
     ataattgatt attacataga cgttagaaaa agatttttaa ttaaacaaaa agattttgat    134520
     ttaaaagtcc ttgaaaatga tttaaacatt aatgttcaaa aattaagatt tgttaaatta    134580
     atcattgatt cagagttaca aatcatgaaa agatctaaaa aggatattga attggatctt    134640
     gaaagtaaag ggtttattaa gtttgaagat agttatgatt atttacttaa gttgccaata    134700
     cattcgttta caaacgaaac ttttgaaaaa ttagtacaaa atgctaaaga aatcaaagct    134760
     aagtttgaaa cattaaaaaa tctggatacg tttaaaaatt atgtggaatc gttagattct    134820
     attaagaata tattaaccaa agcttaaggg ctaaaatcta aataggagtt aaaatgagat    134880
     acgaagctat gaacaataaa acaaaaatgg aagattctga attggatatt atatctgtaa    134940
     aggatgcgag acattcatta tacaaaaaaa gttttaatta tactaattat actttaaata    135000
     tcaattcatt tgatcacgaa gaaggtgaat tagaaaatat ttttgctagt cttaacgacg    135060
     ctgccgaagg tgattctata caaatcttta tagccagtgt gggtggtttt gctgacgaac    135120
     ttaatagatt tacaaatata attagaacaa agttctatgg taatgtaaca acagtattaa    135180
     acccatttgg ttattcttgt ggtgctatgt tgttcttaat tggtaattca cgtgtaattt    135240
     atgagaactc tagtattatg tttcattcag tgagttttgg agtttctggt aaacattcgg    135300
     atgttaaaac acaatttgat ttttctaata agtattggaa tgaatatatg aagtcattat    135360
     taaatccata tcttaccaag aaagaaattg aattattaat agatggtgtt gagttttggt    135420
     tcgatgctta tgaaatgtgt aaacgtggta ttgctactca tattaatgtt tttggtttaa    135480
     gtatgaaagc aagtgattat tgtgagtaca tagataattt agattataga atagcgtttc    135540
     ttgaatatat tattaaagaa ggtgatcttg attctattga tttgcaaaga gctgaaattg    135600
     agctagaaca agctaaaaaa gatgctaaga aagctaaaac tattaaaact attaaaacta    135660
     ctaaaaaagc tgtagaatct aagccaaagg ctaaaactac taaaactgct aaagctaaaa    135720
     ctactaccaa tagtgaaatt gagtctaacg atcttaacta agatctttag gctttaagaa    135780
     tttttttagt tcagttatat tataatcata tatgacacct aaggtaataa aatatgaaaa    135840
     taacaatctt tggaactgca agtaaaaatg aaaagtttgc taagtcacca tacgatgata    135900
     attcttttat ttttgaaacg attgaagttc aaacgactta ccaagcattt caactacttg    135960
     ttaataattt ttgtttaaat attaccttag acttaaaagg gcctagtaaa tccagaagat    136020
     taaaaacaga tttagaaccg catataatta aaacatttga tcatttatta tttgattttg    136080
     aatgtaaatc agagtttaat aaaaatatgg cactagacta ttttaagagc acacaatgca    136140
     ctatcggtca atccagatct tatgatggtg ttaataattt taatttaaaa ggtattatta    136200
     aaacaacccc aatgagctta aaagaactaa aagttctaca agctaaaata caaaaagaac    136260
     tttctgaata tggtaaatat actactgaca cattaagaat aacttattat acagcacctt    136320
     tgaataaaga caacatccta ctagataatc caaacggttc tgtattgatg cctgtaggca    136380
     cgaatgttac agattactat aataacatag atttagattg taaatttaat attacttcta    136440
     aagaaactac tgaaatatgc aaaactattt ttaagaacct ggggtttatc ttagtagata    136500
     tcaacgctaa tggttctata aaatacacaa aagattctga agattatatt tggtatccaa    136560
     ataacccata tattatgaat catactgaaa gttatatgtc agtaaatatt tggaaagaag    136620
     ctatgaagta tgagcctact tttgatataa ctccttatat agattataaa gcagatattg    136680
     tagttgatag aaattttaca gaaattaaat ctgaattaga ttcaattgta gaatcttttt    136740
     tgtttaaaca taatggtgcc ttgactttga gagctcctat gggttcaggt aaaacaactt    136800
     ttatagatag aatcatagaa tatgctttgg aacaagattt taaaattgca attataacca    136860
     atagagttac attagcagaa gactacaaaa gaaaatataa gaagttttta tattataaag    136920
     attatactaa tgctattaaa gctaaaaatg actataaaaa taacaacgat tgcaacaata    136980
     aacccaaaat tgttagacca aaaggtaaat cattaatttg ccaatacgat agttttaact    137040
     actttgattt ggatgactat gatttgatta ttttagatga atttatgagt ttgttaatgc    137100
     atacaagaac tgctttaaat agtaaaacag agaacttaat aaaattctat actgctttaa    137160
     ataaaaaagt tgttgtggct gatgcatttt taagtaaata cattgtagac aatatgttta    137220
     ctaaaccttt aaatgttgtt agttatacaa aaaataatac agaactttat agttgtaatg    137280
     atgccaatac cttttataca ttaattaaaa atgctttaga tactaataaa aaaataacta    137340
     tttctacaac tagtataaaa gttgttgata ttattaaaga aatgtgtcac atactaaaca    137400
     aaaaaataat tatttttaat aaagaaacta gcaccatatc aaaagatatt atatatgata    137460
     aaattagatc taaagaagta ttagattgcg atgtctttat ttacactcca gtgttaactg    137520
     taggagtcaa tattctgaat gatgttgata tacattttca ttatgatagt gcaagttcta    137580
     cagacgttat tagttcttta caaatgctag gcagagcaag attttccaaa aagataattt    137640
     actatgttat gaacaaaaaa tataatgctt gtattaatta tgatttatta aaaactactg    137700
     tagaaaaaaa gcctaaggaa tatactgatg attctaaaga cagaaacgct gaatataaaa    137760
     gagggagcat caaaaatctt ttgtaccatt ttcacatacc acctggtaaa gattatcaag    137820
     aattaagtca tattggtaaa gcttgtctaa aagtggacgt ttttaacaat atgactttgt    137880
     gtgactataa aaaatctttt gatattttat taagttttaa tttcagcaag atacctattg    137940
     aattaagaaa aataggcggt gatattttga aattaatgga tattaaaata caggattcaa    138000
     aagattctga tactttttag ttttgagctt tagttttggt ttaagtttaa aattagtcta    138060
     aatatgttat aatatattaa aatctcaatc gctaaaggag tttaaatgaa attaatagat    138120
     ggttattata cagattttga taacaataaa tgggattctt ctaggtatac agaagatcaa    138180
     gctagagaag cttctgaatc tttagtgttt tgtaaagatt gtttgaattg ttttaattgt    138240
     gttgcttgtt ataaatgtat tgattgtata gattgttgta aatgccgcgt ttctgaagat    138300
     tgtattgatt gcaaatcttg tattgattgc attgattgtt ataaatgtca aggttgcttt    138360
     aaatgccata aatgtgttta ttgtttggat tgtcacgaat gtgtagattg caagagatgc    138420
     cgagcttcta tagattgttt gaattgtatt gagtgtggca acatttcgaa taaatctcat    138480
     atacgaaaat catacacagt attaaaatta tataaaattt taaatacata aatcatatat    138540
     tcataaataa actaaaaggt gataatgatt tacattacaa gtgatttgca tatatctcat    138600
     caaaatatta taaaatatac tggtagatat attaatgacg ccttagaata ttcaaaagaa    138660
     gttcataagt attttaaatc agttttaaaa gattctgata ttttaatgtt tttaggagat    138720
     ttagattgtg gtcctaataa aaatatagaa ttcttaagac actttattag ttcattacca    138780
     agtaaaaaaa ttttcgtaag aggcaaccac gacaagtggt tagatactga aagtatttta    138840
     tatataggat ttagtgcagt ttctgatatc attagatata aagatacttt gttttgtcat    138900
     tatccattag attcaagatc cgtaatacct aaggaagctc cagagttttt aaaatcttat    138960
     gatttaactg gtattaaaaa aatatatcac ggccatactc acaataattg gatagtagat    139020
     tctaaagatg gtattgaaag aattaattgt tgtatagaca gaaatccaga agttattggt    139080
     gctttgatac catttgaaat ttaaatcata taaggatatt aaatgaataa agtttctgaa    139140
     gttaaaaaag ttacaagagt tttccaagga aaatctgtgt atgattgttt tgttcgttgg    139200
     aatgatacta ataaatttgt gccttgcaca gttgatattc aaaatccagg tgacctgaaa    139260
     ccattagcag attacttact taaacataat cttatatctg gcctttaata aaaggcctca    139320
     ctaaggttta taatgcatag cgatattata caaactctaa gttcagcagg tgcttactta    139380
     cccaatgata ctatatgccc tagagcaaaa ctagacactg gcacatactg caactatcgt    139440
     tgttattttt gctattacca aaatgagtta gataaaaaga ccccgtttga agtcattaaa    139500
     aaaagaatag atactttata taatatagga tgtagagatt tcgatttaag tggtggggaa    139560
     tcttctgtac acccagattt ctttaaaatc ttagagtata ttaaatcttt gaatccagat    139620
     aataaaatat cttgtttgac aaacgggtca aaatttcaga ataaagattt tcttaaaaaa    139680
     gcaaaagatc ttgggttatc tgaaatatta ttttcattac atagtgttaa tgaaactcac    139740
     gataaaataa ctgggataaa aaattcttat aattatataa ttaaagctat tcataatgca    139800
     aaggatcttg atattgtagt tagattaaat tcaactatta ctgatgtaaa ttataaatta    139860
     gtagatactg aatatttcga agttgttgaa aaattagaac cacttgaaat gaatttctta    139920
     ccattgaatt attttagtca gaattcaaaa tcaaagggtg ttaattattc tgagatttta    139980
     gaacctataa aaagattcat agatttatcc aaaattccat taatcaacgt tcggtacgtc    140040
     ccgttttgtt atatgactgg gtatgagaaa tacgtcgtag gatattatca gcatatctat    140100
     gatatctacg attggaatat tgctatgtat gaatacttag aacctaattt agtaaattta    140160
     gcaaaacaag ccgcatctaa tagacaaaaa agttatagga aatgtgatgc ttgtagaact    140220
     tgtaagtatt tttatatctg cgatgggatt gaacctcaag ttcttaaaac aggttgtgag    140280
     tttaaaccta tacaaggttc taaaataaaa gacgttaata catttagaaa atcattcttt    140340
     aatttttagt ttatagtttt agatcttaaa cttagactat agttttagat ctcagacttt    140400
     agattttaaa ctatagtttt aactttttaa cattttaaaa gaggtataat ggatatttca    140460
     ttaattatgg ggcctataag atctggaaaa tctcttgaat tattaagaca agcagaaaaa    140520
     cttcatttta gtaacaaatc ttatgtttta tatagaccta aagcagacac aagagatttc    140580
     atatctagaa gttttagacc tagtttagac ttaaatatac agtactataa caatgaaaaa    140640
     tttagtgaat ctaaatatga ttatatatta ttagatgaat ttcaattttt tgaacctgaa    140700
     attattaaga atatattaga atctaataaa acatttgttt tatgtgcttt acaaagtgga    140760
     actaataata ttaacgaacc ttataatgta gaagttttta aaaatgttaa tagaattata    140820
     ccgttttgta gtgatattag attattaact agtatatgtg aaaaatgtgg tagttcttgt    140880
     gctacgcaca gttataccga tgttatcaca gtttcagatg attataagat tctttgtaat    140940
     aattgtttag attttgagat ttcaaacgct ggtgttttta agagattaaa aacttaaatt    141000
     atcttaaagc aaagcttaaa ttatcttaaa atattattaa aaagtataaa aaatgcttga    141060
     gtttttacag tttatactgt agtataagtc taaaacttaa agcaatatta aaaagtataa    141120
     aaaatgcttg agtttttaca gtttatactg tagtataagt ctaaaactta aagcaatatt    141180
     aaaaagtata aaaaatgctt gagtttttac agtttatact gtagtataag tctaaaactt    141240
     aaagcaatat taaaaagtat aaaaaatgct tgagttttta cagtttatac tgtagtataa    141300
     gtctaaaact taaagcaata ttaaaaagta taaaaaatgc ttgagttttt acagtttata    141360
     ctgtagtata agtctaaaac ttaaagcaat attaaaaagt ataaaaaatg cttgagtttt    141420
     tacagtttat actgtagtat aagtctaaaa cttaaagcaa tattaaaaag tataaaaaat    141480
     gcttgagttt ttacagttta tactgtagta taagtctaaa acttaaagca atattaaaaa    141540
     gtataaaaaa tgcttgagtt tttacagttt atactgtagt ataagtctaa aacttaaagc    141600
     aatattaaaa agtataaaaa atgcttgagt ttttacagtt tatactgtag tataagtcta    141660
     aaacttaaag caatattaaa aagtataaaa aatgcttgag tttttacagt ttatactgta    141720
     gtataagtct aaaacttaaa gcaatattaa aaagtataaa aaatgcttga gtttttacag    141780
     tttatactgt agtattatta aaacgacaag actaaaatca taaatatcta aaaaaaatat    141840
     aaaaaatatt gaaaaattca gtatttttta agtaaatata gtatataatt atttcaatta    141900
     agataaataa ttaagataaa taattaagat aaataattaa gaatacatag aatatttaaa    141960
     gatgctgtaa acttttacgc gtcttattta cagcatcttt aaatattttg tgaagatgcg    142020
     tatatggatc ctaaaaacga atttgatgaa tttgatactc tgttaaactt cttagctgta    142080
     aaaccagaag acgaataccc aggtgaaccc gttgatatat cagaatttta taaagcttat    142140
     aatttaccaa acccgtctga cgaagaatac actgaatcaa attataaaac cgaaaataca    142200
     cttgcagaat ctctaaaaaa tacaaagggt aatgaactag aatctaaaat agcaaatatt    142260
     ttcaacttga ctggttttga tgcctggaat aaaatcatca aaattagggg cgaagttgaa    142320
     aacatacata cccatatcaa attagatcaa agacttaata gacatataaa tcacctatta    142380
     tctgacagat ctacattaag taaaacatat attgaacacg cattacctca acaacgaata    142440
     caattttcat aaagttccta atatatccag acctgttata cctgaaaaag attatattaa    142500
     aaacaacaca aaattcaatg aaatcaatcc accaaaatct atttttgacg tcaattatag    142560
     tgacattaat tttgacccac tatttaatga agttctggat ctcaaaatag ctcaaaaaat    142620
     tagtatttta tattataggg gttatgagga accatttact gaaaaagagc tcaatgaaat    142680
     gctcaaaaat agatctgagc tctttaaaaa atctcgcaaa aacactcgat atggatacac    142740
     ttcacaatta gaacatatta ataattttta cagtataggt gatgaatgcc ttgctaaaag    142800
     tagtttgtta tacacagatg acccacttag atacagagat tataatggac cgctcgtcgg    142860
     atcgttcaaa gctttaaaaa taacaccgac agaatttaaa agtcttttaa ataaagaatt    142920
     taaaaattat attagaaatt cagtatctta tttttatgat tacttaaaac accacgatat    142980
     acaatatttt gaacatatta atattgcaga tttattttat agtctttgtg aattaatgga    143040
     ttatacagaa cataaatgca gagttttatc tgttagagca aattatgtta gggattcatt    143100
     agattatagt aatgttttta atattatgtg ctggctatta tataaattac aatcatcttt    143160
     aggagtagaa aaatgtacag attctaccca aaaacataaa attaattttg atgaacttac    143220
     aaataagtta tattttggtg aatatagctt ctttaaacaa agtctgggaa atttaactaa    143280
     attctatgac agaatcagaa aagaagttaa aaatcaaaaa tatgtagtta aatctataaa    143340
     attttctaag agattaccaa atgtagtgga tgtcaagcct tttaatatgg atgtttatga    143400
     ggagccagat cccgatgact acattaatga tgatgaagtt ccacgtttag ctaccaacaa    143460
     agtagataga agggaagcta aatatgctag agatcgcctg gagttcttga aatactgcaa    143520
     aataccttat ttttatctta ctggtgatta cgcggaaaaa tttgaatttt tagctagagt    143580
     atttgatgtt gatttaaaaa ctacaaccgc ttttagaaga ctaaaaaaat ttgggtcaat    143640
     atataaaaaa tctaaagata ctttggatgt ctgcgaattt aaaaaagctg tcaataatat    143700
     taataaaaaa tactttaaaa aacgcaaata cttaataaaa cgtgagagct ggaaattata    143760
     tgcgcctatt aatataatgt ctataaatgg tcgtgtggca aatcttaaaa tgagagaaat    143820
     catatttagt atagatcgta tggataaaat taaaaaagaa tttgataatt taaataaatt    143880
     aagatctaaa tatggtgcca catttactta ttgcaaagcg aacccacata aacaaaacaa    143940
     acgtgattta aaaaatgctt taaaagctgt tgaaaaatct attaataaaa ttctgaagat    144000
     tgacagccaa atcagggcga aacacccgtg ttctgattcc gaggatggta aatttaagtc    144060
     tttgattaag agattaacag atatggaaga aggtataaga tgttcaggat ctgttggatc    144120
     taaactaagt aaacacaaag atgaattaga gttaagattc aaagatttgg attttgataa    144180
     caatgatttg agtgttgatg gcactaaaaa agctagagat ttaaatttat cattaaaaaa    144240
     tagactttat aattatgttt attcgattgt ttcacctaaa accaaaggtt taaatttaaa    144300
     acagttaata tttaattaca attctagcta tactggaaat gataatttta attctatata    144360
     taatatttta aattattata acacctccac ttttcagctt taaatcgttt caagtattac    144420
     aatcgttgca aaatttccac gttaaatcgt gataaccttg caaattattt tgttaaactt    144480
     gaattaaatt ctgatttctc tattaaaaat ccttaaaatt ttcaagtttt tttagtgcgt    144540
     tttgactctt ttgctgctta taaaacttaa aacttaaagc aatattaaaa agtataaaaa    144600
     atgcttggct ttttagtagt ttatatatgc tggcactgct aaaacttaaa gtaatattaa    144660
     aaagtataaa aaatgcttgg atatttagta gtatatacta tagtattata tctaaaactt    144720
     aaagtaatat taaaaagtat aaaaaatgct tggatattta gtagtttata tatgctggca    144780
     ctgctaaaat tttaagtata tcttaagtat ttatataata taatattaac aatacaataa    144840
     atcaaaggtt gaaaacaatg attaaaacca acaaaaagct cgaagctatt aaagatacat    144900
     tatcaagtcc agaaaattta ggaacacatt tctacatttt agagagtata aaaggattta    144960
     atttcagtgt taagttcgat aaaataaacg gatcaattga atattttact aaaagtaaac    145020
     caattaattt taaatctaat aaaagttcga aaatcaaagt acttaatgat actatcaatg    145080
     gggttagctt aatcagtaaa ttggtcgaat taattaatat taaataccca gaagatgccc    145140
     atattgagtt ctttttgaca ttattttcgg tcggtgctag cgagtctaag tacacagaat    145200
     atgcaatcat aatgtatgac attttagtcg gttcaaaaca gctagaatcc aaatacgaag    145260
     attttgataa tgttttagat tattgcactt tagctggtat caaaacaaat ccaattatta    145320
     aaattgcaaa tgatttagat tctgctttaa gtatctcagt aaatagcgat tcaatgattc    145380
     catatctttt caacaatagt tcgaagttgg tacctatgta tggcattacc attagacctt    145440
     ataaagaatt gcaatataaa ttaagatcta aaacacacag acttattatt gagctcgatg    145500
     agtctaatac atcagcagat tctaaaactg aagattcaga atttcttaaa tttttaaaca    145560
     tagaatcatt aaatgttgta aaagctcaaa atccaaaaaa tttagaaact gagttaatat    145620
     attatataat agaaaaaata aatgaaataa aacacttaag tgtagaagaa attaaaaatc    145680
     taaaatcaaa gtatttacaa agagttaagg atttcatctc tgcgaactaa aatcagaatg    145740
     ttaagtgtta agtgttaagt tctaagttct aagaactaga atgtaaatca aagaactaga    145800
     atgtaaatca aagaactaga atgtaaatca aagaactaga atgtaaatca aataactaaa    145860
     acacaaatca aagaattaga ggagtaaaaa tgaaaatttt cgtgacagga tccagcggct    145920
     tcctaggatc taactttatc aaaatgatat attcattgga ttcaaactct agagtaatcg    145980
     gtttagatat aaaacctggt gaatacactg atagcataca aggtattaaa aatgccaaga    146040
     aatctgggtt gcttaaaaac ttaattaaaa atagtgatat agttgttcat tttgcaagcc    146100
     atttaggtgt tcaaaatatt atagataatc caaacttacc ttttaaatct tttaaaaatg    146160
     ataaaattgt tgtagactta gcggttaaat acaacaaaaa gattgtatat ttttctactt    146220
     ctgaagtata tggtgattct aaagattact cagaatccag tgatttaatt ataagttcta    146280
     aattaagatc taattatgct ttagaaaaac tttttatgga aagatacata caatcaaaaa    146340
     caaataatta tttaataata agacctttta atgtttacgg ccctggtcaa aatccaaata    146400
     atggattcat tgctaaagta ttagcagcag ctttcaatcc taaagaatta atcaaaatca    146460
     gagtcgatac tgagtcaaaa acagggactg aaagatgcta ttgttatgtg gatgacttta    146520
     ataaaattct ttataaatta attaaacaaa atgtcagcgg tgtgttcaac ataggaaatc    146580
     ctatggctag agcaaatcca ttagatatca taaaaataat caatagtttt gggtataata    146640
     taaaatataa attcgaaatt attgaaaatg aaaatgatta tgaaatacaa agacgagttc    146700
     ctagtattgt taaattaagc gaagttgttt ataccgattt tacaaattta aaaactggta    146760
     ttaaaaatat tttgtattat gttgacccac cattttgaga taaaatttaa aacctaaaat    146820
     caacaaggag taaatatgct aaaacattta ataattgcgg gccatccaga tgatgaggta    146880
     attggttgta gttctatact actagaagat tctgttggcg ttctatacat cacaaatgat    146940
     tacagtactg ctaacgcaga acgtaataaa gttaaagata aattagcttt agattatcaa    147000
     aaatgtttga attatccatt tttcagaatg cctgatatca atgaattagc tgataatatt    147060
     aaagacgttt tagactccat taaaccagaa aatgtttatg ttcaccaccc agaagattta    147120
     caccaagatc ataatgctat tacaaaagca acattaatag ctgctagaat gaatagaaat    147180
     gattatatta aatctttaag ttattattat gttgaaaatc catttgaatt aaaagcttgt    147240
     gaatttagaa aaatagataa agatgaaaaa ctcaagtttt tatctaaata caaaaattat    147300
     ataccagaaa atcatattaa aactatttta gcttttaatg agttcgtagg aatttatagc    147360
     aatttaggtt ttgctgagcc gtttgaagtt gtttataagc gttcttagtt caaaagagtt    147420
     caaaagttaa atacaaggaa aataatgagt gaaattataa tgattcacga agtaaatgat    147480
     aaagttctta aagctgcaga atctttagat ccagatagta taatcacatt tgatgatgga    147540
     ttatatacac aatttcatta tagaagtcat tttgcattat ttaaacgtgt tatattcttc    147600
     gtaaatccgt ctataatttg tgaatcttct gagaaacaat ctaaagagta tatacagtgt    147660
     tataacgccc ataaaaaggc gtttaaaggc tgttttgaaa attatatgac attagatcaa    147720
     attcagcaaa tttcaaggga aaatatgtat aattttgaaa taggttcaca ttcttataat    147780
     cataaatatt ttaaagattc aaaatctttg ataaaagata ttcaagattc tttagatttt    147840
     tttgagaatc ataatatacc tattaaatca ttttgttttc cgtataatca agattcgaga    147900
     aacccacatt ttatccaagc agttaaacta aagtttaaag atttggatat ttttggtaat    147960
     aacagagtac ctattgaatc taagttctaa atgttaaata ttagactgaa gtctcagatt    148020
     ttagacttta acaacacatc aaattaagga gcttaagtga aaaatattaa agttaaatta    148080
     atagcagatt ctggtattaa tgtttttatt gatgctgtta gaacttgttg ggatagccat    148140
     agcaagtgtg atactactgg tgataacgta ggagaaaatg acaaagcatt aatagataga    148200
     atagtacaca aacacaaaca ccattctaca ttagaacatt tgttttataa ttttgaaatc    148260
     acaggaattt caagactttg tttgcaggag ctagcaagac atagaatggc ttcattcagc    148320
     gttaagagta caagatacac actaaaagaa cttagaggtt ctaacatctc gactttagaa    148380
     gctgctagca agtttattgt tttaactggt aatgaattag tagacactgc aagtcacaaa    148440
     aatttaaaag aacttcataa catagtcaat acaaatggta ttacccaaga ctacgccaag    148500
     tattgtttac cagaatgtta cagaacttca ttaagatttt ctttaaatgc tagaagttta    148560
     agaaatctat tagaactaag attatctaaa ggtgcgcatt ttgagattcg gtatttggct    148620
     aaattgttgt ttgatgcatt gccagatcta cacaaagaat taattttcaa tgatttagaa    148680
     tattcagaga attaattttc aatgatttaa aatctttaat ataatacaag gagttaaaat    148740
     gtatatcaca aaagaagatg gtgaagaaat tgaagttgaa atagatgaat ttggagacga    148800
     tgacgtctta agatatgcca gggatttaat tgaagatgat agatctaaaa tagaatattt    148860
     taaagatctt atggaaccag aatttaaatt tgatttttta aatgatttat ataatataga    148920
     atacaaaaaa aattattttg aatcatttcc tgagcataaa aaattaattg attttataaa    148980
     agatctatat aatttagaat ataaaaaaga ttattttgaa tcatttccag attataaaaa    149040
     aattaattga ttttatataa agaaaggggt ttagaatgtt atctagaaag ataagaattg    149100
     ataactttat ctctgataaa gaaaaagaag aaatttatca gtattctaga cttctcaaga    149160
     tacaaaaaat gaatattact ttgtaatatt tgattaaatt cttgtagatt tctatagaat    149220
     ttaaaaatca taaaagctaa ttattaactt aaaattaagg attttaatga acgttttata    149280
     taataatgaa tatatagatt tcacaaaaga acctttattt tttggaacag gtaaaaactc    149340
     acaaagatat gatgttataa aatatcctat ctttgaaact ttgtttaaga aaatggctgg    149400
     ttttgattgg caagaagatg aagtacaatg taccaaagat caggcagatt tcaatgtctt    149460
     gaatgaagca atgaaacatt cttatactag agtgttaaac aagttaattt tcttagattc    149520
     tattcaaggc aggggtttat tacaaactat tggatctatt gttacaaatc cagaacttga    149580
     agtttgtatg acagaatggc aaagatttga aatttcaaga cattcaagaa gttacacaca    149640
     tattcttaga tctgtttatg ctaacccaag taagatattt gacgaatctt ttgaaatacc    149700
     agaattatta gaacttgcag atagtatttc aaaaccatat gaagaagctt ttgaagctgt    149760
     aacaaagtat catttaggat taatagatac tgaagaagtt aaagtaaaag ttcttaatat    149820
     gttagtcgaa attaatatat tagaaggtgt tagattttat tctggttttg cgacaatttg    149880
     gagtatgcat tatagccaag gattaatgga aagaactggc aagattttac aattaatttg    149940
     tagagatgaa aatctacact tagcaataac tcaaaatcta attaagatat tgtcaagatc    150000
     tcctgaagaa ggctttataa atgcttggaa ttctattaaa gataatataa ctgatagata    150060
     tttagaagct gctgaccaag agtttaagtg gattgattat ttgtttagca aaggtgcttt    150120
     cttaggtatg accccagaat tagctaagaa ttatattaaa tatcttatta ataaaagatt    150180
     aaaagctatt ggattcaaag aagtttttgc cgggtttaat aagaatccta taccttgggt    150240
     agaaacatat attaattatg ataaaaatga agttcttcca caagaatctg aaataacaaa    150300
     ttataaaatg gatattttag atactgaaat taaagattct gcttttgaaa gacttaagaa    150360
     gaaattaaaa atctaagctt ttagattttt aacactttag tgttatttgc tagatctgta    150420
     gtattaagct tagttcgtta acactatagt gttatttgtt gttaatttta tcttatttta    150480
     agtttattat tatataatta tataaaatta aaaggagtaa aaatgaaaga tttaacaaca    150540
     aagtttatta atattatgtt gaataacaac cacgacgaag ctctgcacaa caaaatacaa    150600
     gaaaaattat ttagttccga tttacaagat tcaaattgtg atacaggttt tgaatcattt    150660
     agacttgaac tcaattgttc aattgatgaa ctcaaatcaa aattattagg ttgcggatac    150720
     cttgacgaca ctgacgagga tctgtggaac ttttttaagt taaaagattc tgatggtgat    150780
     tcgcaatggg ataagtatgt ttacagttta ccttcatcta caagagattt aagcagcact    150840
     acatttagaa ttaaagacgg aaatactatt gttttctacg atatggtttg gggcagcgaa    150900
     caaacttgtc atttgacttt taagaactag taaatattac actttagtgt taacgaactt    150960
     aaacgacact aaagtgtaaa cttctaagct tgctgtatac tattgaatat cagtatcctt    151020
     gaatcttgat aaaatcaatt ttgtaatata aaattgtgaa ctttctattt tatctataaa    151080
     cccagttaaa atatactcac cagaaatttt agtgtctcct tcttgtgttt cattagtatt    151140
     ttcgttagat ttaaataata ctttatattt tgtgaatatt tcgggtgcct taacaactcc    151200
     aggtactact aattctaact tagaataatc taaaaacgat ttatatgtat cggcaaaaat    151260
     attatcatcg tacaaatatt cttgagcttg atattcaaaa ccatcatgat cttgagattc    151320
     tactggaaca tcgaaatcta aatcttcaag attaattttc ataactttca ttgttttagt    151380
     agctttatca aatgcaatta tttgtgattt cggtaatttc agggcttggt ttgtgtttat    151440
     aatcttccta gataaaatat cataagggtt gttaggatct tttttaaaat catcatattg    151500
     tatattttga agttttaaat tatttggttt aagttcttta taaggtttca taacaatttt    151560
     ttgtttatcc tgaaataata ttaatccttg tctatcacat tcttcgaata tgaaatccaa    151620
     tacagatttt cgtgaagtta aaacgaagtt ttcaattacg atattactag ataattccaa    151680
     tttaacagaa tctggattat attttaattt tggtttaata taagtatcat atatatcttt    151740
     aaaaatatct gaaagttttt tatttttata tgttttagct atatataatt tactaaacaa    151800
     ataagatatc aaatcttggc cttgtattgt aaaattggat ttatcagttg tttgggtttt    151860
     attattttta acaacttgaa attctcttct atagtaacct tcactagcat ctaatataaa    151920
     aggaataaat cgcatatcac cggattgatc taaatagtat tgcaaatccg tggtaccatt    151980
     gactgtaaaa taagacaaga tgataaaacc attgaatgaa atttcaccag attttgtttc    152040
     tccagttttt aattcaagtg atttacttga tttattatta agaatagaaa aagtaaaatc    152100
     tttaacatcg caagcgtgag aaaatagact ttgagttccc ggattcatta gaacctacca    152160
     aacacatcat cagaatttgt ataaaaatct tttgtttctt gttgttgttt atctttaata    152220
     gaactcaatt catcgaaata tttttcaagc tcgttatgca tatctgtatt aggtgtttgc    152280
     ttgtctaata attcgtcaga tctaatgaca aaatcacttt caagttcatc agatttttta    152340
     aatacataag ttttacattt aaatttataa acatttttat attgattata aagaaatacg    152400
     ttatttaacc caaaacaatc taacgtaatt tcggtaattt caagaatctt tccacttgga    152460
     acgattatta aagatcctat taaatcgtga attctggaat ctggtaaagt tacatcatat    152520
     tcattcttag aattcattga agattgaact aaattaaatg tggaaatttt agaaacatat    152580
     aaacctatac ttgtatctaa tgggacacca aattgtgttt gcaatctttc atattggtca    152640
     aattcttctg aattttctgg cataccaaat atttcaaaac aagctctatt gtccgcttta    152700
     aaatgactaa aatcaccaaa tgtcaaatct ctgttaattt ttttggtaat gattaattta    152760
     agtggtgcac cataaagtct aatgagttcc tcggtaactg atccgctcag atcatattca    152820
     ttagtatgtt gattaaagtt caattcaaag ccttattttt gatatattta ttattaaata    152880
     cctaataaat aaaatcaaaa ggttcaagat ggacagcaca gataattcta aagctacgag    152940
     tattgaaaca aaccaataca taaaaaatcc aaaatataca acaaaagaag ctattgataa    153000
     atttgttaac ctattgatcc taggtagata cactgaaaaa gatttatcag atgctttgaa    153060
     ctattgctta attcgtagta cagaaagttt tgatagcata gattctataa aagaagctat    153120
     agaagaactt aagaaagatt cagaagcttt taaaatattc atagataata caaataaact    153180
     tttagatgct attcaagaca ttaacaaaga acagactgct gaaattgata aaattaatga    153240
     attcttaaaa acagcagtaa ctttagatac agaacaaact attacaggga ccaaaacatt    153300
     taataagatt tacgtctcgg atccaaccga aaacaaacaa gctgccaatg ctcagtatgt    153360
     tatggattat gttagaaatc aattaagttt aactattggt gatttaaata atttaaaaac    153420
     tgaatctaaa gatttaattg ttaatgctat taacgaagtt cttgataatt taaatattta    153480
     caaagaaact ataaatgaaa ctactattaa tcaaatgatt gatactaagt taaatccatt    153540
     aatagaaaga attacgacaa ttgaatctac tgcggattac accaaagaat tagcagaagc    153600
     taataagcaa gctattgaag atttaaatac aaaagtagtt gataatacta gtgatataac    153660
     ggatatcaat agaagacttg aagaagctgt tttctatagt aaaattgatg atactcgcaa    153720
     aactatacaa cttaaaaatt atgatagcat ttctggtgtt agtaccacag gtgctggtat    153780
     caatattgct atggtttcta aatgggataa agtagattta ggatctactc aaattccaat    153840
     taacttaaac ggatctggga ccagaccaac ttacaatgat tctaatgaaa tagctttaat    153900
     agatgatgtt aatttaaaag caaattctaa tgacgtttat aataaaactg aaattgattc    153960
     aaaattagat actaaagcag attcaaactc agtttacaat aaagaagatt ctgatgctag    154020
     atttgttagt ttaacagaag atcaaagtat tgaaggtaat aaaacaattg aaggtatttg    154080
     ggaatataat ggagtattgt ctaaaccaaa acaattagca actaccgaat atgtgatgaa    154140
     ttatgctaaa acatatgcta accaaaaagt cggagatttg gcaagtctta aaacagaagc    154200
     taaagataca gcagtgtctg ctatcaacga attatttgat aagattggat ctgggagtgc    154260
     agacagcaaa caactaatac ataaagaata cctagataaa aatattacag ataatgtagc    154320
     atataatatt agtaatactc cattaatacc ttacactgat gttagttctt taaacaataa    154380
     aaaaatatct ataagaatat ctgcgacaac taataactct agttattcat ctggtgatac    154440
     agtagtagtt agtaatttca agataaaact taaaggagat gatgaatatc ttaaacctta    154500
     tggggttgaa gttattgata gagaaaataa taaaataggt ttaaatttaa taggagatga    154560
     tacagtatat aatgataatg atgctttatt atctacaaga ccttctgatt ttaattcatc    154620
     tagtgtagat ctttctagtg gaagtaacgc cttagtaact gttaaaacta atggagctta    154680
     tgattatagt ggagtttatg atataccaaa tccttttaga gaatataata aaaaatactc    154740
     tttattctta agtaatgatg ggttaaaaaa tccttattac caagttgata taaatagctc    154800
     caaacaagtt gataatatat cttttcaatt atttggaact agtgctacaa atcctttttt    154860
     atattctaaa gactgtaaaa ttgaattgtt tatagaaaat actattgtaa aaaccttcaa    154920
     tattaaaggc agctctggaa ataatagtcc tgtgaatatt aatatagatt ataaagatgg    154980
     tatgttttta atatctgttc ttgattctat aaattacata aataatagaa ttaataaaaa    155040
     tgcagaatta cttacagggt caggcaaacc taatttttca ttaaacccta acaaaatagg    155100
     ttctctatac tctgatacaa ctaataaagc tgtatatatg tgtatagaca atacttctgg    155160
     tgctaataaa tgggtaaata tagtaacagg agatgaaatt aaaccaaacc ttagaaaaat    155220
     agaaattact tgtaatgtaa gattaagaag tggccaatat ggtggttgta tgagcggtgt    155280
     taaaatagga tttgataacg gatatgcttc tacaaaacaa atagttaaag ggttaaatag    155340
     tggtcaaata ttgctatctc tagatgggtt gggtaacctt tctggatatt ctgaagtcag    155400
     ttctttaact cctagcagtc aagatataaa agttgatgtg gatactactg ggatatataa    155460
     cgacccttca tatcattgcg ttactaatat atttaaagaa taccttggca atgctgatca    155520
     atgttcgcta tggtctgatg ctagtgttaa acaacttaaa ataattttat tatctgaaaa    155580
     gattcctaat aaaatattgt atgtaggaga cggatattat ggtcaaacat ctgtttctga    155640
     tgtaaaagct atatggtatt atgtaaatga taatggagac aaaatagaag gcagtataga    155700
     taatgatttg gaaataagca ataataactc tgaaacaaac gatagttctt atatatatgc    155760
     gttcaatata aattagatat gtaagactgt attaatgata gtgccaacta aagacttttt    155820
     aaaagatatt atttggaaac atcattatta ttttttgatt cattttatta aagaaaacag    155880
     agatatttat attgtcttta taattataaa taaagttcga taaataattt atatctaata    155940
     gatatatcat aagaataatt taaatttaat ttagtagaac attttaattt aggtgtttct    156000
     acaaatatga tcaaatgggg gttctattaa ttttaaaata gtccctggtt taactattga    156060
     agttggggat tcttaatggc tttctttcat tttaatactt taagaaaata tactggggct    156120
     ttgatacatt tattttctaa tttagaaata caaactattc aaagtaatgg taaaccatta    156180
     tattctatag ttcctattca gtatgctaat agagaaagat ttgatattta tagccaatta    156240
     tcttataatc aaatgtttaa tggtaataca caagttttac ctagaggtat acttttgttt    156300
     actggtatga atgctaatat caacagagca aaaaataaat ttgctaaaat atatagaaaa    156360
     tcacaaataa ttaaaggcga aactaaaaaa ttaaattatc aattcaattc agtcccttat    156420
     gattttactt atcaagtaat tatacaatgt cgtggaatga atgaagctag tatgatatta    156480
     gaacaagtta ctagttattt caatcctagt tattgtttaa gaattaaaga agtagattta    156540
     ccagattttg gagatacctc ttgtatatta gaattaaact caactagtgt agatcaagaa    156600
     tctatggatg aattaagtac taatattgta acttgcactt ttgatttaac cttaaggggt    156660
     aatatatacc cagcaataaa agaacatcat ttaatagaat tggttcaatt gtttatgagt    156720
     actgatttac cagaatctac tgaagttaat ccagtagtta cgagagctta ttctgaaggt    156780
     tctaaagaaa ctgaatctgg tattcaaact tttataaatc aatacaaagc agttattaag    156840
     gatatagaat tcaatcaaga ttatttactc tgtaaaatag attctgaatg tgagaaactt    156900
     attaaattta gatttaattg gtggatcaat gacatcaaac aagacagtga aattgaaaaa    156960
     ttacattatg taccacgaga tggtgatatc gtaaaagttc aagcatttac tgatattgtt    157020
     gagagtgata tctttgaaaa agaattttat tctgatgaac caagatatga tttaattatt    157080
     aatgatttaa tcagagataa agaattctta gaatgtgatt ttactgacag taatacatca    157140
     aatattaaat atacatttga atggtttata aacggcaaaa aattagattt aactcaacga    157200
     attattaaat ataaatctaa agttagcttt gattgtgaat gtattattag aagctctgat    157260
     ggtagagaag ccaaatattt taaacatttt cataataatg aaatgatttt taaagattct    157320
     tttaaagtaa aagattctat gaagcttgaa ctcaaaacag atttgaaatc tatagccatt    157380
     ggctacaatg attcagtgaa tttcgatact aataacgatt caaatgataa ttcaaatggc    157440
     aattaaggtt taaaatgggt actttttcat tttcattatc ggatataaag aaacaattag    157500
     gtcctggttt aggagttaga tcaaatgctt acttactaga agttgctgta gtaggtgctg    157560
     tttctaaaaa attagcagtt ctttgtcaaa gcacagcgtt acctgaaaga aatattggaa    157620
     ccactgatat attctacaaa ggtagaaaat ataagatgcg aggtgaaaca gacttaagtg    157680
     gtacttatac tattaatata actgatgatt ctgaaatgaa acttagaaga atgttcgata    157740
     gctggatgag agaagtggat aatactacac ctaaagggac taatgcttta gcaggcttat    157800
     ttggtggtgc tatgggtgat ttaatggagg tagctaacgg aactttgaaa gcggttaatg    157860
     aaattaaatc tgcttgggag tttgatggtg gtgtttcttg gcttaaaaat atgattatgg    157920
     gcaagccact gccagcaaat tatcaaacaa ccgtaaatat ttggcaatta actaaagtca    157980
     aagaaaaact atatgggtat gctttgacta atgcttttcc tattgaagta ggtgcagtag    158040
     aagtttctga cgaaaatgaa aatcagttat ctatgtttag tgtaactttt gcatattcag    158100
     attttgaacc tattgaagat aaaggtataa tcggtcaaat agttgatact gtaataggcc    158160
     aagaaggtca agaaattgca caaggtgttg aaaatctatt ggattaaggc attcttttag    158220
     tttaaaactt tttaagcttt aatattatat aatatattaa aaatttaaat ttaaaagatt    158280
     taacactaca gtgttaaatg ttagctctac aaaaaactgc taaaatcacc aaaaattaag    158340
     aatattttaa ggattaatac attataataa cattgtaaag gagatcaaat ggatatttca    158400
     attaaagaaa tacaaccaag ttctgaacaa ctgagacaat acaaagcgca aagaataaca    158460
     caaagaaaac gcatcataaa aggtgggttt gagcacgttc tcgtaacttc ggattctgac    158520
     ttagatggta ttcatatagg cgctttattg atggggttta tagaaagatt taggccggaa    158580
     tacaaaggta gatttggccg gtttaatacg cctgttaaaa tggttttaaa gggtgaaact    158640
     cctatcaagt ggacttatga catcactgaa gagttaccgg ttaaatccgg tgaaaatgcg    158700
     aagtatttca aaggtttagg atcttggcaa aaagaattat tagattttgt tattaagaag    158760
     gatggattag aaaatatgat cgatgtctat gatttcgata atattaatat aattaatgac    158820
     ttcttaggct ctgaagagag tgataaaaga aagaattata ttagaaatca ttcttttagt    158880
     atagcaagtc tgtaattatt tgattgtttt acattttggt gatttaattt gattctaagt    158940
     tttaaacttt agttttaatt tttaaacttt agtttataat atataatcaa tattaaatta    159000
     agtttttttt ttaattttta caattggttt taatataata gattaaaacc gattaatttt    159060
     tttaaaggat attttatgga tattaatttt gattggaatt caatgaatgc gggagctaac    159120
     ccattcgaat ctaaaagtta cgaaagtgat actcgttttt ataccttggc aaaagatgaa    159180
     aatggaaatg gtgcagcttt aatcagattc ttacctagtg aagttcacga aaatggttca    159240
     atgagtacta ttatgaaagt attcaaatat aatgttagat ctaaaacttc taaaagattt    159300
     atagctgagt ggagtccaag cacgattggc ttacctgacc caattcaaga aaagtgggcg    159360
     gccctttgga actcagggca aaaagatgaa gcaagaagat atgcaaggtc tacaagatat    159420
     attgctaata ttaaagttat taaagatcca aaaaacccag caaatgaagg taaaatcttc    159480
     ttatttgata tgtcacaaac acttggtgag aaaattaaat ctattttaac accaaatgaa    159540
     caagaattag cactaggtgc agttgctaaa aatctttttg atcctataaa aggatttaac    159600
     tttaaattga ttgcaactaa aggagctaat ggatttacag aatattcaaa aagtgatgct    159660
     gaagcaaatc caagcgcaat ttataatagc gtagaagaag cagtagcaga tattaaaaat    159720
     aatgcttata aattgtcaga ttggcaaaaa ccagaaagct acaaatctta tgaagcattg    159780
     aaagaattac tagatggttt agatacgcca gtagaatcta acaatttaga ttcaatggtt    159840
     caagcagcac cagtaacaag ttttgctgaa acagaagcac caaaagcccc acaaggtaca    159900
     ttatcggtag caactccaaa aacagaagca ccaaaagctc caagtgctaa ccaagcagat    159960
     aatcttgatg agttgatggc tgatttattg aaataactta tagaagctct gatgagcttc    160020
     ttctcaagga agaattatga ttgatatcga aaactttaaa ccacttcaag attttgttct    160080
     aataaaaaca gaacccgtta aatttgaaac tgagtctggc atcattacaa aaatacaaaa    160140
     atcaaatctt tacgacagac caaccaaagg tgttgtaatt aaacaaggtc ctaaatgtca    160200
     atatgatttg gttaataaaa cagttcaatg ggatatcaca aaaggtcaag atattgaaga    160260
     aaattatatt ctcttgactg aggattcaat cctaggaatt atagagtaat gagagcacag    160320
     ctttttgaat tacaccaaga actcaacaat gatgataata ccagtagtga tataatgttg    160380
     ttacattgtg atatgtttcc ttatacagga aagaatatca taaatttaca tatacaagaa    160440
     caaactatga ttaatgtggc agctggtatt gcttatactg gtaaaccagt tataatttat    160500
     ggtgttcttg gatttgtttt tcttaaagct cttgagcaaa tcaagtttag tatattagat    160560
     tttagtgcaa aatatgctcc gataattatg tgcaatgccg gttataccgg atgttatgaa    160620
     atgtttggta aaggtcatat ttttaatgaa gaattagatc tttgccgaat ttataatata    160680
     gatttctttg taccaaataa agaaaatttt aaagatttaa taaaagattg tttaaaaaca    160740
     aatggtttca aatatattct aatatactaa atatattaaa atattaaaac attttaagct    160800
     aaagctttaa ttttttaaag tgctagcttt taagctttag cttatagtta tcaaatattt    160860
     taagctttag cttttttaaa acttttgtaa ctttaaatta aaaataaata attcaaaaca    160920
     taggattttt aatgaaagaa ttaacggcat cgtggttaag ccgtagattt acagataatg    160980
     actttagaag tgttctcaaa aatgtagttc taaaagatgg tataggtaaa ggtgttaaac    161040
     gcccaaataa tgctaccaat tttgttgata caaaaactgg cgaattaata gaacctacta    161100
     aaattcgtga atttatcaaa gccatgaatg tggaggttca aactcgtaat aatttctata    161160
     aaggcaatac cacttatcaa aacgtttcac aagttactca aagtggtatt ttacagggtt    161220
     ctgtggtttc aaacacacct tatactgcta tgcaggttgt tttagaatca tttgtaggtg    161280
     atggtattgt aaattttgga accgcagttc aagccgattt caatcaagtt aaattaaatc    161340
     aaaaatcttt gtttttagca cacggtaatt attttgcaag attagaattc accgcaagcg    161400
     cgattgttaa tatttctggt ggtgtaagat taacttataa tcaatcacaa ctttggtatg    161460
     atcaaggcag atcaaaagtt aatattaatt atgatgcttt aacaaaaata ctagctctta    161520
     aagattttac agacgtagaa gttggtatag cagattttag ttctaaaaaa attaaatggt    161580
     tcaataacgt taaacttaaa gcaagcacat taaaattcac agtttcacaa aatacagaaa    161640
     atgctaataa aacagtgcaa aaacgcatag tttctgggta tttagatttt acaattgatc    161700
     aaactattga ggatgcaata tctgagaaat taagaggtgc tttgattaca gctgctagat    161760
     ttaataaatt caaacaatta ttaaataaag ctgaagttgc ttgtttgtgt gattgtaatt    161820
     attgtacttg tgattgtaat tattgtactt gtgattgcaa ttattgtact tgtaactgca    161880
     attattgtac ttgtgattgc aattattgta cttgtgattg caattattgt acttgtaata    161940
     ataataaaga atacactgat agtgttaatt attggaatgg tgttgtctgt acttgtaatg    162000
     ctaatattac ttgccaaact caaggccctg gatatacacc agtttatgaa aacaaatata    162060
     tgactgagtg ttcttgtcaa ggtgataaaa gtgttccgca atacaaccaa tacggtcaaa    162120
     tatatggtta tgcgtgtaga tgtaatgcta actggattaa ttctgttaga cagcacgcta    162180
     ccgtaactca agtatgttct tgtaacgttg ataaacaatg gactaaaaac attacaggta    162240
     aaccaatttg ggataaaaaa tctacaggac aaatcgacaa tattgtcaac aataatactt    162300
     caaattccca agtaagtact acagtaagag tttgtgtttg tgatacaaat gtcacaatag    162360
     ctgcaaaatg tgctacaaat agaacaatgg cttatgttga tggatcgact ggaaatcaag    162420
     gtggttacag atgcgtttgt gatatcaaca caaatagaca agttgcttgt tctgccaata    162480
     gagaatataa atatgtcact gactacactc aatttcaaaa caaaaaatac aattaagaca    162540
     caattaacat ataatcagct tgaagttctt aaaaagagct tcaatgcttt taaaatttaa    162600
     gatcaaagtt ttaaaactaa agtttaaatt ttaaaatatt tttaagtcaa aatatattat    162660
     aattatttca ccaaagatgt atatgaagga gatagaatga attatttaga acttaaaaat    162720
     atggcagaga atttaaaaga ttctaattat agatcaacaa aattaaataa ttttaaattc    162780
     tatacttata tattttcaga ttataaaaac ttcaaagaaa ataacacctt tttcataaga    162840
     ggtttaatga tagattctaa atctatatta aacaaagata ctttagcacc tggcatatca    162900
     ataccaatgc caaaattctt taatattaat gaaaatgaag attggttatt accagattct    162960
     acaaatcttg aagatttcac tatagtgaca aaatacgatg gttctttgat gataccttat    163020
     gaatacgatg gtataaaatt tagaactaaa atgtctattg acaatgatca aactaaatta    163080
     gctaataagt atatcaaaaa taatccagat atattagatc taataaaaaa taatccagat    163140
     actcagtact tttttgagtt gatttcacct ttaaatagaa tagtagtaga ttataataaa    163200
     actgaattaa aattaatagc tgaattagat cttagaacat tagaatttaa aattcacgaa    163260
     actaacgagt ttaattttaa agatttaaat attaagacgc taaaagatct caaagattat    163320
     ataaacacca tatctaatta cgaaggtgtt atactacagc ataaagtaac taaaaaagtc    163380
     tacaagttaa aaacacaaga atatttagac ttacataata ctatgactaa tttagattta    163440
     aaagtgatat acaaaatgat attagaagaa actatagatg atgtgttacc aaaattatca    163500
     ccagaagctg tagcttacat tgattctgta tctaattcag taaaagttaa gttaaatgaa    163560
     atattagatt ctatagattc taattatatt aaaaccaaag atcttgaaac accagcttta    163620
     tatataaaag atttaaatat agatcctata gccaaagatt gtttatttaa attatgtaaa    163680
     aataaactta atttagacga cgtcttaaat caagttaaaa aatctatgtt gaaatataac    163740
     aaattacgag atattaaggt ttttcttaaa tggattcatt aatatattat attgcagttt    163800
     acggtggaat atgcgcgatt ttgagcgttt ttgtagtata tatttctcat aagttttaaa    163860
     ggtataaaat gagtacaatt aaactaactt ggaatgatat tcaccaagct ttgcataatc    163920
     ttacaaatga agtagatctt aaaaattttg attgtatatt aactcctaat agaggaggat    163980
     taatcataac tggtatgttg caatacactc agcgtgttaa attacctgtt tatgtaatta    164040
     ataattctga tgtaatcaac attcaaaatc ataaaaaaat tttgttttta gatgatatta    164100
     atgatacaag taaaacaata tttaaaatac aaaaagtttt taatggtctc ataacattta    164160
     aaacattatt tgaaagatat aatagtccat ttaaaactga gactattaat atcattatga    164220
     gtgatgcttg gttaattttt ccttgggatg ttgaaccaga agttttaaat ctaagaaagt    164280
     gagtaattaa tatgattaaa acactagtac caaaaataat cagaaattca aaagtttata    164340
     gattattaaa aaatatcatt aaattcagag atgaattaac aatttgggga ccttatgagc    164400
     caatatttga tttaaaattg atttataaaa tgcttaaaat caaaagagaa tattggctca    164460
     atgattgtgg gggtgcagtt tatgaaggtg ctgaaaaaga attagatact ttaaacagac    164520
     tcttaaatga gttagactta gtatttaaat attcaaatgg tggtgatgaa caaactgcta    164580
     tgattcattt tgatattttt atggaaactt ataagaaaaa tgcttttaaa ttgtggtgct    164640
     gataataaca ctatagtgtc cgaatctaaa atactaaaat actaaaaata tttaagttgc    164700
     atttaatcat aaatagtata taatatatct aaaggagaat tatggaatat ttaccaaaaa    164760
     cacaagggcc taaaaaactt tataattttg atattaatat gactcaagcg tgtacgctaa    164820
     gatgtacata ctgtattcaa gattttaata aacaaaaatt tgaaaaatta tcaccagaac    164880
     ttactaagaa aatgatagaa aagtttgatt ttctgttaaa ttcagtagaa ttcaacaaac    164940
     attacgatgg aatcagaatc tcattttggg gtggtgaacc tacaactaac ctagaaggtg    165000
     ttaaagagtt tgtagaatac tatagacaca acccaagagt ttgtttcttt atgtattcaa    165060
     atggttataa atacaaccac gtttttgatt acttagaaac atttaagtat atgccaaatg    165120
     tcgggtcaga accaaaattc ctgactcaaa tatcttatga tggaatggca agccacgatt    165180
     cagatagact taatttgcaa ggtaagggct cagcacaaca agttaaagaa actgtttttg    165240
     aactagcaaa aagaaatata ccttttattg tacatcctac aattgcagct aagaatttcg    165300
     ataagattgc tattaattat ttcgaattta aaagaatgtc ggatgtctta ggtattgaac    165360
     ttaattataa ccctacaata gattatatgt ctaaatatga ttttacaaaa gaacaattag    165420
     aagcattgac aaatacttta aaagaagaat tcttaaaaat acgtgatgct gaagttgagt    165480
     tctttaaaag aaaaggatat tttaattttg gctggatgaa tccaaataga agtatttgta    165540
     cagcaggtga tggctattct ggtattgaat tggatggtaa aatgtatgct tgtcacggtg    165600
     tttttagtga agaatataaa ccaaataatg ttttaaatga tattaatttt gagaatgtaa    165660
     aatttactga tactttaatc aaaagctcac aagatcatag aaaaatatta aatgaaaata    165720
     tgcctaaagc ttgtcaagaa tgttttacac attattgttt aaaatgcaat tctacaaaat    165780
     ttggtatttc taataaagaa acctatgctg aaagatggac tgattatagt tgccaacctg    165840
     gtttatgtta tatgtttaaa ttcataggta aatatagaat agctttgatg aaatatattc    165900
     aagcttctta gaattctaaa atagttctaa attgatacta tagagctagc atctaacact    165960
     ttagtgttaa cgaactaaat tgtaaaagtt aacactttag tgttagatgc tcagatccaa    166020
     aataaatata caaaaagtag ggtttatttt gggtataata aaatcaactg ctagaggtat    166080
     cagaggtact tatagagcag gtaaaaatgt agttaatagt gttaattctg cttataatag    166140
     tgctgttagt ggtataaaca aagtaaattc tgctttagat cctatgaata cagttagaag    166200
     tgctacacaa agacttaata actggattga ttcaagttct aaagtgtcta agacaactca    166260
     aaaaaataat gattcaattg tcaacgaatt aaacaacgta ggcaatgaag ttattagtgc    166320
     tgctaaagct ttagatccta tgaatgctag aaaattaact gaaatttcag aatctcttaa    166380
     aaatctttca aaacaaatct cagacattaa aaaaggttta atagataatc aagatacaga    166440
     aataagacac caaggttttg ataaaaaggt tcaaaacgtt tcagaatcta aagtaaatgc    166500
     acctcagaat aaaagttttt ttgataaact tttaggttgg ttagggggtt tattaggtgt    166560
     atcggcaggt gctttattac cattattagg ttcattagga agttttttaa caaagccttt    166620
     agatttcatt ttagatctat taaaaggtgg tattaataaa ttatggactt tatttgagcc    166680
     attattaggc cctattatag accctttaaa aaatggattt gatttcttaa aaaataaatg    166740
     gaactcatta gtagatttta tcaataacaa aattaatatt ggtgataaat ggaaaatttc    166800
     tgataatgat aatccaaaaa atccaaaatc accaaaagta agttcatcta atccagctaa    166860
     agaacaatct tggttgtcta agaaatggga ttcttttaaa ggtgctgtgc aaaatggata    166920
     tgattggtct tcacgaaaaa tagatgatct aaaatcgtat gctagcaaga aatatcaaga    166980
     tattaaaaat tctaaagtag gtaaaattat atccgcaggg tatgataaat taaaagcagc    167040
     acaaaaatat atagtagaaa aagctattga aggatttgat gctgttaaaa atatggtaag    167100
     ctctgcttgg gattcagcag ttaaagcagc gcaaaaaggc tttaatatgc ttaaaaagtt    167160
     tgctttagct cctatggaga aatttgttgg ttcagtaggt aagaaactat ttgggggttc    167220
     taagttattt tcaattttac caagtatact tggaaatctt gaaaaaatag gagcaagatt    167280
     agctgctagt ggtgctaaaa tagcttcaaa agctttaccg ggtgttggat ttgcagtagg    167340
     tatatatcaa gcttgggatt tctttactcg tggtagatgg gtattgggtt caatagctgc    167400
     acttagtgct tgtatttcat tgttaccagg tattggtgga atcatatcta tgtgtttaga    167460
     cttaggttta tttgctgctg atattataac aagcccagaa gatgtcgata gccttaataa    167520
     agaacaaaat gatttagtta atgtggtgaa taaaatggtt caaaataatg atactggagg    167580
     tattccagaa ccaagtcaag tagaaaaaga taaagcacaa tctggtgttc aagattcaag    167640
     ttccagttca ggtgctaaag gattaaatgc taaagtactt gacggaaaat ctgctaatga    167700
     ttttacagct ttgtatacac cacataaagt ggatgctaat ggaacagtta tagcagctaa    167760
     aactggttct atatataaag gtttgacctg ggaagaatct gaaaaatatg atgctgaaaa    167820
     acaagcttat ttcaagaaac gcgaagaaaa gcaagctcaa ttagacgcac tttttgaacg    167880
     aggccaaaaa gctatggatt ctggtgatac cgaaacgttt aataaattag ccactcaaag    167940
     aaataaatta tcagatgaat tatctaaaat gagtttagat tctattaata ctaagtacga    168000
     agctatgggc caagctagaa ttaaaaaatt acaaaatcaa ggagctaatg cagatttatc    168060
     agtatttaga actaatgctg attctgttac tagttcaggt ggaactgaca caaaaccaga    168120
     ttctacaaat gctagcgcaa gtgtagcttc acaagcttct ggttcaatca cccctacgat    168180
     acaaacccag gaagctcaag gctccagttc agggggatct ccaggatcaa aggctgcggc    168240
     agaattcagc aaaaaatata acttagggat tagatcaact ggttcgtgtg ctaagtatgt    168300
     tagatcttat ttaatggctg cggggtatcc attatctggt tggccagtag cagctgctga    168360
     ttatataaat ttcttaccta aatatggttt cacgccagtc caaggtagag ctactcaaat    168420
     aagaccagaa gtaggtgaca tttcaataac ccagagattt ggaaatcaca aatatggaca    168480
     tattgctatt tggaatggtt ctaattgggt ttcagatttt aaacaaaact cagtttcaat    168540
     ttatagagac gtaaatgctt tcggtgggcc ggatgctaat ataactattc taagagacac    168600
     ttcaggtcaa aatccatctc aagaacttgt aaatcaacaa ttatccaata tgaatagttc    168660
     ttttaaagtt gcattagggg gaggaggagc taaaggtgct gtttatagtt tggcttctgg    168720
     agtttcaaat gttgttacaa atacagctgg tactgcagcc agtgttataa gttctggtat    168780
     tagcagtgca caatcttttg ctaatgctaa ttctatttcg accagaaaat ctttaactca    168840
     aatgtataca gaatctggat taagtactag ttttagatca agttcgaccc caagctcagc    168900
     ttcaagttct acaccaaaag aaacaaaagc agatattaag ccaacttcaa aagcagttcc    168960
     taaagctgct agccacggaa ccccaggcag aggacaatat gatgctgaaa caatgtcaga    169020
     ctttaacaac ttagtagata actttagtaa atccaaatca ccaatttctt tacctggaga    169080
     ttctaaacct gccagctctg ttagctcgaa tgttcaaact aataacgcta gcccagtaac    169140
     acctgtggtt attacaaaga acacttcagc ttcaagtgat tattcttggg cttctaaaaa    169200
     cagttttaaa attgctagaa tgtttgggtt agatggcatt agtgattacg aaatacttaa    169260
     tgaaggtaca gaatctgact ttttacaatc ttatggtata tctaaaagac gcgcaataca    169320
     agcagcagga ttaaacaata ctgtacaaac caaagctgct agcaatgtta aaacaaaaga    169380
     tgctgtacca gctgtcaata aaacccaaat aaataatacc aatatacaga ctaaaacaaa    169440
     agaaacttct aataaagatt taactgattc ttttgttttg agctaaggtt cattaaatac    169500
     aaaggattaa attttgggat tatttggttc tgttagcagt gtcatttcag gtgtcgattt    169560
     accaaaagct actaaaactt tctcagctag caatggtgct gaaattctaa aatttactaa    169620
     agctttagaa tctgataatt ttaaacataa acaaataata ttaactgttt atgacccaaa    169680
     tgatttctat aaaaaagtca aagatgctat tggccaaaaa atgtcaagtc tgatggcagc    169740
     aggaacttca gcattttctg gtgatggata tgattcttca aaaaacagtc aaaccctcaa    169800
     agatgctagc caagatattg tagatatgtc agcagtcaat atattatata caatacattt    169860
     accattaatg aatgcgttcc aagagcaaaa ttctcataat tattctgaag atactggtat    169920
     tttaggttct atagcaaatg ctgctaatga attatcaagc accgctagtt ctggtataat    169980
     tgaagcttat ggtagatttg gagattttgg tggaaataca gataatatgg cgtttgcacc    170040
     acaactacca caagtagatc cattaaaatg gcaaaacttt aaaggttcta acctaagaac    170100
     atttcaattt acttttaaaa tatctcctag aaatatagat gaagcttcta atatgatgcg    170160
     aatattttgg ttattaaaaa gaagttcata tcctaaaaaa gaagctggtg gtgtcttatt    170220
     gataccacca gcaagaatag gtgtacaatt ttcaaaccca ctactacata agttaatagc    170280
     tcctggtatt tgtgtaatag acggtgtttc tatggtttat gaaaatggtg atgatattgc    170340
     tgtaacatta gatggtgtcc cgaagaaaat agagtttaca ttatcattaa aagaattccg    170400
     tcaaaaatac caggatgatt ggaattttga aaatgctagt ctataggagt caaaatgtat    170460
     attaataagc aacttacaaa ttatttagat aattattcgt tcagtgaagc taataaaact    170520
     gaagcagaag tttgtaatgt tagagattat aggtctatgg attatagcgc tataacaaaa    170580
     tatattaatg attctaatac tattaatgtt aaaataaatg caaatgattt cattgaaagt    170640
     gtttctaata gattgtataa tgatcctaat ttatgggatt tattaatgct tattaataat    170700
     aaagatgcct tgagtgatat gccttatgat aacgatagaa tagcagatat ggctgatgaa    170760
     ttgatagcta attattttaa taatcctgag aaaccatacc aaggtaatgt tactgaacaa    170820
     ttaataactg aatacagaga atatttgata gatttattga cacaaaagaa ttatcaaaat    170880
     atgattataa aagctttaga tcctgtgtat ttaggtgact tcttaagact ttttaagtac    170940
     aagtaattta ataagccaag cattttttat actttttaat attgctttaa gttttaagca    171000
     tatactagga tatatagtat tgttatatac tattaaaaac cctagcattt tttatacttt    171060
     ttaatattgc tttaagtttt aagcatatac taggatatat agtattgtta tatactatta    171120
     aaaaccctag cattttttat actttttaat attgctttaa gttttaagca tatactagga    171180
     tatatagtat tgttatatac tattaaaaac cctagcattt tttatacttt ttaatattgc    171240
     tttaagtttt aagcatatac taggatatat agtattgtta tatactatta aaaaccctag    171300
     cattttttat actttttaat attgctttaa gttttaaaat ctaaactaaa gttttggttt    171360
     taaaaacccg aaaaaaactt ttttaaaatt ttttttaaaa agctttatat tataatatat    171420
     catattaaag agtaaaaaat tttttaaaaa atttttcaag ggcttgaaat ctcatattaa    171480
     aattcaaaca aagcttaaag caatattaaa aagtataaaa aatgctaggg tttttaatag    171540
     tatataacaa tactatatat cctagtatat gcttaaaact taaagcaaag cttaaactaa    171600
     tattaaaaag tataaaaaat gctagggttt ttaatagtat ataacaatac tatatatcct    171660
     agtatatgct taaaacttaa agcaaagctt aaactaatat taaaaagtat aaaaaatgct    171720
     agggttttta atagtatata acaatgctat atatcctagt atatgcttaa aacttaaagc    171780
     aaagcttaaa ctaatattaa aaagtataaa aaatgctagg gtttttaata gtatataaca    171840
     atgctatata tcctagtata tgcttaaaac ttaaagcaat attaaaaagt ataaaaaatg    171900
     ctagggtttt taatagtata taacaatact atatatccta gtatatgctt aaaacttaaa    171960
     gcaaagctta aactaatatt aaaaagtata aaaaatgcta gggtttttaa tagtatataa    172020
     caatactata tatcctagta tatgcttaaa acttaaagca aagcttaaac taatattaaa    172080
     aagtataaaa aatgctaggg tttttaatag tatataacaa tactatatat cctagtatat    172140
     gcttaaaact taaagcaaag cttaaactaa tattaaaaag tataaaaaat gctagggttt    172200
     ttaatagtat ataacaatac tatatatcct agtatatgct taaaacttaa agcaaagctt    172260
     aaactaatat taaaaagtat aaaaaatgct agggttttta atagtatata acaatactat    172320
     atatcctagt atatgcttaa aacttaaagc aaagcttaaa ctaatattaa aaagtataaa    172380
     aaatgctagg gtttttaata gtatataaca atactatata tcctagtata tgcttaaaac    172440
     ttaaagcaaa gcttaaacta atattaaaaa gtataaaaaa tgctagggtt tttaatagta    172500
     tataacaatg ctatatatcc tagtatatgc ttaaaactta aagcaaagct taaactaata    172560
     ttaaaaagta taaaaaatgc tagggttttt aatagtatat aacaatgcta tatatcctag    172620
     tatatgctta aaacttaaag caaagcttaa actaatatta aaaagtataa aaaatgctag    172680
     ggtttttaat agtatataac aatgctatat atcctagtat atgcttaaaa cttaaagcaa    172740
     agcttaaact aatattaaaa agtataaaaa atgctagggt ttttaatagt atataacaat    172800
     actatatatc ctagtatatg cttaaaactt aaagcaaagc ttaaactaat attaaaaagt    172860
     ataaaaaatg ctagggtttt taatagtata taacaatact atatatccta gtatatgctt    172920
     aaaacttaaa gcaaagctta aactaatatt aaaaagtata aaaaatgcta gggtttttaa    172980
     tagtatataa caatactata tatcctagta tatgcttaaa acttaaagca aagcttaaac    173040
     taatattaaa aagtataaaa aatgctaggg tttttaatag tatataacaa tactatatat    173100
     cctagtatat gcttaaaact taaagcaata ttaaaaagta taaaaaatgc tagggttttt    173160
     aatagtatat aacaatgacc tcatttcagt taaaattcag ttatatttta atataatacc    173220
     gtaagtataa aaaataaata cttgaatata atataacaag caaggaaata tatgactagt    173280
     aatagctatt cgcaatctag taattataaa atatttttac cttttctagg cgatgaatgg    173340
     atatatgctc aaaatatagc attgccaggg tttagtctga acccaagtca agccaacttc    173400
     ggcggtaaaa ctatttatgt tggtggtgac cacatagact atgacccagt aactgtaggt    173460
     ttccttgtag gtgaagattt caaaatatac acaaaattaa tcaaatatat tttcgacaga    173520
     gttcacccaa ataatggtaa tatcgaacca ttaaaagaat ttacttgcgg tgtggaaata    173580
     accgataata agggagaatc attagtcagt atgactatgt atggttgtaa aatcacaaac    173640
     ttaggtgctt tacaactaat atcgaatgct gatgatgctg aacaaacttt tgatcttact    173700
     tttaatttcg ataatttcga attaattgat tatttcgaat ctattaaatt aaaagaagct    173760
     gttataaaat cataaagggt tctaatggaa caagtccttg aagctgaaat cgttgagttc    173820
     gattctgaga aagctaaaat caataaagct caattaaatc ctgatgaaat aatccaatta    173880
     gatttagtag tagatgatta taataaatta agacaaatta ttttagctaa tgttgcgcaa    173940
     ttaaaagtta tgagtgataa cctagttcaa gaaatggaaa ttgaaggata taacccagac    174000
     ttagtaactg cttatagtaa actaattgaa acttcaaata agtctttaaa aattctaacc    174060
     gattcttata aagggatatc tgatatttta attaatatta ataaaattaa tgtattacat    174120
     ccaagcacag aagttaaaga agattttgaa gtcatttcga ctgctgatgt catcaaaaga    174180
     attcgagatt caaaaaagga ttaaatatta aaacaaagta tttcagatag gacaaattaa    174240
     atgcctttaa gtgtaaatga atttattaag aaaccaaaat attttaaacc ttttcttaat    174300
     aaattagaaa caaatgattt tttattagaa ggtgatcttg gtgtttttag ttttgattta    174360
     aaagacccca caaatattag attatttgaa ttaattaaaa gtatgaatgt tgatgctgta    174420
     gaacttttaa tatatgacaa agacactaaa aaatataaaa actttaaagg ttctattaat    174480
     ggaaagaaag gtgaagtacc ttttagcaaa attcataaat ctaatgtatc tggtattaca    174540
     ttaaaaggac aaaaaagtga taacaaagac gacttagcgg agtgcggtgt tgtatattat    174600
     ttggatatgt ttttaaatac taaattaact gatattaaat tctacactga aactcaagtt    174660
     aaaaatacta ggactaggac accattagat tctgttaaaa catttttatt tgaaaatcca    174720
     gattgggata aagcttgtaa agatgctgct aaatgtattc taaatgaaat tattttaaaa    174780
     caaaatctta gaaattatga atttcatcat aaaactgatg tttttaatga tcttaaaaaa    174840
     caaggtaaac aattaactaa attagcagag gataaatgga atccaggaga tttcttttta    174900
     gtcaaaccta catataaaat caaaaaatat aaaacatatc aagaacttaa caaagaaatt    174960
     aatgcttttg ataatataat acctataagt cttaagaaat ctactaaaga agctttaggc    175020
     ggttcttatg ctttgaataa tttatcaggt aattatggtt taccaaattt taaaagtatt    175080
     aaatataaat cattcgatga taattttttt aagtttttta aagaatgtat ggttgaatta    175140
     aagaagcata aaaattcaga tatcattaga gttagaacta ataacaataa tttagctgct    175200
     atttatagtg aaattgctag taatgctaaa gctgctaatt tttttgaagg attttcacca    175260
     agtttagcat ttatagctat gagttctgaa cattttaatg atattatatt tgaagttgtt    175320
     tgtaattgtt tgagtagatc tccattaagt tctaattttt ataaagtttc gggaaatcat    175380
     ttagaagtat ttgatagttt gccttcggat tttaaaatcg aatattgtgt tgtctcttgt    175440
     gatggtaatg ctgatatcaa atggaatgtt aagatagacg gtaaattatg gaaattacaa    175500
     ttaagatcta aaggttcttt accacaattt atgttagttc cacaaccagt aagttcttca    175560
     agccaagata aaaaaatcca agctattaaa gtttaaaaat ctacactcga gtgttagatc    175620
     tagcactata tttagtatcc aaataagtga ataaatacat aaaaaggatc ataatggcaa    175680
     aattaatcct acaaagagta caagaatgta ctaatgttag aaaaccaagt aaagaaaaaa    175740
     ttgaaggttc gacattatct gatttaatat tatatgatga taatgatcaa attctttgga    175800
     aaggtgctgc ttgcgaaaat gctggaccaa gcacagaaga atctggaact gataagcgca    175860
     taacagcagg ttcttataaa ttagaatggt gtgctagttc taaaaatact ggattggcta    175920
     aaaaatatcc acaatggtat aataaagatc gatcaactat agcaatttgg gttaaaagac    175980
     caaacgatgc taattttaac aatagattaa tcagaataca tattggaaat tacccacaag    176040
     atacggaagg ttgtatttta cctggtaaaa ccagaggtgc tggcattgtt tctagttcag    176100
     cagatgcttg caacgaactc tatactaaaa taaaagaaat tggaattaaa acagtagatt    176160
     ttattattaa agaaatcgaa gcttaaggat taaaatgaag gggttagtct ataaatcacc    176220
     acttaaagtt gatttagatt tagtagaatc ttacaaaggt aatatatttt tatatgatga    176280
     accaataaag aacgatccag aatatagtat tcaagattct attaatttgg tatctaaacc    176340
     agatcctgtg acttttagag aatctgtgac tttagacgat gctaaccact tcaatattga    176400
     ttttaatttt agtgaatctg tgatattaaa agattctaag tttgatataa cttccacgac    176460
     tattgattct gattttagca gagagtcaga ttcgaatact gacaaataaa taaatacaaa    176520
     aaaacaagga ttttaaatgt cagataagtt aaaattactt tatgaatatc acgatgctaa    176580
     tgtacttatc gaagaatcag ttaacgacaa aaaagaaaaa gttaaaaaat ataaaattgc    176640
     tggtattttt tcaacaatag gtgaaaaaaa ccgcaacggt agaatttacc caaaagaact    176700
     ctgggaaagt aatgttaaaa aatatcaaga cgttataaaa agcggttcta tcaatagact    176760
     ttgtgagtgg gaacaccctg aaagaggaac agttgatcct atggaagcag ttgctgctat    176820
     caataaactt gaaatcaatg gtaagtatgt tatgggtgaa gctacattgt tagataatcc    176880
     aagagctaac caattaaaat ccttaataga taatggtatc aaattgtcgg tatctagtag    176940
     aggttctggt agagttaaaa atggtattgt tgaatcattt gatttgatta cgtatgattt    177000
     agtatctgca ccaagcgatt ataatgctac tatggaaggg acctctatat atgaatcaca    177060
     aaaagaattt gtaatggtag acggtaaatt agtggaatcc aaaagttctg aagttgaaac    177120
     taaagattcc gacagtggcg atgctgatac taaagattct aataccgaag attcaaaact    177180
     aaaagaatct gtacttaaag aacatttctt agaatttatc gagattctta aaaataaaaa    177240
     caaataatta taatcacagg agttaaaaat gtatgacgat attgtaatga atgtaattca    177300
     aaataaaggg ttagcacaag caagcaatga tttcagagct attctaatta ataagtttga    177360
     tgatatgcca gaaattaggt caagactagc ttctatcgaa aaatataaaa atatgagaga    177420
     tttacaaatt tctgcaaaca ctgcatataa accagatcca gatttaattt cttaaacatt    177480
     taaaatccaa tctcaataga gctaacattt tagtaatttt aaaatgttag ctct          177534
//


spacer
spacer