spacer

EBI Dbfetch

ID   FN667018; SV 1; linear; genomic DNA; STD; HUM; 1876 BP.
XX
AC   FN667018;
XX
DT   10-FEB-2010 (Rel. 103, Created)
DT   10-FEB-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, allele
DE   HLA-C*05new, exons 2-4
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1876
RA   Keller E.;
RT   ;
RL   Submitted (08-FEB-2010) to the INSDC.
RL   Keller E., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Keller E., Zahn R., Klaus W.;
RT   "New HLA-C*05 allele";
RL   Unpublished.
XX
DR   MD5; 2c34fa5f2483ac7e4b02e1cd96dfc677.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1876
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="196329"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<95..364,656..931,1564..>1839)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:D3HUM0"
FT                   /db_xref="IMGT/HLA:C*05:37"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D3HUM0"
FT                   /protein_id="CBJ55212.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKKTLQRAEHPRTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW"
FT   exon            <95..364
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=2
FT   intron          365..655
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=2
FT   gap             465..564
FT                   /estimated_length=unknown
FT   exon            656..931
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=3
FT   intron          932..1563
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=3
FT   gap             1226..1325
FT                   /estimated_length=unknown
FT   exon            1564..>1839
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05new"
FT                   /number=4
XX
SQ   Sequence 1876 BP; 328 A; 499 C; 565 G; 284 T; 200 other;
     agaggagcga ggggcccgcc cggcgagggc gcaggacccg gggagccgcg cagggaggag        60
     ggtcgggcgg gtctcagccc ctcctcgccc ccaggctccc actccatgag gtatttctac       120
     accgccgtgt cccggcccgg ccgcggagag ccccgcttca tcgcagtggg ctacgtggac       180
     gacacgcagt tcgtgcagtt cgacagcgac gccgcgagtc caagagggga gccgcgggcg       240
     ccgtgggtgg agcaggaggg gccggagtat tgggaccggg agacacagaa gtacaagcgc       300
     caggcacaga ctgaccgagt gaacctgcgg aaactgcgcg gctactacaa ccagagcgag       360
     gccggtgagt gaccccggcc cggggcggag gtcacgaccc ctccccatcc cccacggacg       420
     gcccgggtcg ccccgagtct cccggtctga gatccacccc gaggnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnntttcat tttcagttta ggccaaaatc cccgcgggtt       600
     ggtcggggct ggggcggggc tcgggggacg gggctgacca cgggggcggg gccagggtct       660
     cacaccctcc agaggatgta tggctgcgac ctggggcccg acgggcgcct cctccgcggg       720
     tataaccagt tcgcctacga cggcaaggat tacatcgccc tgaatgagga cctgcgctcc       780
     tggaccgccg cggacaaggc ggctcagatc acccagcgca agtgggaggc ggcccgtgag       840
     gcggagcagc ggagagccta cctggagggc acgtgcgtgg agtggctccg cagatacctg       900
     gagaacggga agaagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca       960
     tctcctgtag atctcccggg atggcctccc acgaggaggg gaggaaaatg ggatcagcgc      1020
     tggaatatcg ccctcccttg aatggagaat gggatgagtt ttcctgagtt tcctctgagg      1080
     gccccctctg ctctctagga caattaaggg atgaagtcct tgaggaaatg gaggggaaga      1140
     cagtccctgg aatactgatc aggggtcccc tttgaccact ttgaccactg cagcagctgt      1200
     ggtcaggctg ctgacctttc tctcannnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnntgagt ccttcggcct ccactcaggt caggaccaga agtcgctgtt cctccctcag      1380
     agactagaac tttccaatga ataggagatt atcccaggtg cctgtgtcca ggctggcgtc      1440
     tgggttctgt gcccccttcc ccaccccagg tgtcctgtcc attctcagga tggtcacatg      1500
     ggcactgttg gagtgtcgca agagagatac aaagtgtctg aattttctga ctcttcccgt      1560
     cagaacaccc aaggacacac gtgacccacc atcccgtctc tgaccatgag gccaccctga      1620
     ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag cgggatggcg      1680
     aggaccaaac tcaggacacc gagcttgtgg agaccaggcc agcaggagat ggaaccttcc      1740
     agaagtgggc agctgtggtg gtgccttctg gagaagagca gagatacacg tgccatgtgc      1800
     agcacgaggg gctgccagag cccctcaccc tgagatgggg taaggagggg gatgaggggt      1860
     catgtgtctt ctcagg                                                      1876
//


spacer
spacer