spacer

EBI Dbfetch

ID   FN658993; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN658993;
XX
DT   21-JAN-2010 (Rel. 103, Created)
DT   21-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB*16, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Yang E.;
RT   ;
RL   Submitted (19-JAN-2010) to the INSDC.
RL   Yang E., Tzu Chi Stem Cells Center, Buddhist Tzu Chi General Hospital, 707
RL   Section 3 Chung Yang Road, Hualien 970, TAIWAN.
XX
RN   [2]
RA   Yang E.;
RT   "Detection of a novel DRB1*16 variant in a volunteer bone marrow donor in
RT   Taiwan";
RL   Unpublished.
XX
DR   MD5; 0aacf50c6a3b1d60d1b265cbae6766fc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Taiwan"
FT                   /isolation_source="bone marrow donor"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*16"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D2U823"
FT                   /db_xref="IMGT/HLA:DRB1*16:16"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D2U823"
FT                   /protein_id="CBJ18095.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAV
FT                   TELGRPDEEYWNSQKDLLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*16"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 65 C; 100 G; 47 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer