spacer

EBI Dbfetch

ID   FN658617; SV 1; linear; mRNA; STD; INV; 750 BP.
XX
AC   FN658617;
XX
DT   16-MAY-2010 (Rel. 104, Created)
DT   19-MAY-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Anastrepha amita mRNA for transformer-2 protein (tra-2 gene)
XX
KW   .
XX
OS   Anastrepha amita
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Tephritoidea;
OC   Tephritidae; Anastrepha.
XX
RN   [1]
RP   1-750
RA   Sanchez L.;
RT   ;
RL   Submitted (15-JAN-2010) to the INSDC.
RL   Sanchez L., Centro de Investigaciones Biologicas (CSIC), Ramiro de Maeztu
RL   9, 28040 Madrid, SPAIN.
XX
RN   [2]
RA   Sarno F., Ruiz M., Eirin-Lopez J., Perondini A.L.P., Selivon D.,
RA   Sanchez L.;
RT   "The gene transformer-2 of Anastrepha fruit flies (Diptera, Tephritidae)
RT   and its evolution in insects";
RL   Unpublished.
XX
DR   MD5; 80dc6f2e8af795c15c26866dcfbc1f2c.
DR   EuropePMC; PMC2885393; 20465812.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..750
FT                   /organism="Anastrepha amita"
FT                   /mol_type="mRNA"
FT                   /country="Brazil"
FT                   /dev_stage="adult"
FT                   /db_xref="taxon:95490"
FT   CDS             1..750
FT                   /gene="tra-2"
FT                   /product="transformer-2"
FT                   /db_xref="GOA:D6CHH0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:D6CHH0"
FT                   /protein_id="CBJ17290.1"
FT                   /translation="MSPRTRSRSISPRRSYSKSPARRSNGRRRHSREKVYNSRSRSASR
FT                   HPPSPPPLPAGRAGRYSDASKSSSTSLSPRHGRRVSRSRTRSPYDKRRANREKPVQNRC
FT                   IGVFGLSVYTTQQKIRDIFSRFGPIERIQVVIDAQTGRSRGFCFIYYQDIADAKAAKDA
FT                   CSGMEIDDRRIRVDYSTTQRPHTPTPGVYMGRYTRRERDNDRYRDDYRSRRRSVTPHNS
FT                   RNSYRGDRRRRYDRSRSRSYSPRRTRY"
XX
SQ   Sequence 750 BP; 193 A; 209 C; 178 G; 170 T; 0 other;
     atgagtccac gtacccgtag tcgtagcatt tccccgcgtc gaagttatag caaatcgccc        60
     gcgcggcgca gcaatggacg tcgccggcat tctagagaaa aagtgtataa ctctcgaagc       120
     cgttcagcct cacgacaccc tccttcacca ccaccgctac cagctggacg tgccggccgc       180
     tactcggatg ccagtaaaag ttcttcaacg tcactctcgc cacgtcatgg ccgccgcgtt       240
     tcccgttcgc gtacacgcag tccatacgat aagcgacgtg caaatcgcga aaagccagtg       300
     cagaatcgct gtataggagt tttcggtttg agtgtgtaca caacacagca aaaaatacgc       360
     gatatattct caagatttgg cccaatcgaa cgaatacaag ttgttattga tgcacagacc       420
     ggcagatctc gaggattttg ttttatttat tatcaggata tagccgatgc taaggcagct       480
     aaagacgctt gctcgggcat ggaaatcgat gatcgccgca tacgtgtcga ttactctaca       540
     acacaacgac cacatacacc tacaccgggc gtttatatgg ggcgttatac gcggcgtgaa       600
     cgtgataatg atcgttatcg tgatgattat cgctcccgtc gtcgatcggt tacgccccac       660
     aacagccgca atagctatcg aggagatcgc agacgccgat acgatcgcag ccgaagtcgt       720
     tcctattcac cgcggcgtac gcgctattaa                                        750
//


spacer
spacer