spacer

EBI Dbfetch

ID   FN658616; SV 1; linear; mRNA; STD; INV; 750 BP.
XX
AC   FN658616;
XX
DT   16-MAY-2010 (Rel. 104, Created)
DT   19-MAY-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Anastrepha bistrigata mRNA for transformer-2 protein (tra-2 gene)
XX
KW   .
XX
OS   Anastrepha bistrigata
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Tephritoidea;
OC   Tephritidae; Anastrepha.
XX
RN   [1]
RP   1-750
RA   Sanchez L.;
RT   ;
RL   Submitted (15-JAN-2010) to the INSDC.
RL   Sanchez L., Centro de Investigaciones Biologicas (CSIC), Ramiro de Maeztu
RL   9, 28040 Madrid, SPAIN.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-10-140.
RX   PUBMED; 20465812.
RA   Sarno F., Ruiz M.F., Eirin-Lopez J.M., Perondini A.L., Selivon D.,
RA   Sanchez L.;
RT   "The gene transformer-2 of Anastrepha fruit flies (Diptera, Tephritidae)
RT   and its evolution in insects";
RL   BMC Evol. Biol. 10(1):140-140(2010).
XX
DR   MD5; e547eabbaecddf8a7dac8de14feb47d5.
DR   EuropePMC; PMC2885393; 20465812.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..750
FT                   /organism="Anastrepha bistrigata"
FT                   /mol_type="mRNA"
FT                   /country="Brazil"
FT                   /dev_stage="adult"
FT                   /db_xref="taxon:95497"
FT   CDS             1..750
FT                   /gene="tra-2"
FT                   /product="transformer-2"
FT                   /db_xref="GOA:D6CHG9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:D6CHG9"
FT                   /protein_id="CBJ17289.1"
FT                   /translation="MSPRTRSRSISPRRSYSKSPARRSNGRRRHSREKVYNSRSRSASR
FT                   HPPSPPLLPAGRAGRYSDASKSSSTSLSPRHGRRVSRSRTRSPYDKRRANRQKPVQNRC
FT                   IGVFGLSVYTTQQKIRDIFSRFGPIERIQVVIDAQTGRSRGFCFIYYQDIADAKAAKDA
FT                   CSGMEIDDRRIRVDYSTTQRPHTPTPGVYMGRYTRRERDHDRYRDDYRSRRRSVTPYNS
FT                   RNSYRGDRRRRYDRSRSRSYSPRRTRY"
XX
SQ   Sequence 750 BP; 192 A; 207 C; 174 G; 177 T; 0 other;
     atgagtccac gtacccgtag tcgtagcatt tccccacgtc gaagttatag caaatcgccc        60
     gcgcggcgca gcaatgggcg tcgccggcat tctagagaaa aagtgtataa ctctcgaagc       120
     cgttcagcct cacgacaccc tccttcacca ccactgctac cagctggacg tgccggccgt       180
     tactcggatg ccagtaaaag ttcttcaacg tcactctcac cacgtcatgg ccgccgcgtt       240
     tcccgttcgc gtacacgcag tccatacgat aagcgacgtg ctaatcgcca aaagccagtg       300
     caaaaccgct gtataggagt tttcggtttg agtgtgtata cgacacagca aaaaatacgc       360
     gatatattct caagatttgg ccctatcgaa cgaatacaag ttgttattga tgcacagacc       420
     ggcagatctc gcggattttg ttttatttat tatcaagata tagccgatgc taaggcagct       480
     aaagacgctt gctcgggcat ggaaatcgat gatcgtcgta tacgtgtcga ttactctaca       540
     acacaacgac cacatacacc tacaccgggc gtttatatgg ggcgttatac gcggcgtgaa       600
     cgtgatcatg atcgttatcg tgatgattat cgctcccgtc gtcgatcggt tacgccctac       660
     aacagccgca atagctatcg aggagatcgc agacgccgat acgatcgcag ccgaagtcgt       720
     tcctattcac cgcggcgtac acgctattaa                                        750
//


spacer
spacer