spacer

EBI Dbfetch

ID   FN658612; SV 1; linear; mRNA; STD; INV; 750 BP.
XX
AC   FN658612;
XX
DT   16-MAY-2010 (Rel. 104, Created)
DT   19-MAY-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Anastrepha grandis mRNA for transformer-2 protein (tra-2 gene)
XX
KW   .
XX
OS   Anastrepha grandis (South American cucurbit fruit fly)
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Tephritoidea;
OC   Tephritidae; Anastrepha.
XX
RN   [1]
RP   1-750
RA   Sanchez L.;
RT   ;
RL   Submitted (15-JAN-2010) to the INSDC.
RL   Sanchez L., Centro de Investigaciones Biologicas (CSIC), Ramiro de Maeztu
RL   9, 28040 Madrid, SPAIN.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-10-140.
RX   PUBMED; 20465812.
RA   Sarno F., Ruiz M.F., Eirin-Lopez J.M., Perondini A.L., Selivon D.,
RA   Sanchez L.;
RT   "The gene transformer-2 of Anastrepha fruit flies (Diptera, Tephritidae)
RT   and its evolution in insects";
RL   BMC Evol. Biol. 10(1):140-140(2010).
XX
DR   MD5; 3ac9a8b971635f0cf4a279a2936fbe46.
DR   EuropePMC; PMC2885393; 20465812.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..750
FT                   /organism="Anastrepha grandis"
FT                   /mol_type="mRNA"
FT                   /country="Brazil"
FT                   /dev_stage="adult"
FT                   /db_xref="taxon:87114"
FT   CDS             1..750
FT                   /gene="tra-2"
FT                   /product="transformer-2"
FT                   /db_xref="GOA:D6CHG5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:D6CHG5"
FT                   /protein_id="CBJ17285.1"
FT                   /translation="MSPRTRSRSISPRRSYSKSPARRSNGRRRHSREKVYNSRSRSASR
FT                   HPPSPPPLPAGRAARYSDASKSSSTSLSPRHGRRVSRSRTRSPYDKRRANREKPVQNRC
FT                   IGVFGLSVYTTQQKIRDIFSRFGPIERIQVVIDAQTGRSRGFCFIYYQDIADAKAAKDA
FT                   CSGMEIDDRRIRVDYSTTQRPHTPTPGVYMGRYTRRERDHDRYRDDYRSRRRSVTPYNN
FT                   RNSYRGDRRRRYDRSRSRSYSPRRTRY"
XX
SQ   Sequence 750 BP; 193 A; 210 C; 172 G; 175 T; 0 other;
     atgagtccac gtacccgtag tcgtagcatt tccccgcgtc gaagttacag caaatcgccc        60
     gcgcggcgca gtaatggacg ccgccggcat tctagagaaa aagtgtataa ctctcgaagt       120
     cgttcagcct cacgacaccc tccttctcca ccaccgctac cagctggacg cgccgctcgt       180
     tactcggatg ccagtaaaag ttcttcaacg tcactctccc cacgtcatgg ccgccgcgtt       240
     tcccgttcac gtacacgcag tccatacgat aagcgacgtg ctaatcgcga aaagccagtg       300
     caaaatcgct gtataggagt tttcggtttg agtgtgtata cgacacagca aaaaatacgc       360
     gatatattct caagatttgg cccaattgaa cgaatacaag ttgttattga tgcacagacc       420
     ggcagatctc gaggattttg ttttatttat tatcaagata tagccgatgc taaggcagct       480
     aaagacgctt gctcgggcat ggaaatcgat gaccgtcgta tacgtgtcga ctactctaca       540
     acacaacgac cacatacacc tacaccgggc gtttatatgg ggcgttatac gcgccgtgaa       600
     cgcgatcatg atcgttatcg tgatgattat cgctcccgtc gtcgatcggt tacgccctac       660
     aacaaccgca atagctatcg aggagatcgc agacgccgat acgatcgcag ccgaagtcgt       720
     tcctattcac cgcggcgtac gcgctattaa                                        750
//


spacer
spacer