spacer

EBI Dbfetch

ID   FN658608; SV 1; linear; mRNA; STD; INV; 750 BP.
XX
AC   FN658608;
XX
DT   16-MAY-2010 (Rel. 104, Created)
DT   19-MAY-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Anastrepha aff. fraterculus 1 LS-2007 mRNA for transformer-2 protein (tra-2
DE   gene)
XX
KW   .
XX
OS   Anastrepha aff. fraterculus 1 LS-2007
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Tephritoidea;
OC   Tephritidae; Anastrepha.
XX
RN   [1]
RP   1-750
RA   Sanchez L.;
RT   ;
RL   Submitted (15-JAN-2010) to the INSDC.
RL   Sanchez L., Centro de Investigaciones Biologicas (CSIC), Ramiro de Maeztu
RL   9, 28040 Madrid, SPAIN.
XX
RN   [2]
RX   DOI; 10.1186/1471-2148-10-140.
RX   PUBMED; 20465812.
RA   Sarno F., Ruiz M.F., Eirin-Lopez J.M., Perondini A.L., Selivon D.,
RA   Sanchez L.;
RT   "The gene transformer-2 of Anastrepha fruit flies (Diptera, Tephritidae)
RT   and its evolution in insects";
RL   BMC Evol. Biol. 10(1):140-140(2010).
XX
DR   MD5; 7ffad0f0bf2dc6cb038b9e840a0b91b7.
DR   EuropePMC; PMC2885393; 20465812.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..750
FT                   /organism="Anastrepha aff. fraterculus 1 LS-2007"
FT                   /mol_type="mRNA"
FT                   /country="Brazil"
FT                   /dev_stage="adult"
FT                   /db_xref="taxon:474448"
FT   CDS             1..750
FT                   /transl_table=1
FT                   /gene="tra-2"
FT                   /product="transformer-2"
FT                   /db_xref="GOA:D6CHG1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:D6CHG1"
FT                   /protein_id="CBJ17281.1"
FT                   /translation="MSPRTRSRSISPRRSYSKSPARRSNGRRRHSREKVYNSRSRSASR
FT                   HPPSPPPLPAGRAGRYSDASKSSSTSLSPRHGRRVSRSRTRSPYDKRRANREKPVQNRC
FT                   IGVFGLSVYTTQQKIRDIFSRFGPIERIQVVIDAQTGRSRGFCFIYYQDIADAKAAKDA
FT                   CSGMEIDDRRIRVDYSTTQRPHTPTPGVYMGRYTRRERDHDRYRDDYRSRRRSVTPHNS
FT                   RNSYRGDRRRRYDRSRSRSYSPRRTRY"
XX
SQ   Sequence 750 BP; 189 A; 208 C; 179 G; 174 T; 0 other;
     atgagtccac gtacccgtag tcgtagcatt tccccgcgtc gaagttatag caaatcgccc        60
     gcgcggcgta gcaatggacg tcgccggcat tctagagaaa aagtgtataa ctctcgaagc       120
     cgttcagcct cacgacaccc tccttcacca ccaccgctac cagctggacg tgccggccgt       180
     tactcggatg ccagtaaaag ttcttcaacg tcactctccc cacgtcatgg ccgccgcgtt       240
     tcccgttcgc gtacacgcag tccgtacgat aagcgacgtg ctaatcgcga aaagccagtg       300
     caaaatcgct gtataggagt tttcggtttg agcgtgtata cgacacagca gaaaatacgc       360
     gatatattct caagatttgg cccaatcgaa cgaatacaag ttgttattga tgcacagacc       420
     ggcagatctc gaggattttg ttttatttat tatcaggata tagccgatgc taaggcagct       480
     aaagacgctt gctcgggcat ggaaatcgat gatcgccgta tacgtgtcga ttactctaca       540
     acacaacgac cacatacacc tacaccgggc gtttatatgg ggcgttatac gcggcgtgaa       600
     cgtgatcatg atcgttatcg tgatgattat cgctcccgtc gtcgatcggt tacgccccac       660
     aacagccgca atagctatcg aggagatcgc agacgccgat acgatcgcag ccgaagtcgt       720
     tcctattcac cgcggcgtac gcgctattaa                                        750
//


spacer
spacer