Dbfetch

ID   FN651783; SV 1; linear; genomic DNA; STD; HUM; 878 BP.
XX
AC   FN651783;
XX
DT   14-JAN-2010 (Rel. 103, Created)
DT   14-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*5901
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-878
RA   Witter K.;
RT   ;
RL   Submitted (12-JAN-2010) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Improvement of HLA-DPB1 typing resolution by allele specific sequencing
RT   and exon 3 sequence determination";
RL   Unpublished.
XX
DR   MD5; dd4c0ee7eb4bf8664f3e616a4a4768b0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..878
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<43..306,445..>726)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5901"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:D2U7E3"
FT                   /db_xref="IMGT/HLA:DPB1*59:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D2U7E3"
FT                   /protein_id="CBJ05875.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDLLEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSMDSPVTVEW"
FT   exon            43..306
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5901"
FT                   /number=2
FT   intron          307..444
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5901"
FT                   /number=2
FT   gap             331..429
FT                   /estimated_length=99
FT   exon            445..726
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*5901"
FT                   /number=3
XX
SQ   Sequence 878 BP; 165 A; 223 C; 232 G; 159 T; 99 other;
     ttgagagtgg cgcctccgct catgtccgcc ccctccccgc agagaattac cttttccagg        60
     gacggcagga atgctacgcg tttaatggga cacagcgctt cctggagaga tacatctaca       120
     accgggagga gttcgtgcgc ttcgacagcg acgtggggga gttccgggcg gtgacggagc       180
     tggggcggcc tgatgaggag tactggaaca gccagaagga cctcctggag gagaagcggg       240
     cagtgccgga caggatgtgc agacacaact acgagctggg cgggcccatg accctgcagc       300
     gccgaggtga gtgagggctt tgggccggcg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnt cttcacgctc ctagtccagc ctagggtgaa tgtttccccc tccaagaagg       480
     ggcccttgca gcaccacaac ctgcttgtct gccacgtgac ggatttctac ccaggcagca       540
     ttcaagtccg atggttcctg aatggacagg aggaaacagc tggggtcgtg tccaccaacc       600
     tgatccgtaa tggagactgg accttccaga tcctggtgat gctggaaatg accccccagc       660
     agggagatgt ctacacctgc caagtggagc acaccagcat ggatagtcct gtcaccgtgg       720
     agtggagtga gtctctgatg accctctaga ccccacctct gaagagcagg ggactctctg       780
     gctctggggt ccactcatct tatcttctgc atctataccc tggggccatg tccaaacccc       840
     atctttcttc tataccagct cctgagcata gtttgaag                               878
//