spacer

EBI Dbfetch

ID   FN640478; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN640478;
XX
DT   11-MAR-2010 (Rel. 104, Created)
DT   11-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*04new
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Longhi E.;
RT   ;
RL   Submitted (11-DEC-2009) to the INSDC.
RL   Longhi E., MA.RE., Fondazione IRCCS Ospedale, Maggiore Policlinico, UOC
RL   Medicina Rigenerativa, Dip, Immunologia Trapianti., Via F. Sforza, 35 -
RL   20122 Milano, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Identification of a new HLA-DRB1*04 allele";
RL   Unpublished.
XX
DR   MD5; 055ba6bccd4a1332ded837f045939bcc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:D3UTA6"
FT                   /db_xref="IMGT/HLA:DRB1*04:04:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D3UTA6"
FT                   /protein_id="CBI71214.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 66 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer