Dbfetch

ID   FN600162; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   FN600162;
XX
DT   03-MAR-2010 (Rel. 104, Created)
DT   03-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*11new
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Longhi E.;
RT   ;
RL   Submitted (03-DEC-2009) to the INSDC.
RL   Longhi E., Maggiore Policlinico, MA.RE., Fondazione IRCCS Ospedale, UOC
RL   Medicina Rigenerativa, Dip, Immunologia Trapianti., Via F. Sforza, 35
RL   -20122 Milano, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Identification of a new HLA-DRB1*11 allele";
RL   Unpublished.
XX
DR   MD5; fcf3d3feb66c276135a21e57ff2b20bd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D3UT98"
FT                   /db_xref="IMGT/HLA:DRB1*11:90"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D3UT98"
FT                   /protein_id="CBI69378.1"
FT                   /translation="RFLEYSTSECHFFNGTERMRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 96 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcggatgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//