spacer

EBI Dbfetch

ID   FN599520; SV 1; linear; genomic DNA; STD; HUM; 778 BP.
XX
AC   FN599520;
XX
DT   03-DEC-2009 (Rel. 103, Created)
DT   03-DEC-2009 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*3901
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-778
RA   Witter K.;
RT   ;
RL   Submitted (02-DEC-2009) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Improvement of HLA-DPB1 typing resolution by allele specific sequencing
RT   and exon 3 sequence determination";
RL   Unpublished.
XX
DR   MD5; 44b345dea382440c5580b07f34d31c7a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..778
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<30..293,469..>750)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3901"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:D2ECG1"
FT                   /db_xref="IMGT/HLA:DPB1*39:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D2ECG1"
FT                   /protein_id="CBI68355.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            30..293
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3901"
FT                   /number=2
FT   intron          294..468
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3901"
FT                   /number=2
FT   gap             320..419
FT                   /estimated_length=unknown
FT   exon            469..750
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3901"
FT                   /number=3
XX
SQ   Sequence 778 BP; 148 A; 192 C; 205 G; 133 T; 100 other;
     ctccgctcat gtccgccccc tccccgcaga gaattacctt ttccagggac ggcaggaatg        60
     ctacgcgttt aatgggacac agcgcttcct ggagagatac atctacaacc gggaggagta       120
     cgcgcgcttc gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctgc       180
     tgcggagtac tggaacagcc agaaggacat cctggaggag aagcgggcag tgccggacag       240
     gatgtgcaga cacaactacg agctgggcgg gcccatgacc ctgcagcgcc gaggtgagtg       300
     agggctttgg gccggcggtn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng       420
     aaggacaatc tcaaattcta tttcattatt tttcttccac gctcctagtc cagcctaggg       480
     tgaatgtttc cccctccaag aaggggccct tgcagcacca caacctgctt gtctgccacg       540
     tgacggattt ctacccaggc agcattcaag tccgatggtt cctgaatgga caggaggaaa       600
     cagctggggt cgtgtccacc aacctgatcc gtaatggaga ctggaccttc cagatcctgg       660
     tgatgctgga aatgaccccc cagcagggag atgtctacac ctgccaagtg gagcacacca       720
     gcctggatag tcctgtcacc gtggagtgga gtgagtctct gatgaccctc tagacccc         778
//


spacer
spacer