Dbfetch

ID   FN594948; SV 1; linear; genomic DNA; STD; HUM; 903 BP.
XX
AC   FN594948;
XX
DT   23-NOV-2009 (Rel. 102, Created)
DT   23-NOV-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*3001
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-903
RA   Witter K.;
RT   ;
RL   Submitted (19-NOV-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Improvement of HLA-DPB1 typing resolution by allele specific sequencing
RT   and exon 3 sequence determination";
RL   Unpublished.
XX
DR   MD5; efb7eda60deb2da6c3054b09c2b082fc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..903
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<41..304,574..>855)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3001"
FT                   /product="MHC class II antigen"
FT                   /function="anitgen presenting molecule"
FT                   /db_xref="GOA:D1H104"
FT                   /db_xref="IMGT/HLA:DPB1*30:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D1H104"
FT                   /protein_id="CBH51783.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPEAEYWNSQKDILEEERAVPDRMCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            41..304
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3001"
FT                   /number=2
FT   intron          305..573
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3001"
FT                   /number=2
FT   gap             323..490
FT                   /estimated_length=168
FT   exon            574..855
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*3001"
FT                   /number=3
XX
SQ   Sequence 903 BP; 175 A; 193 C; 232 G; 135 T; 168 other;
     gagagtggcg cctccgctca tgtccgcccc ctccccgcag agaattacgt gcaccagtta        60
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       120
     cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg aggcggagta ctggaacagc cagaaggaca tcctggagga ggagcgggca       240
     gtgccggaca ggatgtgcag acacaactac gagctggacg aggccgtgac cctgcagcgc       300
     cgaggtgagt gagggctttg ggnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn aggaaggaag gaaggaagga aggaaggaag gaaagaagga caatctcaaa       540
     ttctatttca ttatttttct tccacgctcc tagtccagcc tagggtgaat gtttccccct       600
     ccaagaaggg gcccttgcag caccacaacc tgcttgtctg ccacgtgacg gatttctacc       660
     caggcagcat tcaagtccga tggttcctga atggacagga ggaaacagct ggggtcgtgt       720
     ccaccaacct gatccgtaat ggagactgga ccttccagat cctggtgatg ctggaaatga       780
     ccccccagca gggagatgtc tacacctgcc aagtggagca caccagcctg gatagtcctg       840
     tcaccgtgga gtggagtgag tctctgatga ccctctagac cccacctctg aagagcaggg       900
     gac                                                                     903
//