Dbfetch

ID   FN594947; SV 1; linear; genomic DNA; STD; HUM; 853 BP.
XX
AC   FN594947;
XX
DT   23-NOV-2009 (Rel. 102, Created)
DT   23-NOV-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*1001
DE   allele, exons 2-3
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-853
RA   Witter K.;
RT   ;
RL   Submitted (19-NOV-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Improvement of HLA-DPB1 typing by allele specific sequencing and exon 3
RT   sequence determination";
RL   Unpublished.
XX
DR   MD5; 74fde6c14b47cf133d81a418cc3ae4f6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..853
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<30..293,431..>712)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1001"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D1H103"
FT                   /db_xref="IMGT/HLA:DPB1*10:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D1H103"
FT                   /protein_id="CBH51782.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YICQVEHTSLDSPVTVEW"
FT   exon            30..293
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1001"
FT                   /number=2
FT   intron          294..430
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1001"
FT                   /number=2
FT   gap             318..417
FT                   /estimated_length=unknown
FT   exon            431..712
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*1001"
FT                   /number=3
XX
SQ   Sequence 853 BP; 162 A; 221 C; 223 G; 147 T; 100 other;
     ctccgctcat gtccgccccc tccccgcaga gaattacgtg caccagttac ggcaggaatg        60
     ctacgcgttt aatgggacac agcgcttcct ggagagatac atctacaacc gggaggagtt       120
     cgtgcgcttc gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga       180
     tgaggagtac tggaacagcc agaaggacat cctggaggag gagcgggcag tgccggacag       240
     ggtatgcaga cacaactacg agctggacga ggccgtgacc ctgcagcgcc gaggtgagtg       300
     agggctttgg gccggcgnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnttc       420
     ccactcgtag tccagcctaa ggtgaacgtt tccccctcca agaaggggcc cctgcagcac       480
     cacaacctgc ttgtctgcca cgtgacagat ttctacccag gcagcattca agtccgatgg       540
     ttcctgaatg gacaggagga aacagctggg gtcgtgtcca ccaacctgat ccgtaatgga       600
     gactggacct tccagatcct ggtgatgctg gaaatgaccc cccagcaggg agacgtctac       660
     atctgccaag tggagcacac cagcctggac agtcctgtca ccgtggagtg gagtgagtct       720
     ctgatgaccg tctagacccc acctctgaag agcaggggac tctctggctc tggggtccac       780
     tcatcttatc ttctgcatct ataccctggg gccatgtcca aaccccatct ttcttctata       840
     ccagctcctg agc                                                          853
//