Dbfetch

ID   FN568089; SV 1; linear; genomic DNA; STD; HUM; 1801 BP.
XX
AC   FN568089;
XX
DT   11-DEC-2009 (Rel. 103, Created)
DT   11-DEC-2009 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, HLA-Cw*08 allele, exons
DE   1-8
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1801
RA   Nesci S.;
RT   ;
RL   Submitted (12-NOV-2009) to the INSDC.
RL   Nesci S., Azienda Ospedale San Salvatore, Laboratorio Di Tipizzazione
RL   Tissutale, Via Lombroso, Pesaro 61100, ITALY.
XX
RN   [2]
RA   Iliescu A.;
RT   "Identification of a new HLA-Cw*08 allele: sequence nucleotide analysis
RT   from exon 1 through exon 8";
RL   Unpublished.
XX
DR   MD5; b2d92ce1aaf123d9016c90c6d5210e8f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1801
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..73,174..443,544..819,920..1195,1296..1415,
FT                   1516..1548,1649..1696,1797..1801)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D2EBJ4"
FT                   /db_xref="IMGT/HLA:C*08:31"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D2EBJ4"
FT                   /protein_id="CBH40210.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKA
FT                   AQITQRKWEAAREAEQWRAYLEGECVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            <1..73
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..1415
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /number=5
FT   gap             1416..1515
FT                   /estimated_length=unknown
FT   exon            1516..1548
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /number=6
FT   gap             1549..1648
FT                   /estimated_length=unknown
FT   exon            1649..1696
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /number=7
FT   gap             1697..1796
FT                   /estimated_length=unknown
FT   exon            1797..>1801
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*08"
FT                   /number=8
XX
SQ   Sequence 1801 BP; 220 A; 335 C; 372 G; 174 T; 700 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca ccgccgtgtc ccggcccggc cgcggagagc cccgcttcat       240
     cgcagtgggc tacgtggacg acacgcagtt cgtgcagttc gacagcgacg ccgcgagtcc       300
     aagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaag tacaagcgcc aggcacagac tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggta taaccagttc gcctacgacg gcaaggatta catcgccctg aatgaggacc       660
     tgcgctcctg gaccgccgcg gacaaggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgaggc ggagcagtgg agagcctacc tggagggcga gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag aagacgctgc agcgcgcggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acacccaaag acacacgtga cccaccatcc cgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggcgagga ccaaactcag gacaccgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga      1140
     tacacgtgcc atgtgcagca cgaggggctg ccagagcccc tcaccctgag atgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggcca tcttcccagc ccaccatccc      1320
     catcgtgggc atcgttgctg gcctggctgt cctggctgtc ctagctgtcc taggagctgt      1380
     gatggctgtt gtgatgtgta ggaggaagag ctcagnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnngtgga aaaggaggga gctgctctca ggctgcgtnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnncc agcaacagtg cccagggctc tgatgagtct      1680
     ctcatcgctt gtaaagnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnncctg      1800
     a                                                                      1801
//