spacer

EBI Dbfetch

ID   FN557302; SV 1; linear; genomic DNA; STD; HUM; 1536 BP.
XX
AC   FN557302;
XX
DT   24-OCT-2009 (Rel. 102, Created)
DT   24-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*36new
DE   allele, exons 2-4, clone 170705
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1536
RA   Keller E.;
RT   ;
RL   Submitted (22-OCT-2009) to the INSDC.
RL   Keller E., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Keller E., Witter K., Zahn R.;
RT   "New HLA-A*36 allele";
RL   Unpublished.
XX
DR   MD5; a0729458ca19292733735ddc48978e2d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1536
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /clone="170705"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<124..393,635..910,1228..>1503)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*36new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:D0RB02"
FT                   /db_xref="IMGT/HLA:A*36:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D0RB02"
FT                   /protein_id="CBH26012.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDCKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGTC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            124..393
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*36new"
FT                   /number=2
FT   intron          394..634
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*36new"
FT                   /number=2
FT   exon            635..910
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*36new"
FT                   /number=3
FT   intron          911..1227
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*36new"
FT                   /number=3
FT   gap             1120..1219
FT                   /estimated_length=unknown
FT   exon            1228..1503
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*36new"
FT                   /number=4
XX
SQ   Sequence 1536 BP; 280 A; 442 C; 497 G; 217 T; 100 other;
     cggggtcggg agggaaaccg cctctgcggg gagaagcaag gggccctcct ggcgggggcg        60
     caggaccggg ggagccgcgc cgggaggagg gtcgggcagg tctcagccac tgctcgcccc       120
     caggctccca ctccatgagg tatttcttca catccgtgtc ccggcccggc cgcggggagc       180
     cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg       240
     ccgcgagcca gaagatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt       300
     gggaccagga gacacggaat atgaaggccc actcacagac tgaccgagcg aacctgggga       360
     ccctgcgcgg ctactacaac cagagcgagg acggtgagtg accccggccc ggggcgcagg       420
     tcacgacccc tcatccccca cggacgggcc aggtcgccca cagtctccgg gtccgagatc       480
     caccccgaag ccgcgggact ccgagaccct tgtcccggga gaggcccagg cgcctttacc       540
     cggtttcatt ttcagtttag gccaaaaatc cccccgggtt ggtcggggcg gggcggggct       600
     cgggggactg ggctgaccgc ggggtcgggg ccaggttctc acaccatcca gataatgtat       660
     ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt accggcagga cgcctacgac       720
     tgcaaggatt acatcgccct gaacgaggac ctgcgctctt ggaccgcggc ggacatggca       780
     gctcagatca ccaagcgcaa gtgggaggcg gtccatgcgg cggagcagcg gagagtctac       840
     ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg       900
     cagcgcacgg gtaccagggg ccacggggcg cctccctgat cgcctataga tctcccgggc       960
     tggcctccca caaggagggg agacaattgg gaccaacact agaatatcac cctccctctg      1020
     gtcctgaggg agaggaatcc tcctgggttt ccagatcctg taccagagag tgactctgag      1080
     gttccgccct gctctctgac acaattaagg gataaaatcn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnc ccgtcagacc cccccaagac acatatgacc caccacccca      1260
     tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca      1320
     cactgacctg gcagcgggat ggggaggacc agacccagga cacggagctc gtggagacca      1380
     ggcctgcagg ggatggaacc ttccagaagt gggcggctgt ggtggtgcct tctggagagg      1440
     agcagagata cacctgccat gtgcagcatg agggtctgcc caagcccctc accctgagat      1500
     ggggtaagga gggagatggg ggtgtcatgt ctttta                                1536
//


spacer
spacer