Dbfetch

ID   FN555527; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   FN555527;
XX
DT   10-OCT-2009 (Rel. 102, Created)
DT   20-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*new
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   McWhinnie A.J.;
RT   ;
RL   Submitted (09-OCT-2009) to the INSDC.
RL   McWhinnie A.J., Research Institute, Anthony Nolan Trust, Fleet Road,
RL   Hampstead, London., NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2010.01562.x.
RX   PUBMED; 20887382.
RA   Kanga U., McWhinnie A.J., Mourya M., Shaw B.E., Madrigal J.A., Mehra N.K.;
RT   "A novel HLA-DPB1 allele, DPB1*125:01, identified by sequence-based typing
RT   in an Indian individual";
RL   Tissue Antigens 77(1):85-87(2011).
XX
DR   MD5; bf25c7d2fa3ace2671685b41a7f15767.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="India"
FT                   /clone="UMKA9360A1"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:D0AB33"
FT                   /db_xref="IMGT/HLA:DPB1*125:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D0AB33"
FT                   /protein_id="CBG92013.1"
FT                   /translation="NYVHQLRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRR"
XX
SQ   Sequence 264 BP; 62 A; 66 C; 97 G; 39 T; 0 other;
     agaattacgt gcaccagtta cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgcgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg ctgcggagta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca gggtatgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc cgag                                              264
//