Dbfetch

ID   FN555432; SV 1; linear; genomic DNA; STD; HUM; 937 BP.
XX
AC   FN555432;
XX
DT   10-OCT-2009 (Rel. 102, Created)
DT   10-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*new
DE   allele, exons 2-3, lab code 196660
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-937
RA   Witter K.;
RT   ;
RL   Submitted (08-OCT-2009) to the INSDC.
RL   Witter K., Laboratory of Immunogenetics, University of Munich,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "Recombination of exon 2 of DPB1*030101 and exon 3 of DPB1*040101 reveals a
RT   new HLA-DPB1 allele, DPB1*xxxx, in a bone marrow recipient patient";
RL   Unpublished.
XX
DR   MD5; 06b4ac861d5a88521ed547d462ba3c7f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..937
FT                   /organism="Homo sapiens"
FT                   /isolate="lab code 196660"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="bone marrow recipient"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<41..304,516..>797)
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:D0AB31"
FT                   /db_xref="IMGT/HLA:DPB1*124:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D0AB31"
FT                   /protein_id="CBG91975.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDLLEEKRAVPDRVCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQH
FT                   HNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDV
FT                   YTCQVEHTSLDSPVTVEW"
FT   exon            41..304
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   intron          305..515
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=2
FT   gap             320..419
FT                   /estimated_length=unknown
FT   exon            516..797
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*new"
FT                   /number=3
XX
SQ   Sequence 937 BP; 198 A; 225 C; 247 G; 167 T; 100 other;
     gagagtggcg cctccgctca tgtccgcccc ctccccgcag agaattacgt gtaccagtta        60
     cggcaggaat gctacgcgtt taatgggaca cagcgcttcc tggagagata catctacaac       120
     cgggaggagt tcgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg atgaggacta ctggaacagc cagaaggacc tcctggagga gaagcgggca       240
     gtgccggaca gggtatgcag acacaactac gagctggacg aggccgtgac cctgcagcgc       300
     cgaggtgagt gagggctttn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnna       420
     aggaaggaag gaaggaagga aggaaggaag gaaggaagga aggaaagaag gacaatctca       480
     aattctattt cattattttt cttccacgct cctagtccag cctagggtga atgtttcccc       540
     ctccaagaag gggcccttgc agcaccacaa cctgcttgtc tgccacgtga cggatttcta       600
     cccaggcagc attcaagtcc gatggttcct gaatggacag gaggaaacag ctggggtcgt       660
     gtccaccaac ctgatccgta atggagactg gaccttccag atcctggtga tgctggaaat       720
     gaccccccag cagggagatg tctacacctg ccaagtggag cacaccagcc tggatagtcc       780
     tgtcaccgtg gagtggagtg agtctctgat gaccctctag accccacctc tgaagagcag       840
     gggactctct ggctctgggg tccactcatc ttatcttctg catctatacc ctggggccat       900
     gtccaaaccc catctttctt ctataccagc tcctgag                                937
//