spacer

EBI Dbfetch

ID   FN555147; SV 1; linear; genomic DNA; STD; HUM; 386 BP.
XX
AC   FN555147;
XX
DT   06-OCT-2009 (Rel. 102, Created)
DT   15-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*04new
DE   allele, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-386
RA   Witter K.;
RT   ;
RL   Submitted (05-OCT-2009) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2010.01492.x.
RX   PUBMED; 20403150.
RA   Witter K., Zahn R., Volgger A., Reininger A.J.;
RT   "HLA-DQB1*0404, a novel DQB1-allele detected in a volunteer blood platelet
RT   donor typed for HLA";
RL   Tissue Antigens 76(3):256-258(2010).
XX
DR   MD5; 6c2c30afec05c005de248eb79d36dcb1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..386
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="thrombocyte"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             <110..>379
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:D0AB13"
FT                   /db_xref="IMGT/HLA:DQB1*04:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:D0AB13"
FT                   /protein_id="CBG76583.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQRR"
FT   exon            110..379
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04"
FT                   /number=2
XX
SQ   Sequence 386 BP; 68 A; 107 C; 152 G; 59 T; 0 other;
     tcgcgcgggg cggttccaca gctccaggcc gggtcagggc ggcggctgcg ggggcggccg        60
     ggctggggcc gggccggggc ctgactgacc ggccggtgat tccccgcaga ggatttcgtg       120
     taccagttta agggcatgtg ctacttcacc aacgggaccg agcgcgtgcg gggtgtgacc       180
     agatacatct ataaccgaga ggagtacgcg cgcttcgaca gcgacgtggg ggtgtatcgg       240
     gcggtgacgc cgctggggcg gcttgacgcc gagtactgga atagccagaa ggacatcctg       300
     gaggaggacc gggcgtcggt ggacaccgta tgcagacaca actaccagtt ggagctccgc       360
     acgaccttgc agcggcgagg tgagcg                                            386
//


spacer
spacer