Dbfetch

ID   FN555101; SV 1; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   FN555101;
XX
DT   07-JAN-2010 (Rel. 103, Created)
DT   07-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, exons 2-4,
DE   HLA-B*52new null allele
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Longhi E.;
RT   ;
RL   Submitted (01-OCT-2009) to the INSDC.
RL   Longhi E., MA.RE., Fondazione IRCCS Ospedale, Maggiore Policlinico, UOC
RL   Medicina Rigenerativa, Dip, Immunologia Trapianti., Via F. Sforza, 35 -
RL   20122 Milano, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Identification of a new HLA-B52 null allele";
RL   Unpublished.
XX
DR   MD5; 4548c0de937d2e3dcd663d3d42bb3a82.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new"
FT   CDS             join(<1..270,371..447)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new null"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:D2U546"
FT                   /db_xref="IMGT/HLA:B*57:28N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:D2U546"
FT                   /protein_id="CBG76065.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGP
FT                   DGRLLRGHNQ"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new null"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new null"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..>1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52new null"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 176 A; 252 C; 278 G; 116 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     acggggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccaggtg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtaggcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagcggaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca catgtgaccc accaccccat       780
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag       900
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acatgccatg tacagcatga ggggctgcca aagcccctca ccctgagatg      1020
     gg                                                                     1022
//