Dbfetch

ID   FN554870; SV 1; linear; genomic DNA; STD; HUM; 1018 BP.
XX
AC   FN554870;
XX
DT   02-OCT-2009 (Rel. 102, Created)
DT   02-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*44new
DE   allele, exon 2-4, isolate 09781664
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1018
RA   Skrablin P.S.A.;
RT   ;
RL   Submitted (29-SEP-2009) to the INSDC.
RL   Skrablin P.S.A., RCBDS Baden-Wuerttemberg - Hessen, Institute of
RL   Transfusion Medicine and Im, Sandhofstrasse 1, 60528 Frankfurt am Main,
RL   Hessen, GERMANY.
XX
RN   [2]
RA   Skrablin P.S., Richter R., Brixner V., Seifried E., Seidl C.;
RT   "HLA-B*44new allele identified in a voluntary blood stem cell donor of
RT   caucasian origin";
RL   Unpublished.
XX
DR   MD5; ee2df96608645f05763e893173423a08.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1018
FT                   /organism="Homo sapiens"
FT                   /isolate="09781664"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /identified_by="Anja Koerner"
FT                   /sex="male"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..266,367..642,743..>1018)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="IMGT/HLA:B*44:101"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C9YSQ4"
FT                   /protein_id="CBG37836.1"
FT                   /translation="LPLHEVFLHRHVPARPRGAPLHHRGLRGRHAVREVRQRRHESEEG
FT                   AAGAMDRAGGAGVLGPGDTDLQDQHTDLPREPAHRAPLLQPERGSHIIQRMYGCDVGPD
FT                   GRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCV
FT                   ESFRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQ
FT                   TQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..266
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=2
FT   gap             267..366
FT                   /estimated_length=unknown
FT   exon            367..642
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=3
FT   gap             643..742
FT                   /estimated_length=unknown
FT   exon            743..>1018
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44"
FT                   /number=4
XX
SQ   Sequence 1018 BP; 182 A; 253 C; 268 G; 115 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgagnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnggtc tcacatcatc cagaggatgt acggctgcga cgtggggccg gacgggcgcc       420
     tcctccgcgg gtatgaccag gacgcctacg acggcaagga ttacatcgcc ctgaacgagg       480
     acctgagctc ctggaccgcg gcggacaccg cggctcagat cacccagcgc aagtgggagg       540
     cggcccgtgt ggcggagcag gacagagcct acctggaggg cctgtgcgtg gagtcgttcc       600
     gcagatacct ggagaacggg aaggagacgc tgcagcgcgc ggnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnacccccca aagacacatg tgacccacca ccccatctct       780
     gaccatgagg tcaccctgag gtgctgggcc ctgggcttct accctgcgga gatcacactg       840
     acctggcagc gggatggcga ggaccaaact caggacaccg agcttgtgga gaccagacca       900
     gcaggagata gaaccttcca gaagtgggca gctgtggtgg tgccttctgg agaagagcag       960
     agatacacat gccatgtaca gcatgagggg ctgccgaagc ccctcaccct gagatggg        1018
//